F438665

General Info

Members Datasets Scaffolds Average Seq Length
415 236 830 227

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0013666|Ga0501068_0013666_1495_2154
Length 219
Sequence MIKLENVSKVYKGPVVALQDASVDIQKGEFVFLVGASGSGKSTFLRLVNKEETPEHGRIFVAGKDIATLSPWKVPYLRRNIGSVFQDFKLLLNKTVYENVAFALEVIGRPRHVIQSQVPAILELVGLAKKMDNFPNELSGGEQQRVSIARAFVNRPLPTGNLDPATSVGIMRLLDRINRTGTTVLMATHDRSIVDTMRRRVIELDRGSIIRDQSRGVYE

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
41 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
42 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
82 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
91 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
92 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
93 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
94 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
97 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
98 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
185 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
190 2501939600 Micromonospora sp. L5 Isolate Unclassified
191 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
192 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
193 2643221561 Nocardioides sp. Root151 Isolate Unclassified
194 2643221696 Nocardioides sp. Root140 Isolate Unclassified
195 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
196 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
197 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
198 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
199 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
200 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
201 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
202 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
203 2855683550 Micromonospora sp. RP3T Isolate Unclassified
204 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
205 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
206 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
207 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
208 2858868258 Micromonospora sp. MH33 Isolate Unclassified
209 2858882152 Micromonospora noduli MED15 Isolate Nodule
210 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
211 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
212 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
213 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
214 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
215 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
216 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
217 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
218 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
219 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
220 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
221 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
222 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
223 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
224 2902582711 Micromonospora sp. AP08 Isolate Unclassified
225 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
226 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
