F438682

General Info

Members Datasets Scaffolds Average Seq Length
415 260 830 307

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221596|2643991224
Length 346
Sequence TPGKPPCGFHIRANPKNRAGRQPALRQSTGREPPGGLPCIKYSRCVNYAFLLLPDFSLIFLGYLICRYTALNRSVWQPVESLVYYLLFPVLLFQSIVKSPMDIGAASGLIGAGMLSGVIGIALAYSLPHWPWLGKHIDVRDHAASAQVAFRFNSFIGLAIAERLAGTQGLLMIAVLIGVCVPLFNVAAVWPMARHGQHSFARELLRNPLIIATASGLAANLLGFQIPEWAVPTVSRISAASLALGLMAAGAGLQFGLLTRGKVLSVSVLAIRHLVQPLVAFGMARMFGLDAVQTTVLLAFAALPTASTCYVLAARMGYNGPYVAGLVTLSTLLGMVSLPFALGVLR

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
99 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
100 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
101 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
121 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
122 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
127 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
128 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
129 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
130 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
131 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
132 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
133 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
134 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
135 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
136 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
143 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
192 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
193 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
194 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
195 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
196 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
197 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
198 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
199 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
200 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
201 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
202 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
203 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
208 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
209 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
213 2643221596 Acidovorax sp. Root70 Isolate Unclassified
214 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
215 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
216 2547132374 Acidovorax radicis N35 Isolate Unclassified
217 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
218 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
219 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
220 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
221 2643221570 Acidovorax sp. Root568 Isolate Unclassified
222 2643221609 Acidovorax sp. Root217 Isolate Unclassified
223 2643221611 Acidovorax sp. Root219 Isolate Unclassified
224 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
225 2643221652 Acidovorax sp. Root402 Isolate Unclassified
226 2643221658 Variovorax sp. Root411 Isolate Unclassified
227 2643221672 Variovorax sp. Root434 Isolate Unclassified
228 2643221683 Variovorax sp. Root473 Isolate Unclassified
229 2643221717 Acidovorax sp. Root267 Isolate Unclassified
230 2738541277 Variovorax sp. GV051 Isolate Unclassified
231 2738541307 Variovorax sp. GV008 Isolate Unclassified
232 2738543012 Acidovorax sp. CF301 Isolate Unclassified
233 2738543019 Variovorax sp. GV040 Isolate Unclassified
234 2816332133 Acidovorax radicis 2721A Isolate Unclassified
235 2818991446 Variovorax sp. 1180 Isolate Unclassified
236 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
237 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
238 2842677519 Variovorax sp. R-72495 Isolate Unclassified
239 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
240 2842733646 Variovorax sp. R-72446 Isolate Unclassified
241 2842747753 Variovorax sp. R-72060 Isolate Unclassified
242 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
243 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
244 2885198086 Variovorax sp. 679 Isolate Unclassified
245 2885211737 Variovorax sp. 553 Isolate Unclassified
246 2899924645 Variovorax sp. 369 Isolate Unclassified
247 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
248 2904456579 Variovorax sp. 2002 Isolate Unclassified