227 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
228 649633069 Micromonospora sp. L5 Isolate Unclassified
229 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
230 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
231 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
232 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
233 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
234 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
235 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
236 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.71
Metatranscriptomes 0.96
Isolates 11.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.1
Nodule 1.45
Rhizoplane 6.02
Rhizosphere 79.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0013666 3300049584 Bacteria 4623
2 Ga0070658_10047129 3300005327 Bacteria 3488
3 Ga0070683_100065429 3300005329 Bacteria 3385
4 Ga0070680_100095232 3300005336 Bacteria 2468
5 Ga0068868_100301334 3300005338 Bacteria 1361
6 Ga0068868_100493967 3300005338 Bacteria 1071
7 Ga0070668_100214774 3300005347 Bacteria 1584
8 Ga0070714_100006966 3300005435 Bacteria 8762
9 Ga0070678_100485397 3300005456 Bacteria 1088
10 Ga0070681_10063508 3300005458 Bacteria 3664
11 Ga0068867_100114640 3300005459 Bacteria 2075
12 Ga0070706_100037289 3300005467 Bacteria 4490
13 Ga0070706_100156055 3300005467 Bacteria 2130
14 Ga0070707_100294537 3300005468 Bacteria 1577
15 Ga0070698_100068518 3300005471 Bacteria 3565
16 Ga0070699_100685245 3300005518 Bacteria 936
17 Ga0070679_100570684 3300005530 Bacteria 1075
18 Ga0070684_100008820 3300005535 Bacteria 7905
19 Ga0070697_100611059 3300005536 Bacteria 959
20 Ga0070695_100042986 3300005545 Bacteria 2871
21 Ga0070696_100092916 3300005546 Bacteria 2151
22 Ga0070693_100389151 3300005547 Bacteria 964
23 Ga0068856_100140980 3300005614 Bacteria 2418
24 Ga0068864_100650116 3300005618 Bacteria 1027
25 Ga0068860_100253039 3300005843 Bacteria 1716
26 Ga0081455_10036310 3300005937 Bacteria 4390
27 Ga0081455_10414185 3300005937 Bacteria 931
28 Ga0081538_10060304 3300005981 Bacteria 2183
29 Ga0075365_10017272 3300006038 Bacteria 4411
30 Ga0075365_10058626 3300006038 Bacteria 2564
31 Ga0075365_10169661 3300006038 Bacteria 1523
32 Ga0075364_10014647 3300006051 Bacteria 4849
33 Ga0075364_10045759 3300006051 Bacteria 2847
34 Ga0075364_10129401 3300006051 Bacteria 1694
35 Ga0075367_10030689 3300006178 Bacteria 3083
36 Ga0075428_100005933 3300006844 Bacteria 13575
37 Ga0075428_100144707 3300006844 Bacteria 2584
38 Ga0075428_100210528 3300006844 Bacteria 2101
39 Ga0075428_100239791 3300006844 Bacteria 1956
40 Ga0075430_100001121 3300006846 Bacteria 21359
41 Ga0075430_100083984 3300006846 Bacteria 2667
42 Ga0075431_100056249 3300006847 Bacteria 4058
43 Ga0075431_100072813 3300006847 Bacteria 3545
44 Ga0075431_100283137 3300006847 Bacteria 1678
45 Ga0075433_10036238 3300006852 Bacteria 4248
46 Ga0075433_10810429 3300006852 Bacteria 818
47 Ga0075434_100006602 3300006871 Bacteria 10647
48 Ga0075429_100012928 3300006880 Bacteria 7240
49 Ga0075429_100051611 3300006880 Bacteria 3578
50 Ga0075429_100159126 3300006880 Bacteria 1978
51 Ga0075429_100223195 3300006880 Bacteria 1650
52 Ga0075435_100027517 3300007076 Bacteria 4449
53 Ga0111539_10119875 3300009094 Bacteria 3082
54 Ga0111539_10481075 3300009094 Bacteria 1446
55 Ga0105245_10374542 3300009098 Bacteria 1416
56 Ga0114129_10099858 3300009147 Bacteria 4016
57 Ga0114129_10142717 3300009147 Bacteria 3281
58 Ga0114129_10328990 3300009147 Bacteria 2029
59 Ga0105242_10387533 3300009176 Bacteria 1301
60 Ga0157313_1001182 3300012503 Bacteria 1361
61 Ga0157324_1002619 3300012506 Bacteria 1110
62 Ga0157316_1009562 3300012510 Bacteria 873
63 Ga0157369_10184715 3300013105 Bacteria 2193
64 Ga0157372_10107896 3300013307 Bacteria 3186
65 Ga0157375_10927530 3300013308 Bacteria 1014
66 Ga0163163_10254741 3300014325 Bacteria 1806
67 Ga0182008_10043465 3300014497 Bacteria 2237
68 Ga0182008_10102107 3300014497 Bacteria 1418
69 Ga0157376_10679495 3300014969 Bacteria 1033
70 Ga0163161_10435967 3300017792 Bacteria 1057
71 Ga0207688_10027481 3300025901 Bacteria 3130
72 Ga0207684_10020905 3300025910 Bacteria 5590
73 Ga0207684_10080744 3300025910 Bacteria 2767
74 Ga0207684_10102161 3300025910 Bacteria 2451
75 Ga0207707_10125479 3300025912 Bacteria 2245
76 Ga0207707_10213388 3300025912 Bacteria 1681
77 Ga0207707_10888101 3300025912 Bacteria 737
78 Ga0207657_10364440 3300025919 Bacteria 1139
79 Ga0207700_10294413 3300025928 Bacteria 1400
80 Ga0207700_10342757 3300025928 Bacteria 1300
81 Ga0207664_10018673 3300025929 Bacteria 5110
82 Ga0207709_10186010 3300025935 Bacteria 1471
83 Ga0207704_10519737 3300025938 Bacteria 962
84 Ga0207677_10078786 3300026023 Bacteria 2354
85 Ga0207708_10207764 3300026075 Bacteria 1564
86 Ga0207702_10121295 3300026078 Bacteria 2340
87 Ga0207648_10061772 3300026089 Bacteria 3266
88 Ga0207648_10249748 3300026089 Bacteria 1581
89 Ga0207683_10150151 3300026121 Bacteria 2103
90 Ga0209999_1034283 3300027543 Bacteria 945
91 Ga0207428_10021742 3300027907 Bacteria 5427
92 Ga0265334_10093571 3300028573 Bacteria 1094
93 Ga0307515_10075296 3300028794 Bacteria 4499
94 Ga0265338_10115817 3300028800 Bacteria 2148
95 Ga0265327_10069920 3300031251 Bacteria 1761
96 Ga0307408_100276741 3300031548 Bacteria 1396
97 Ga0316579_10017826 3300031691 Bacteria 3119
98 Ga0316576_10007177 3300031727 Bacteria 6989
99 Ga0307405_10016292 3300031731 Bacteria 4050
100 Ga0316577_10022734 3300031733 Bacteria 3482
101 Ga0307410_10033712 3300031852 Bacteria 3308
102 Ga0307407_10372145 3300031903 Bacteria 1018
103 Ga0307409_100271311 3300031995 Bacteria 1562
104 Ga0307416_100020306 3300032002 Bacteria 4737
105 Ga0307416_100256053 3300032002 Bacteria 1707
106 Ga0307416_100272114 3300032002 Bacteria 1664
107 Ga0307414_10052199 3300032004 Bacteria 2844
108 Ga0307411_10113627 3300032005 Bacteria 1943
109 Ga0307415_100059898 3300032126 Bacteria 2628
110 Ga0307415_100350541 3300032126 Bacteria 1242
111 Ga0316580_10050928 3300032139 Bacteria 1276
112 Ga0373951_0000536 3300035091 Bacteria 10697
113 Ga0373943_0039274 3300035170 Bacteria 2280
114 Ga0373942_0000505 3300035207 Bacteria 10996
115 Ga0316574_0037657 3300035398 Bacteria 2967
116 Ga0316574_0080398 3300035398 Bacteria 2068
117 Ga0316574_0108265 3300035398 Bacteria 1781
118 Ga0373947_0035673 3300035725 Bacteria 2945
119 Ga0316582_0012507 3300036647 Bacteria 4741