249 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
250 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
251 2928037797 Variovorax sp. 1126 Isolate Unclassified
252 2928044640 Variovorax sp. 1128 Isolate Unclassified
253 2928051484 Variovorax sp. 1133 Isolate Unclassified
254 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
255 2928070936 Variovorax gossypii 1167 Isolate Unclassified
256 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
257 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
258 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
259 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
260 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.19
Metatranscriptomes 0.24
Isolates 11.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 41.45
Nodule 0.48
Rhizoplane 1.45
Rhizosphere 40.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000079 3300002704 Bacteria 56287
2 JGI25156J39149_1000125 3300002705 Bacteria 56308
3 JGI25154J39366_1000141 3300002738 Bacteria 56305
4 JGI25157J39369_1000159 3300002741 Bacteria 56308
5 JGI25159J45721_1000098 3300002987 Bacteria 41673
6 JGI25159J45721_1003992 3300002987 Bacteria 5025
7 JGI25159J45721_1015427 3300002987 Bacteria 1673
8 JGI25159J45721_1015780 3300002987 Bacteria 1640
9 JGI25151J46595_10000851 3300003187 Bacteria 24295
10 JGI25151J46595_10012749 3300003187 Bacteria 3811
11 JGI26128J50194_1000579 3300003347 Bacteria 2064
12 JGI25160J50197_1000067 3300003354 Bacteria 113436
13 JGI25161J50226_1000035 3300003374 Bacteria 133666
14 Ga0006562J51391_1039902 3300003578 Bacteria 4378
15 Ga0055535_1000392 3300003761 Bacteria 41361
16 Ga0055542_1000033 3300003762 Bacteria 233997
17 Ga0055526_1002977 3300003771 Bacteria 11094
18 Ga0055537_1000187 3300003773 Bacteria 46437
19 Ga0055537_1009994 3300003773 Bacteria 2037
20 Ga0055524_1000006 3300003775 Bacteria 324702
21 Ga0055536_1000447 3300003781 Bacteria 29029
22 Ga0055536_1001359 3300003781 Bacteria 14888
23 Ga0055536_1005819 3300003781 Bacteria 5927
24 Ga0055536_1008630 3300003781 Bacteria 4345
25 Ga0055534_1001114 3300003784 Bacteria 11407
26 Ga0055534_1012909 3300003784 Bacteria 1630
27 Ga0055528_1001357 3300003790 Bacteria 15087
28 Ga0055530_10000154 3300003791 Bacteria 61878
29 Ga0055530_10000894 3300003791 Bacteria 24528
30 Ga0055530_10002156 3300003791 Bacteria 13041
31 Ga0055540_1000005 3300003792 Bacteria 378126
32 Ga0055540_1000672 3300003792 Bacteria 23734
33 Ga0055540_1001095 3300003792 Bacteria 17111
34 Ga0055540_1001667 3300003792 Bacteria 12862
35 Ga0055540_1002401 3300003792 Bacteria 9927
36 Ga0055531_10000607 3300003794 Bacteria 31111
37 Ga0055531_10000926 3300003794 Bacteria 23734
38 Ga0055531_10002068 3300003794 Bacteria 13829
39 Ga0055543_1005610 3300004625 Bacteria 3176
40 Ga0055543_1006962 3300004625 Bacteria 2665
41 Ga0065165_1021754 3300005262 Bacteria 2217
42 Ga0065165_1024185 3300005262 Bacteria 2045
43 Ga0065165_1028663 3300005262 Bacteria 1794
44 Ga0065714_10002630 3300005288 Bacteria 12912
45 Ga0070658_10137165 3300005327 Bacteria 2042
46 Ga0070658_10202777 3300005327 Bacteria 1674
47 Ga0070659_100108041 3300005366 Bacteria 2244
48 Ga0070678_100022877 3300005456 Bacteria 4154
49 Ga0070662_100007530 3300005457 Bacteria 7063
50 Ga0068867_100161547 3300005459 Bacteria 1767
51 Ga0068853_100167340 3300005539 Bacteria 1987
52 Ga0068864_100005488 3300005618 Bacteria 10393
53 Ga0068864_100276856 3300005618 Bacteria 1565
54 Ga0068851_10006580 3300005834 Bacteria 5311
55 Ga0075365_10023971 3300006038 Bacteria 3844
56 Ga0075365_10059719 3300006038 Bacteria 2542
57 Ga0075365_10221736 3300006038 Bacteria 1327
58 Ga0075363_100089737 3300006048 Bacteria 1690
59 Ga0075363_100188351 3300006048 Bacteria 1176
60 Ga0075364_10003437 3300006051 Bacteria 9006
61 Ga0075364_10012914 3300006051 Bacteria 5126
62 Ga0075364_10022705 3300006051 Bacteria 3966
63 Ga0075362_10009739 3300006177 Bacteria 3725
64 Ga0075362_10021216 3300006177 Bacteria 2723
65 Ga0075367_10093627 3300006178 Bacteria 1830
66 Ga0075366_10015792 3300006195 Bacteria 4334
67 Ga0075366_10037429 3300006195 Bacteria 2864
68 Ga0097621_100044649 3300006237 Bacteria 3576
69 Ga0075370_10029749 3300006353 Bacteria 3043
70 Ga0068871_100214176 3300006358 Bacteria 1667
71 Ga0079104_1022539 3300006946 Bacteria 1692
72 Ga0105244_10004550 3300009036 Bacteria 9498
73 Ga0105240_10259101 3300009093 Bacteria 2007
74 Ga0105243_10000579 3300009148 Bacteria 36878
75 Ga0105243_10002338 3300009148 Bacteria 15864
76 Ga0105243_10198750 3300009148 Bacteria 1757
77 Ga0105242_10000656 3300009176 Bacteria 27099
78 Ga0105242_10201676 3300009176 Bacteria 1767
79 Ga0105239_10350767 3300010375 Bacteria 1666
80 Ga0105246_10006764 3300011119 Bacteria 7012
81 Ga0157373_10115089 3300013100 Bacteria 1891
82 Ga0157373_10141946 3300013100 Bacteria 1689
83 Ga0157371_10302278 3300013102 Bacteria 1158
84 Ga0182008_10001298 3300014497 Bacteria 17055
85 Ga0182006_1000895 3300015261 Bacteria 19978
86 Ga0182006_1065701 3300015261 Bacteria 1357
87 Ga0182007_10000647 3300015262 Bacteria 20069
88 Ga0163161_10000166 3300017792 Bacteria 60327
89 Ga0163161_10100445 3300017792 Bacteria 2153
90 Ga0163161_10168200 3300017792 Bacteria 1675
91 Ga0163161_10206120 3300017792 Bacteria 1517
92 Ga0209435_100001 3300025206 Bacteria 1424171
93 Ga0209436_112264 3300025208 Bacteria 1464
94 Ga0209436_115935 3300025208 Bacteria 1144
95 Ga0209672_100794 3300025228 Bacteria 15056
96 Ga0209258_100089 3300025242 Bacteria 234040
97 Ga0207425_1000520 3300025245 Bacteria 23495
98 Ga0207425_1000682 3300025245 Bacteria 18545
99 Ga0207425_1004554 3300025245 Bacteria 4122
100 Ga0207425_1008392 3300025245 Bacteria 2648
101 Ga0207425_1024031 3300025245 Bacteria 1270
102 Ga0209646_1000001 3300025246 Bacteria 3092932
103 Ga0209026_1000003 3300025250 Bacteria 1060571
104 Ga0209148_1000097 3300025254 Bacteria 234049
105 Ga0209759_1000001 3300025256 Bacteria 2799452
106 Ga0209129_1000071 3300025258 Bacteria 210729
107 Ga0209129_1005334 3300025258 Bacteria 4594
108 Ga0209565_1000246 3300025263 Bacteria 57871
109 Ga0209565_1000334 3300025263 Bacteria 41939
110 Ga0209565_1000345 3300025263 Bacteria 40893
111 Ga0209565_1002574 3300025263 Bacteria 6442
112 Ga0209673_1000043 3300025273 Bacteria 291503
113 Ga0209673_1001065 3300025273 Bacteria 31373
114 Ga0209673_1001338 3300025273 Bacteria 24643
115 Ga0209673_1024577 3300025273 Bacteria 2021
116 Ga0209130_1000241 3300025284 Bacteria 70093
117 Ga0209130_1000456 3300025284 Bacteria 43000
118 Ga0209130_1000623 3300025284 Bacteria 33778
119 Ga0209130_1000812 3300025284 Bacteria 26378
120 Ga0209675_1000309 3300025291 Bacteria 44113
121 Ga0209675_1000919 3300025291 Bacteria 18777
122 Ga0209675_1001269 3300025291 Bacteria 15100
123 Ga0209676_1000005 3300025292 Bacteria 1076001
124 Ga0209676_1000007 3300025292 Bacteria 1029371
125 Ga0209676_1001036 3300025292 Bacteria 32214
126 Ga0209676_1001229 3300025292 Bacteria 27108
127 Ga0209676_1002882 3300025292 Bacteria 11315
128 Ga0209676_1012907 3300025292 Bacteria 3247
129 Ga0209676_1029183 3300025292 Bacteria 1707
130 Ga0209025_1000854 3300025294 Bacteria 48260
131 Ga0209025_1001409 3300025294 Bacteria 31873
132 Ga0209025_1001588 3300025294 Bacteria 28622
133 Ga0209025_1001745 3300025294 Bacteria 26100
134 Ga0209025_1021808 3300025294 Bacteria 3427
135 Ga0209025_1050791 3300025294 Bacteria 1654
136 Ga0209564_1000239 3300025295 Bacteria 119761
137 Ga0209564_1000285 3300025295 Bacteria 102585
138 Ga0209564_1000890 3300025295 Bacteria 39405
139 Ga0209564_1001560 3300025295 Bacteria 22537
140 Ga0209758_1000027 3300025297 Bacteria 549650
141 Ga0209758_1005982 3300025297 Bacteria 9009
142 Ga0209758_1008390 3300025297 Bacteria 6709
143 Ga0209050_1000003 3300025298 Bacteria 1609245
144 Ga0209050_1000007 3300025298 Bacteria 1187891
145 Ga0209050_1000954 3300025298 Bacteria 37580
146 Ga0209050_1001714 3300025298 Bacteria 21890
147 Ga0209050_1005953 3300025298 Bacteria 7415
148 Ga0209050_1032169 3300025298 Bacteria 1619
149 Ga0209256_1000001 3300025299 Bacteria 2166974
150 Ga0209256_1000081 3300025299 Bacteria 222908
151 Ga0209256_1010928 3300025299 Bacteria 3719
152 Ga0207426_1000027 3300025302 Bacteria 513176
153 Ga0207426_1000247 3300025302 Bacteria 119659
154 Ga0207426_1000614 3300025302 Bacteria 45951
155 Ga0207426_1003029 3300025302 Bacteria 9727
156 Ga0209051_1000003 3300025303 Bacteria 1609245
157 Ga0209051_1000009 3300025303 Bacteria 706778
158 Ga0209051_1000320 3300025303 Bacteria 72764
159 Ga0209051_1000373 3300025303 Bacteria 64348
160 Ga0209051_1000619 3300025303 Bacteria 40839
161 Ga0209051_1001605 3300025303 Bacteria 18445
162 Ga0209051_1006608 3300025303 Bacteria 6501
163 Ga0209051_1016061 3300025303 Bacteria 3414
164 Ga0209257_1000020 3300025304 Bacteria 773356
165 Ga0209257_1000161 3300025304 Bacteria 176089
166 Ga0209257_1000873 3300025304 Bacteria 42738
167 Ga0209257_1002439 3300025304 Bacteria 18494