120 Ga0395901_0151915 3300038443 Bacteria 2433
121 Ga0436365_0147265 3300039437 Bacteria 2706
122 Ga0451797_0621492 3300041453 Bacteria 1022
123 Ga0451806_614865 3300041462 Bacteria 1253
124 Ga0451837_0166454 3300041494 Bacteria 1242
125 Ga0451839_0254273 3300041496 Bacteria 915
126 Ga0451843_1577166 3300041509 Bacteria 1021
127 Ga0451853_0474197 3300041512 Bacteria 1206
128 Ga0439432_057148 3300042006 Bacteria 1208
129 Ga0439452_014983 3300042010 Bacteria 2139
130 Ga0439457_034315 3300042014 Bacteria 1128
131 Ga0466972_0072864 3300044658 Bacteria 1638
132 Ga0466965_0010674 3300044683 Bacteria 4292
133 Ga0466965_0036025 3300044683 Bacteria 2426
134 Ga0466965_0102838 3300044683 Bacteria 1462
135 Ga0466966_0032729 3300044684 Bacteria 3367
136 Ga0466966_0107418 3300044684 Bacteria 1722
137 Ga0466961_0003469 3300044693 Bacteria 9828
138 Ga0466961_0282892 3300044693 Bacteria 1015
139 Ga0466963_0019596 3300044694 Bacteria 4246
140 Ga0466963_0067830 3300044694 Bacteria 2395
141 Ga0466971_0012391 3300044719 Bacteria 3736
142 Ga0466970_0090970 3300044765 Bacteria 1656
143 Ga0466957_0118108 3300044842 Bacteria 1688
144 Ga0466957_0220148 3300044842 Bacteria 1253
145 Ga0466960_0001621 3300044901 Bacteria 8231
146 Ga0466960_0002963 3300044901 Bacteria 6470
147 Ga0466960_0033636 3300044901 Bacteria 2384
148 Ga0466959_0169223 3300045049 Bacteria 1533
149 Ga0466958_0074960 3300045836 Bacteria 2075
150 Ga0466958_0126827 3300045836 Bacteria 1600
151 Ga0466967_0042237 3300045976 Bacteria 3938
152 Ga0466967_0070590 3300045976 Bacteria 3125
153 Ga0466967_0544750 3300045976 Bacteria 1142
154 Ga0466967_0672304 3300045976 Bacteria 1025
155 Ga0495653_0014866 3300046463 Bacteria 6350
156 Ga0495630_0038374 3300046517 Bacteria 3583
157 Ga0495663_0125577 3300046525 Bacteria 862
158 Ga0495665_0061688 3300046531 Bacteria 1980
159 Ga0495588_0106065 3300046674 Bacteria 1479
160 Ga0495647_0156171 3300046681 Bacteria 981
161 Ga0495658_0193685 3300046683 Bacteria 1265
162 Ga0495672_0011488 3300047320 Bacteria 6246
163 Ga0495676_0189176 3300047321 Bacteria 1437
164 Ga0495673_0179408 3300047469 Bacteria 803
165 Ga0495602_0411146 3300048088 Bacteria 963
166 Ga0496101_0020333 3300048904 Bacteria 4542
167 Ga0496102_0005539 3300048905 Bacteria 10723
168 Ga0496102_0386881 3300048905 Bacteria 1316
169 Ga0496102_0425390 3300048905 Bacteria 1247
170 Ga0496103_0015216 3300048906 Bacteria 4574
171 Ga0496104_0093564 3300048907 Bacteria 2875
172 Ga0496104_0288904 3300048907 Bacteria 1552
173 Ga0496106_0072245 3300048909 Bacteria 2638
174 Ga0496107_0093444 3300048910 Bacteria 2199
175 Ga0496108_0059653 3300048911 Bacteria 3208
176 Ga0496108_0179705 3300048911 Bacteria 1832
177 Ga0496109_0183750 3300048912 Bacteria 1964
178 Ga0496109_0186847 3300048912 Bacteria 1947
179 Ga0496110_0283726 3300048913 Bacteria 1508
180 Ga0496110_0462759 3300048913 Bacteria 1156
181 Ga0496110_0691599 3300048913 Bacteria 921
182 Ga0496110_1152091 3300048913 Bacteria 684
183 Ga0496111_0044607 3300048914 Bacteria 3187
184 Ga0496111_0461423 3300048914 Bacteria 937
185 Ga0496113_0054850 3300048916 Bacteria 2985
186 Ga0496113_0082364 3300048916 Bacteria 2468
187 Ga0496114_0172105 3300048917 Bacteria 1888