168 Ga0209257_1005219 3300025304 Bacteria 9302
169 Ga0209257_1012827 3300025304 Bacteria 3811
170 Ga0207656_10009112 3300025321 Bacteria 3680
171 Ga0207655_1002596 3300025728 Bacteria 14387
172 Ga0207695_10276564 3300025913 Bacteria 1573
173 Ga0207659_10036030 3300025926 Bacteria 3424
174 Ga0207706_10003823 3300025933 Bacteria 14346
175 Ga0207706_10181567 3300025933 Bacteria 1848
176 Ga0207709_10000424 3300025935 Bacteria 40863
177 Ga0207709_10001232 3300025935 Bacteria 18384
178 Ga0207691_10017600 3300025940 Bacteria 6773
179 Ga0207679_10017828 3300025945 Bacteria 4746
180 Ga0207668_10072985 3300025972 Bacteria 2458
181 Ga0207639_10132123 3300026041 Bacteria 2068
182 Ga0207678_10266692 3300026067 Bacteria 1468
183 Ga0207648_10160582 3300026089 Bacteria 1985
184 Ga0207676_10005025 3300026095 Bacteria 9364
185 Ga0207674_10155267 3300026116 Bacteria 2244
186 Ga0207683_10037751 3300026121 Bacteria 4208
187 Ga0209968_1001093 3300027526 Bacteria 4143
188 Ga0209966_1000004 3300027695 Bacteria 108133
189 Ga0209813_10076357 3300027866 Bacteria 1099
190 Ga0209974_10010097 3300027876 Bacteria 3191
191 Ga0307515_10001283 3300028794 Bacteria 57022
192 Ga0314311_1039826 3300030733 Bacteria 3328
193 Ga0316180_1028154 3300030736 Bacteria 2008
194 Ga0316183_1031442 3300030742 Bacteria 3844
195 Ga0316181_1147176 3300030744 Bacteria 4115
196 Ga0265330_10000033 3300031235 Bacteria 126931
197 Ga0265332_10000001 3300031238 Bacteria 863783
198 Ga0265332_10000009 3300031238 Bacteria 295760
199 Ga0265325_10097544 3300031241 Bacteria 1442
200 Ga0307513_10000004 3300031456 Bacteria 558931
201 Ga0307513_10000054 3300031456 Bacteria 148887
202 Ga0307408_100074164 3300031548 Bacteria 2524
203 Ga0307408_100141090 3300031548 Bacteria 1891
204 Ga0307408_100414070 3300031548 Bacteria 1160
205 Ga0307514_10001840 3300031649 Bacteria 23499
206 Ga0265314_10000022 3300031711 Bacteria 297299
207 Ga0265342_10069102 3300031712 Bacteria 2063
208 Ga0265342_10090635 3300031712 Bacteria 1753
209 Ga0307516_10006430 3300031730 Bacteria 13763
210 Ga0307516_10043795 3300031730 Bacteria 4433
211 Ga0307405_10039857 3300031731 Bacteria 2842
212 Ga0307406_10010303 3300031901 Bacteria 5269
213 Ga0307406_10027013 3300031901 Bacteria 3453
214 Ga0307406_10145196 3300031901 Bacteria 1685
215 Ga0307406_10332513 3300031901 Bacteria 1180
216 Ga0307412_10004878 3300031911 Bacteria 7493
217 Ga0307412_10278711 3300031911 Bacteria 1312
218 Ga0307412_10476119 3300031911 Bacteria 1034
219 Ga0307416_100158604 3300032002 Bacteria 2087
220 Ga0307416_100660043 3300032002 Bacteria 1131
221 Ga0307414_10018789 3300032004 Bacteria 4266
222 Ga0307414_10128067 3300032004 Bacteria 1965
223 Ga0373931_0130026 3300035691 Bacteria 1448
224 Ga0395900_0059601 3300037418 Bacteria 3930
225 Ga0395905_0000431 3300037471 Bacteria 58717
226 Ga0395905_0002347 3300037471 Bacteria 21113
227 Ga0395905_0247986 3300037471 Bacteria 1663
228 Ga0395905_0263056 3300037471 Bacteria 1610
229 Ga0395901_0126387 3300038443 Bacteria 2687
230 Ga0439436_0014207 3300041404 Bacteria 2406
231 Ga0439436_0017115 3300041404 Bacteria 2170
232 Ga0439447_026705 3300041407 Bacteria 1478
233 Ga0439466_0025489 3300041411 Bacteria 2064
234 Ga0439466_0069499 3300041411 Bacteria 1123
235 Ga0439465_0023708 3300041413 Bacteria 1931
236 Ga0439465_0030893 3300041413 Bacteria 1705
237 Ga0451791_0864312 3300041451 Bacteria 2326
238 Ga0439433_0008987 3300041999 Bacteria 2176
239 Ga0439433_0011105 3300041999 Bacteria 1970
240 Ga0439442_014639 3300042002 Bacteria 1615
241 Ga0439449_0003869 3300042007 Bacteria 5804
242 Ga0439449_0004511 3300042007 Bacteria 5379
243 Ga0439449_0012928 3300042007 Bacteria 3139
244 Ga0450911_003154 3300042115 Bacteria 2980
245 Ga0450912_000378 3300042116 Bacteria 2119
246 Ga0450920_014260 3300042122 Bacteria 1502
247 Ga0450921_000020 3300042123 Bacteria 3995
248 Ga0450897_004352 3300042128 Bacteria 1181
249 Ga0450896_008450 3300042133 Bacteria 1428
250 Ga0450896_010887 3300042133 Bacteria 1278
251 Ga0450906_002358 3300042145 Bacteria 4139
252 Ga0450907_013276 3300042146 Bacteria 1372
253 Ga0450910_011420 3300042147 Bacteria 1274
254 Ga0439446_0012287 3300042156 Bacteria 2339
255 Ga0439446_0013326 3300042156 Bacteria 2255
256 Ga0439446_0031478 3300042156 Bacteria 1535
257 Ga0439446_0043926 3300042156 Bacteria 1322
258 Ga0450908_006479 3300042184 Bacteria 2221
259 Ga0439434_0003132 3300042435 Bacteria 4863
260 Ga0439459_0017334 3300042438 Bacteria 1341
261 Ga0439464_0012279 3300042439 Bacteria 2278
262 Ga0450918_001659 3300042531 Bacteria 4364
263 Ga0450893_0015597 3300042532 Bacteria 1282
264 Ga0451577_0004048 3300042876 Bacteria 15763
265 Ga0451577_0186660 3300042876 Bacteria 1870
266 Ga0453683_0010416 3300044673 Bacteria 6164
267 Ga0453683_0014712 3300044673 Bacteria 5077
268 Ga0466966_0020934 3300044684 Bacteria 4299
269 Ga0466966_0086395 3300044684 Bacteria 1950
270 Ga0466961_0019696 3300044693 Bacteria 4341
271 Ga0466957_0061879 3300044842 Bacteria 2299
272 Ga0466959_0035375 3300045049 Bacteria 3694
273 Ga0451576_0037377 3300045051 Bacteria 5143
274 Ga0451576_0286369 3300045051 Bacteria 1722
275 Ga0495629_0175770 3300046459 Bacteria 1485
276 Ga0495638_0094183 3300046460 Bacteria 1800
277 Ga0495607_0126595 3300046501 Bacteria 1335
278 Ga0495616_0001530 3300046513 Bacteria 15932
279 Ga0495631_0001087 3300046518 Bacteria 16877
280 Ga0495654_0005545 3300046530 Bacteria 7313
281 Ga0495621_0016390 3300046539 Bacteria 2378
282 Ga0495621_0028863 3300046539 Bacteria 1888
283 Ga0495597_0000183 3300046542 Bacteria 56126
284 Ga0495633_0000678 3300046558 Bacteria 31374
285 Ga0495625_0001521 3300046660 Bacteria 27742
286 Ga0495625_0115479 3300046660 Bacteria 1832
287 Ga0495625_0185572 3300046660 Bacteria 1380
288 Ga0495588_0084843 3300046674 Bacteria 1655
289 Ga0495676_0117773 3300047321 Bacteria 1937
290 Ga0495593_0011546 3300047673 Bacteria 5069
291 Ga0495602_0213090 3300048088 Bacteria 1464
292 Ga0496101_0148839 3300048904 Bacteria 1789
293 Ga0496111_0253621 3300048914 Bacteria 1306
294 Ga0496116_0014995 3300048919 Bacteria 6148
295 Ga0496116_0077301 3300048919 Bacteria 2080
296 Ga0496117_0126499 3300048920 Bacteria 1558
297 Ga0496118_0045150 3300048921 Bacteria 3443
298 Ga0496121_0020909 3300048924 Bacteria 6443
299 Ga0496121_0142289 3300048924 Bacteria 1777
300 Ga0496122_0008992 3300048925 Bacteria 10617
301 Ga0496122_0121721 3300048925 Bacteria 1681
302 Ga0496123_0043270 3300048926 Bacteria 3096
303 Ga0496123_0128902 3300048926 Bacteria 1406
304 Ga0496123_0167199 3300048926 Bacteria 1165
305 Ga0496124_0126189 3300048927 Bacteria 2038
306 Ga0496124_0213237 3300048927 Bacteria 1459
307 Ga0496125_0003634 3300048928 Bacteria 18481
308 Ga0496125_0008003 3300048928 Bacteria 11163
309 Ga0496125_0015670 3300048928 Bacteria 7314
310 Ga0496125_0017986 3300048928 Bacteria 6718
311 Ga0496125_0023514 3300048928 Bacteria 5686
312 Ga0496125_0036673 3300048928 Bacteria 4275
313 Ga0496126_0149729 3300048929 Bacteria 2001
314 Ga0496126_0238423 3300048929 Bacteria 1521
315 Ga0501034_0063602 3300049571 Bacteria 3703
316 Ga0501036_0325261 3300049572 Bacteria 1285
317 Ga0501043_0218324 3300049579 Bacteria 1476
318 Ga0501043_0336956 3300049579 Bacteria 1148
319 Ga0501262_000561 3300049759 Bacteria 4438
320 Ga0501035_0221244 3300049822 Bacteria 1616
321 Ga0501044_0195151 3300049823 Bacteria 1985
322 nmdc:mga03683_34832_c1 3300050489 Bacteria 2039
323 nmdc:mga03683_7877_c1 3300050489 Bacteria 3719
324 nmdc:mga03n38_134085_c1 3300050490 Bacteria 1230
325 nmdc:mga00v17_10844_c1 3300050491 Bacteria 4993
326 nmdc:mga00v17_21680_c1 3300050491 Bacteria 3696
327 nmdc:mga00v17_26691_c1 3300050491 Bacteria 3368
328 nmdc:mga0yw44_22035_c1 3300050492 Bacteria 3565
329 nmdc:mga0yw44_87113_c1 3300050492 Bacteria 1968
330 nmdc:mga0k408_2345_c1 3300050493 Bacteria 10067
331 nmdc:mga0k408_25748_c1 3300050493 Bacteria 3333
332 nmdc:mga06z11_69341_c1 3300050494 Bacteria 1861
333 nmdc:mga04h51_29306_c1 3300050495 Bacteria 1723
334 nmdc:mga07m45_113875_c1 3300050496 Bacteria 1559
335 nmdc:mga07m45_6357_c1 3300050496 Bacteria 5965
336 nmdc:mga07m45_88673_c1 3300050496 Bacteria 1770
337 nmdc:mga07m45_98885_c1 3300050496 Bacteria 1675
338 nmdc:mga09592_256130_c1 3300050508 Bacteria 1517
339 Ga0500644_0008568 3300053088 Bacteria 2703
340 Ga0500644_0016689 3300053088 Bacteria 2117
341 Ga0500651_0000029 3300053093 Bacteria 113528
342 Ga0500651_0022281 3300053093 Bacteria 3956
343 Ga0500566_0019988 3300053094 Bacteria 3932
344 Ga0500560_032932 3300053107 Bacteria 1580
345 Ga0500562_009335 3300053108 Bacteria 2480
346 Ga0500562_017385 3300053108 Bacteria 1854
347 Ga0500571_000115 3300053110 Bacteria 26083
348 Ga0500593_051502 3300053117 Bacteria 1826
349 Ga0500594_0014493 3300053118 Bacteria 1888
350 Ga0500597_043875 3300053120 Bacteria 1888
351 Ga0500655_003614 3300053133 Bacteria 2787
352 Ga0500658_0000245 3300053134 Bacteria 25454