188 Ga0496115_0090931 3300048918 Bacteria 2494
189 Ga0501318_012923 3300049534 Bacteria 964
190 Ga0501318_026176 3300049534 Bacteria 768
191 Ga0501321_023098 3300049537 Bacteria 787
192 Ga0501325_001671 3300049541 Bacteria 1409
193 Ga0501031_0000175 3300049568 Bacteria 36468
194 Ga0501031_0073590 3300049568 Bacteria 2225
195 Ga0501031_0085436 3300049568 Bacteria 2057
196 Ga0501031_0105860 3300049568 Bacteria 1836
197 Ga0501031_0118773 3300049568 Bacteria 1728
198 Ga0501032_0001450 3300049569 Bacteria 18859
199 Ga0501032_0002831 3300049569 Bacteria 13498
200 Ga0501032_0075019 3300049569 Bacteria 2253
201 Ga0501033_0006903 3300049570 Bacteria 8865
202 Ga0501033_0022368 3300049570 Bacteria 4770
203 Ga0501034_0000918 3300049571 Bacteria 43043
204 Ga0501034_0004886 3300049571 Bacteria 14786
205 Ga0501034_0009594 3300049571 Bacteria 10127
206 Ga0501034_0357260 3300049571 Bacteria 1388
207 Ga0501036_0000427 3300049572 Bacteria 29880
208 Ga0501036_0001609 3300049572 Bacteria 17449
209 Ga0501036_0008068 3300049572 Bacteria 8624
210 Ga0501036_0076351 3300049572 Bacteria 2834
211 Ga0501037_0001429 3300049573 Bacteria 17518
212 Ga0501037_0001829 3300049573 Bacteria 15446
213 Ga0501037_0061691 3300049573 Bacteria 2734
214 Ga0501037_0157387 3300049573 Bacteria 1621
215 Ga0501037_0183970 3300049573 Bacteria 1482
216 Ga0501038_0000459 3300049574 Bacteria 35683
217 Ga0501038_0011092 3300049574 Bacteria 8229
218 Ga0501038_0060361 3300049574 Bacteria 3246
219 Ga0501038_0239448 3300049574 Bacteria 1441
220 Ga0501039_0000992 3300049575 Bacteria 20644
221 Ga0501039_0004319 3300049575 Bacteria 10717
222 Ga0501039_0008199 3300049575 Bacteria 7964
223 Ga0501039_0082892 3300049575 Bacteria 2497
224 Ga0501039_0127449 3300049575 Bacteria 1997
225 Ga0501040_0003942 3300049576 Bacteria 9632
226 Ga0501040_0013673 3300049576 Bacteria 5337
227 Ga0501040_0683549 3300049576 Bacteria 742
228 Ga0501041_0180528 3300049577 Bacteria 1321
229 Ga0501042_0023167 3300049578 Bacteria 4342
230 Ga0501042_0239224 3300049578 Bacteria 1310
231 Ga0501043_0000323 3300049579 Bacteria 43049
232 Ga0501043_0007104 3300049579 Bacteria 8909
233 Ga0501043_0674754 3300049579 Bacteria 757
234 Ga0501046_0002007 3300049580 Bacteria 19307
235 Ga0501046_0004776 3300049580 Bacteria 12221
236 Ga0501046_0034553 3300049580 Bacteria 4079
237 Ga0501046_0268620 3300049580 Bacteria 1251
238 Ga0501046_0330149 3300049580 Bacteria 1110
239 Ga0501047_0000772 3300049581 Bacteria 33513
240 Ga0501047_0099221 3300049581 Bacteria 2791
241 Ga0501048_0000332 3300049582 Bacteria 32494
242 Ga0501048_0003737 3300049582 Bacteria 11610
243 Ga0501048_0017179 3300049582 Bacteria 5332
244 Ga0501067_0024443 3300049583 Bacteria 3350
245 Ga0501068_0000026 3300049584 Bacteria 54959
246 Ga0501068_0018777 3300049584 Bacteria 4006
247 Ga0501068_0024932 3300049584 Bacteria 3515
248 Ga0501068_0203353 3300049584 Bacteria 1256
249 Ga0501068_0220066 3300049584 Bacteria 1207
250 Ga0501068_0325770 3300049584 Bacteria 985
251 Ga0501069_0000015 3300049585 Bacteria 144828
252 Ga0501069_0000475 3300049585 Bacteria 18296
253 Ga0501069_0017991 3300049585 Bacteria 3811
254 Ga0501069_0057065 3300049585 Bacteria 2176
255 Ga0501069_0267127 3300049585 Bacteria 999
256 Ga0501070_0000066 3300049586 Bacteria 87890
257 Ga0501070_0000507 3300049586 Bacteria 35570
258 Ga0501070_0000579 3300049586 Bacteria 33316
259 Ga0501070_0005552 3300049586 Bacteria 10756
260 Ga0501070_0042194 3300049586 Bacteria 3800
261 Ga0501070_0054169 3300049586 Bacteria 3326
262 Ga0501071_0001763 3300049587 Bacteria 12754
263 Ga0501071_0012532 3300049587 Bacteria 5752
264 Ga0501071_0025611 3300049587 Bacteria 4134
265 Ga0501071_0113766 3300049587 Bacteria 2001
266 Ga0501071_0191913 3300049587 Bacteria 1532
267 Ga0501071_0302286 3300049587 Bacteria 1213
268 Ga0501071_0373106 3300049587 Bacteria 1087
269 Ga0501072_0006131 3300049588 Bacteria 9169
270 Ga0501072_0041488 3300049588 Bacteria 3614
271 Ga0501072_0171685 3300049588 Bacteria 1730
272 Ga0501072_0362381 3300049588 Bacteria 1151
273 Ga0501073_0005988 3300049589 Bacteria 9074
274 Ga0501073_0136314 3300049589 Bacteria 1701
275 Ga0501073_0198071 3300049589 Bacteria 1389
276 Ga0501074_0031412 3300049590 Bacteria 3847
277 Ga0501074_0152949 3300049590 Bacteria 1649
278 Ga0501075_0000485 3300049591 Bacteria 23749
279 Ga0501075_0003482 3300049591 Bacteria 10525
280 Ga0501076_0009846 3300049592 Bacteria 7065
281 Ga0501076_0071431 3300049592 Bacteria 2777
282 Ga0501076_0081698 3300049592 Bacteria 2594
283 Ga0501076_0109740 3300049592 Bacteria 2230
284 Ga0501076_0421671 3300049592 Bacteria 1098
285 Ga0501076_0857266 3300049592 Bacteria 749
286 Ga0501077_0009962 3300049593 Bacteria 5915
287 Ga0501077_0036298 3300049593 Bacteria 3139
288 Ga0501079_0005194 3300049741 Bacteria 9679
289 Ga0501079_0137243 3300049741 Bacteria 1905
290 Ga0501079_0315212 3300049741 Bacteria 1224
291 Ga0501080_0000328 3300049742 Bacteria 36313
292 Ga0501080_0000773 3300049742 Bacteria 25991
293 Ga0501080_0000901 3300049742 Bacteria 24339
294 Ga0501080_0049797 3300049742 Bacteria 3899
295 Ga0501080_0068115 3300049742 Bacteria 3311
296 Ga0501080_0080669 3300049742 Bacteria 3024
297 Ga0501080_0244219 3300049742 Bacteria 1638
298 Ga0501080_0315559 3300049742 Bacteria 1416
299 Ga0501080_0467427 3300049742 Bacteria 1129
300 Ga0501081_0007814 3300049743 Bacteria 6934
301 Ga0501081_0066359 3300049743 Bacteria 2509
302 Ga0501081_0121529 3300049743 Bacteria 1861
303 Ga0501081_0538489 3300049743 Bacteria 872
304 Ga0501081_0539796 3300049743 Bacteria 871
305 Ga0501083_0000693 3300049744 Bacteria 21950
306 Ga0501083_0009378 3300049744 Bacteria 6910
307 Ga0501083_0050859 3300049744 Bacteria 2788
308 Ga0501083_0056982 3300049744 Bacteria 2617
309 Ga0501083_0122418 3300049744 Bacteria 1706
310 Ga0501035_0003658 3300049822 Bacteria 14662
311 Ga0501035_0256347 3300049822 Bacteria 1484
312 Ga0501035_0291331 3300049822 Bacteria 1378
313 Ga0501044_0001724 3300049823 Bacteria 25587
314 Ga0501044_0005153 3300049823 Bacteria 14570
315 Ga0501045_0000470 3300049824 Bacteria 24990
316 Ga0501045_0001275 3300049824 Bacteria 16734
317 Ga0501045_0016564 3300049824 Bacteria 5237
318 Ga0501045_0366720 3300049824 Bacteria 1072
319 Ga0501045_0562080 3300049824 Bacteria 846
320 nmdc:mga00v17_320939_c1 3300050491 Bacteria 1006
321 nmdc:mga0yw44_159488_c1 3300050492 Bacteria 1476
322 nmdc:mga0yw44_375649_c1 3300050492 Bacteria 959