353 Ga0500658_0000252 3300053134 Bacteria 24949
354 Ga0500559_0012143 3300053136 Bacteria 3667
355 Ga0500559_0021709 3300053136 Bacteria 2722
356 Ga0500564_034726 3300053138 Bacteria 2327
357 Ga0500568_0001102 3300053139 Bacteria 18199
358 Ga0500574_001206 3300053141 Bacteria 3736
359 Ga0500616_0139572 3300053153 Bacteria 1134
360 Ga0500627_0112338 3300053158 Bacteria 1227
361 Ga0500634_0018047 3300053161 Bacteria 3784
362 Ga0500638_001571 3300053162 Bacteria 7313
363 Ga0500636_0044145 3300053177 Bacteria 2629
364 Ga0500645_000413 3300053730 Bacteria 29917
365 Ga0500645_002124 3300053730 Bacteria 9139
366 Ga0500645_014783 3300053730 Bacteria 2483
367 Ga0500661_000326 3300055283 Bacteria 8733
368 2643991224 2643221596 Bacteria 5006805
369 2511245659 2511231002 Bacteria 5042903
370 2513227995 2513020051 Bacteria 6053213
371 2548500098 2547132374 Bacteria 5530232
372 2599624037 2599185214 Bacteria 8209958
373 2599672048 2599185226 Bacteria 8233575
374 2599681870 2599185227 Bacteria 8246414
375 2599693883 2599185229 Bacteria 8216126
376 2643864863 2643221570 Bacteria 5103772
377 2644059878 2643221609 Bacteria 6756331
378 2644074501 2643221611 Bacteria 6820941
379 2644162788 2643221628 Bacteria 5745828
380 2644293901 2643221652 Bacteria 5140275
381 2644328794 2643221658 Bacteria 6064537
382 2644397987 2643221672 Bacteria 6322190
383 2644469173 2643221683 Bacteria 5749203
384 2644644582 2643221717 Bacteria 5676132
385 2738719959 2738541277 Bacteria 7458140
386 2738881459 2738541307 Bacteria 8606193
387 2739241402 2738543012 Bacteria 7115078
388 2739279158 2738543019 Bacteria 7459457
389 2816473566 2816332133 Bacteria 7249298
390 2819596486 2818991446 Bacteria 7757362
391 2831269524 2831265667 Bacteria 7184833
392 2838060015 2838054893 Bacteria 7451788
393 2842682611 2842677519 Bacteria 5615038
394 2842719011 2842718218 Bacteria 4560148
395 2842735327 2842733646 Bacteria 5716726
396 2842749100 2842747753 Bacteria 5578255
397 2881101185 2881101125 Bacteria 4590519
398 2885196162 2885192300 Bacteria 5882526
399 2885199620 2885198086 Bacteria 7212419
400 2885213107 2885211737 Bacteria 7212420
401 2899931203 2899924645 Bacteria 7487985
402 2904454858 2904449895 Bacteria 6927402
403 2904462569 2904456579 Bacteria 6819253
404 2919464009 2919462493 Bacteria 5817112
405 2919705093 2919704043 Bacteria 5560311
406 2928038024 2928037797 Bacteria 7273642
407 2928046370 2928044640 Bacteria 7271509
408 2928054066 2928051484 Bacteria 7773759
409 2928065819 2928064002 Bacteria 7419480
410 2928077859 2928070936 Bacteria 8062541
411 2928090806 2928084124 Bacteria 7159212
412 2932424313 2932422444 Bacteria 4678430
413 2939632806 2939631187 Bacteria 6118131
414 2974324364 2974320154 Bacteria 4571377
415 2990711692 2990710928 Bacteria 5002431
416 JGI25155J39150_1000079
417 JGI25156J39149_1000125
418 JGI25154J39366_1000141
419 JGI25157J39369_1000159
420 JGI25159J45721_1000098
421 JGI25159J45721_1003992
422 JGI25159J45721_1015427
423 JGI25159J45721_1015780
424 JGI25151J46595_10000851
425 JGI25151J46595_10012749
426 JGI26128J50194_1000579
427 JGI25160J50197_1000067
428 JGI25161J50226_1000035
429 Ga0006562J51391_1039902
430 Ga0055535_1000392
431 Ga0055542_1000033
432 Ga0055526_1002977
433 Ga0055537_1000187
434 Ga0055537_1009994
435 Ga0055524_1000006
436 Ga0055536_1000447
437 Ga0055536_1001359
438 Ga0055536_1005819
439 Ga0055536_1008630
440 Ga0055534_1001114
441 Ga0055534_1012909
442 Ga0055528_1001357
443 Ga0055530_10000154
444 Ga0055530_10000894
445 Ga0055530_10002156
446 Ga0055540_1000005
447 Ga0055540_1000672
448 Ga0055540_1001095
449 Ga0055540_1001667
450 Ga0055540_1002401
451 Ga0055531_10000607
452 Ga0055531_10000926
453 Ga0055531_10002068
454 Ga0055543_1005610
455 Ga0055543_1006962
456 Ga0065165_1021754
457 Ga0065165_1024185
458 Ga0065165_1028663
459 Ga0065714_10002630
460 Ga0070658_10137165
461 Ga0070658_10202777
462 Ga0070659_100108041
463 Ga0070678_100022877
464 Ga0070662_100007530
465 Ga0068867_100161547
466 Ga0068853_100167340
467 Ga0068864_100005488
468 Ga0068864_100276856
469 Ga0068851_10006580
470 Ga0075365_10023971
471 Ga0075365_10059719
472 Ga0075365_10221736
473 Ga0075363_100089737
474 Ga0075363_100188351
475 Ga0075364_10003437
476 Ga0075364_10012914
477 Ga0075364_10022705
478 Ga0075362_10009739
479 Ga0075362_10021216
480 Ga0075367_10093627
481 Ga0075366_10015792
482 Ga0075366_10037429
483 Ga0097621_100044649
484 Ga0075370_10029749
485 Ga0068871_100214176
486 Ga0079104_1022539
487 Ga0105244_10004550
488 Ga0105240_10259101
489 Ga0105243_10000579
490 Ga0105243_10002338
491 Ga0105243_10198750
492 Ga0105242_10000656
493 Ga0105242_10201676
494 Ga0105239_10350767
495 Ga0105246_10006764
496 Ga0157373_10115089
497 Ga0157373_10141946
498 Ga0157371_10302278
499 Ga0182008_10001298
500 Ga0182006_1000895
501 Ga0182006_1065701
502 Ga0182007_10000647
503 Ga0163161_10000166
504 Ga0163161_10100445
505 Ga0163161_10168200
506 Ga0163161_10206120
507 Ga0209435_100001
508 Ga0209436_112264
509 Ga0209436_115935
510 Ga0209672_100794
511 Ga0209258_100089
512 Ga0207425_1000520
513 Ga0207425_1000682
514 Ga0207425_1004554
515 Ga0207425_1008392
516 Ga0207425_1024031
517 Ga0209646_1000001
518 Ga0209026_1000003
519 Ga0209148_1000097
520 Ga0209759_1000001
521 Ga0209129_1000071
522 Ga0209129_1005334
523 Ga0209565_1000246
524 Ga0209565_1000334
525 Ga0209565_1000345
526 Ga0209565_1002574
527 Ga0209673_1000043
528 Ga0209673_1001065
529 Ga0209673_1001338
530 Ga0209673_1024577
531 Ga0209130_1000241
532 Ga0209130_1000456
533 Ga0209130_1000623
534 Ga0209130_1000812
535 Ga0209675_1000309
536 Ga0209675_1000919
537 Ga0209675_1001269
538 Ga0209676_1000005
539 Ga0209676_1000007
540 Ga0209676_1001036
541 Ga0209676_1001229
542 Ga0209676_1002882
543 Ga0209676_1012907
544 Ga0209676_1029183
545 Ga0209025_1000854
546 Ga0209025_1001409
547 Ga0209025_1001588
548 Ga0209025_1001745
549 Ga0209025_1021808
550 Ga0209025_1050791
551 Ga0209564_1000239
552 Ga0209564_1000285
553 Ga0209564_1000890
554 Ga0209564_1001560
555 Ga0209758_1000027
556 Ga0209758_1005982
557 Ga0209758_1008390
558 Ga0209050_1000003
559 Ga0209050_1000007
560 Ga0209050_1000954
561 Ga0209050_1001714
562 Ga0209050_1005953
563 Ga0209050_1032169
564 Ga0209256_1000001
565 Ga0209256_1000081
566 Ga0209256_1010928
567 Ga0207426_1000027
568 Ga0207426_1000247
569 Ga0207426_1000614
570 Ga0207426_1003029
571 Ga0209051_1000003
572 Ga0209051_1000009
573 Ga0209051_1000320
574 Ga0209051_1000373
575 Ga0209051_1000619
576 Ga0209051_1001605
577 Ga0209051_1006608
578 Ga0209051_1016061
579 Ga0209257_1000020
580 Ga0209257_1000161
581 Ga0209257_1000873
582 Ga0209257_1002439
583 Ga0209257_1005219
584 Ga0209257_1012827
585 Ga0207656_10009112
586 Ga0207655_1002596
587 Ga0207695_10276564
588 Ga0207659_10036030
589 Ga0207706_10003823
590 Ga0207706_10181567
591 Ga0207709_10000424
592 Ga0207709_10001232
593 Ga0207691_10017600
594 Ga0207679_10017828
595 Ga0207668_10072985
596 Ga0207639_10132123
597 Ga0207678_10266692
598 Ga0207648_10160582
599 Ga0207676_10005025
600 Ga0207674_10155267
601 Ga0207683_10037751
602 Ga0209968_1001093
603 Ga0209966_1000004
604 Ga0209813_10076357
605 Ga0209974_10010097
606 Ga0307515_10001283
607 Ga0314311_1039826
608 Ga0316180_1028154
609 Ga0316183_1031442
610 Ga0316181_1147176
611 Ga0265330_10000033
612 Ga0265332_10000001
613 Ga0265332_10000009
614 Ga0265325_10097544
615 Ga0307513_10000004
616 Ga0307513_10000054
617 Ga0307408_100074164
618 Ga0307408_100141090
619 Ga0307408_100414070
620 Ga0307514_10001840
621 Ga0265314_10000022
622 Ga0265342_10069102
623 Ga0265342_10090635
624 Ga0307516_10006430
625 Ga0307516_10043795
626 Ga0307405_10039857
627 Ga0307406_10010303
628 Ga0307406_10027013
629 Ga0307406_10145196
630 Ga0307406_10332513
631 Ga0307412_10004878
632 Ga0307412_10278711
633 Ga0307412_10476119
634 Ga0307416_100158604
635 Ga0307416_100660043
636 Ga0307414_10018789
637 Ga0307414_10128067
638 Ga0373931_0130026
639 Ga0395900_0059601
640 Ga0395905_0000431
641 Ga0395905_0002347
642 Ga0395905_0247986
643 Ga0395905_0263056
644 Ga0395901_0126387
645 Ga0439436_0014207
646 Ga0439436_0017115
647 Ga0439447_026705
648 Ga0439466_0025489
649 Ga0439466_0069499
650 Ga0439465_0023708
651 Ga0439465_0030893
652 Ga0451791_0864312
653 Ga0439433_0008987
654 Ga0439433_0011105
655 Ga0439442_014639
656 Ga0439449_0003869
657 Ga0439449_0004511
658 Ga0439449_0012928
659 Ga0450911_003154
660 Ga0450912_000378
661 Ga0450920_014260
662 Ga0450921_000020
663 Ga0450897_004352
664 Ga0450896_008450
665 Ga0450896_010887
666 Ga0450906_002358
667 Ga0450907_013276
668 Ga0450910_011420
669 Ga0439446_0012287
670 Ga0439446_0013326
671 Ga0439446_0031478
672 Ga0439446_0043926
673 Ga0450908_006479
674 Ga0439434_0003132
675 Ga0439459_0017334
676 Ga0439464_0012279
677 Ga0450918_001659
678 Ga0450893_0015597
679 Ga0451577_0004048
680 Ga0451577_0186660
681 Ga0453683_0010416
682 Ga0453683_0014712
683 Ga0466966_0020934
684 Ga0466966_0086395
685 Ga0466961_0019696
686 Ga0466957_0061879
687 Ga0466959_0035375
688 Ga0451576_0037377
689 Ga0451576_0286369
690 Ga0495629_0175770
691 Ga0495638_0094183
692 Ga0495607_0126595
693 Ga0495616_0001530
694 Ga0495631_0001087
695 Ga0495654_0005545
696 Ga0495621_0016390
697 Ga0495621_0028863
698 Ga0495597_0000183
699 Ga0495633_0000678
700 Ga0495625_0001521
701 Ga0495625_0115479
702 Ga0495625_0185572
703 Ga0495588_0084843
704 Ga0495676_0117773
705 Ga0495593_0011546
706 Ga0495602_0213090
707 Ga0496101_0148839
708 Ga0496111_0253621
709 Ga0496116_0014995
710 Ga0496116_0077301
711 Ga0496117_0126499
712 Ga0496118_0045150
713 Ga0496121_0020909
714 Ga0496121_0142289
715 Ga0496122_0008992
716 Ga0496122_0121721
717 Ga0496123_0043270
718 Ga0496123_0128902
719 Ga0496123_0167199
720 Ga0496124_0126189
721 Ga0496124_0213237
722 Ga0496125_0003634
723 Ga0496125_0008003
724 Ga0496125_0015670
725 Ga0496125_0017986
726 Ga0496125_0023514
727 Ga0496125_0036673
728 Ga0496126_0149729
729 Ga0496126_0238423
730 Ga0501034_0063602
731 Ga0501036_0325261
732 Ga0501043_0218324
733 Ga0501043_0336956
734 Ga0501262_000561
735 Ga0501035_0221244
736 Ga0501044_0195151
737 nmdc:mga03683_34832_c1
738 nmdc:mga03683_7877_c1
739 nmdc:mga03n38_134085_c1
740 nmdc:mga00v17_10844_c1
741 nmdc:mga00v17_21680_c1
742 nmdc:mga00v17_26691_c1
743 nmdc:mga0yw44_22035_c1
744 nmdc:mga0yw44_87113_c1
745 nmdc:mga0k408_2345_c1
746 nmdc:mga0k408_25748_c1
747 nmdc:mga06z11_69341_c1
748 nmdc:mga04h51_29306_c1
749 nmdc:mga07m45_113875_c1
750 nmdc:mga07m45_6357_c1
751 nmdc:mga07m45_88673_c1
752 nmdc:mga07m45_98885_c1
753 nmdc:mga09592_256130_c1
754 Ga0500644_0008568
755 Ga0500644_0016689
756 Ga0500651_0000029
757 Ga0500651_0022281
758 Ga0500566_0019988
759 Ga0500560_032932
760 Ga0500562_009335
761 Ga0500562_017385
762 Ga0500571_000115
763 Ga0500593_051502
764 Ga0500594_0014493
765 Ga0500597_043875
766 Ga0500655_003614
767 Ga0500658_0000245
768 Ga0500658_0000252
769 Ga0500559_0012143
770 Ga0500559_0021709
771 Ga0500564_034726
772 Ga0500568_0001102
773 Ga0500574_001206
774 Ga0500616_0139572
775 Ga0500627_0112338
776 Ga0500634_0018047
777 Ga0500638_001571
778 Ga0500636_0044145
779 Ga0500645_000413
780 Ga0500645_002124
781 Ga0500645_014783
782 Ga0500661_000326
783 2643991224
784 2511245659
785 2513227995
786 2548500098
787 2599624037
788 2599672048
789 2599681870
790 2599693883
791 2643864863
792 2644059878
793 2644074501
794 2644162788
795 2644293901
796 2644328794
797 2644397987
798 2644469173
799 2644644582
800 2738719959
801 2738881459
802 2739241402
803 2739279158
804 2816473566
805 2819596486
806 2831269524
807 2838060015
808 2842682611
809 2842719011
810 2842735327
811 2842749100
812 2881101185
813 2885196162
814 2885199620
815 2885213107
816 2899931203
817 2904454858
818 2904462569
819 2919464009
820 2919705093
821 2928038024
822 2928046370
823 2928054066
824 2928065819
825 2928077859
826 2928090806
827 2932424313
828 2939632806
829 2974324364
830 2990711692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03547

Mem_trans

Membrane transport protein

190

342

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.7545 2 300
7y9t-assembly1.cif.gz_B structure of the auxin exporter pin1 in arabidopsis thaliana in the apo state 0.7518 2 300
7wks-assembly1.cif.gz_A apo state of atpin3 0.7479 2 293
7qpc-assembly1.cif.gz_A inward-facing npa bound form of auxin transporter pin8 0.7479 2 300
7y9t-assembly1.cif.gz_B structure of the auxin exporter pin1 in arabidopsis thaliana in the apo state 0.7452 2 300
ID Description Score Start End Superfamily
af_Q9LFP6_9_362_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8205 3 298 1.20.1530.20
af_Q5VQY3_10_421_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8094 4 296 1.20.1530.20
af_Q9LFP6_9_362_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8058 3 298 1.20.1530.20
af_Q0JJV0_10_302_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7964 4 298 1.20.1530.20
af_Q5VQY3_10_421_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7876 4 296 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A4R6N389-F1-model_v4 Permease 0.9829 4 300 GO:0005886
GO:0055085
AF-H5WR13-F1-model_v4 Putative permease 0.9776 2 300 GO:0005886
GO:0055085
AF-A0A5Q4FG26-F1-model_v4 deleted 0.9575 65 301
AF-A0A4R6N389-F1-model_v4 Permease 0.957 4 300 GO:0005886
GO:0055085
AF-H5WR13-F1-model_v4 Putative permease 0.9521 2 300 GO:0005886
GO:0055085

Map