323 nmdc:mga0yw44_571374_c1 3300050492 Bacteria 768
324 nmdc:mga0yw44_62281_c1 3300050492 Bacteria 2291
325 nmdc:mga06z11_102858_c1 3300050494 Bacteria 1570
326 nmdc:mga04h51_107024_c1 3300050495 Bacteria 1026
327 nmdc:mga05p37_1065861_c1 3300050507 Bacteria 851
328 nmdc:mga05p37_117756_c1 3300050507 Bacteria 3264
329 nmdc:mga05p37_198495_c1 3300050507 Bacteria 2431
330 nmdc:mga05p37_35401_c1 3300050507 Bacteria 6121
331 nmdc:mga05p37_94975_c1 3300050507 Bacteria 3674
332 nmdc:mga05p37_97400_c1 3300050507 Bacteria 3623
333 nmdc:mga09592_15785_c1 3300050508 Bacteria 6170
334 nmdc:mga09592_194761_c1 3300050508 Bacteria 1754
335 nmdc:mga09592_20431_c1 3300050508 Bacteria 5444
336 nmdc:mga09592_238099_c1 3300050508 Bacteria 1577
337 nmdc:mga09592_307925_c1 3300050508 Bacteria 1373
338 nmdc:mga09592_5104_c1 3300050508 Bacteria 10659
339 nmdc:mga09592_589975_c1 3300050508 Bacteria 953
340 nmdc:mga0qj67_177911_c1 3300050509 Bacteria 1728
341 nmdc:mga0qj67_180395_c1 3300050509 Bacteria 1715
342 nmdc:mga0qj67_1944_c1 3300050509 Bacteria 14704
343 nmdc:mga06r32_27632_c1 3300050510 Bacteria 5304
344 nmdc:mga06r32_277289_c1 3300050510 Bacteria 1664
345 nmdc:mga08y16_17869_c1 3300050511 Bacteria 7471
346 nmdc:mga08y16_227800_c1 3300050511 Bacteria 1928
347 nmdc:mga08y16_617882_c1 3300050511 Bacteria 1091
348 nmdc:mga0n895_139855_c1 3300050512 Bacteria 2449
349 nmdc:mga0rr50_6947_c1 3300050513 Bacteria 6940
350 nmdc:mga0a205_14835_c1 3300050515 Bacteria 7272
351 Ga0495601_0277085 3300053077 Bacteria 1094
352 Ga0500643_006135 3300053087 Bacteria 5071
353 Ga0500641_0007675 3300053096 Bacteria 3845
354 Ga0500569_136265 3300053109 Bacteria 824
355 Ga0501084_0000396 3300054114 Bacteria 33489
356 Ga0501084_0006905 3300054114 Bacteria 9346
357 Ga0501084_0008393 3300054114 Bacteria 8533
358 Ga0501084_0196644 3300054114 Bacteria 1701
359 Ga0501084_0742025 3300054114 Bacteria 827
360 Ga0501082_0005628 3300060353 Bacteria 10875
361 Ga0501082_0014685 3300060353 Bacteria 6748
362 Ga0466962_0011633 3300061719 Bacteria 4239
363 Ga0530510_0012347 3300061734 Bacteria 6000
364 Ga0530510_0043127 3300061734 Bacteria 3258
365 Ga0530510_0052647 3300061734 Bacteria 2941
366 Ga0530510_0077215 3300061734 Bacteria 2421
367 Ga0530510_0202095 3300061734 Bacteria 1476
368 Ga0530510_0206016 3300061734 Bacteria 1461
369 2501944664 2501939600 Bacteria 6907073
370 2515720582 2515154129 Bacteria 5584369
371 2623586788 2622736626 Bacteria 7181580
372 2643827931 2643221561 Bacteria 4984412
373 2644531022 2643221696 Bacteria 5431823
374 2676480446 2675903059 Bacteria 8644972
375 2753263537 2751185782 Bacteria 11227053
376 2772646235 2772190715 Bacteria 6959372
377 2799184644 2799112218 Bacteria 4315149
378 2831938652 2831935698 Bacteria 5963223
379 2832006400 2832004796 Bacteria 6538017
380 2855671423 2855670206 Bacteria 7120389
381 2855680676 2855676851 Bacteria 7063653
382 2855684813 2855683550 Bacteria 7134265
383 2856860697 2856858025 Bacteria 7255264
384 2857292119 2857288857 Bacteria 7189066
385 2857486122 2857481737 Bacteria 4761446
386 2858850914 2858848962 Bacteria 6963058
387 2858870795 2858868258 Bacteria 7683772
388 2858883725 2858882152 Bacteria 7230291
389 2858894195 2858888857 Bacteria 7060307
390 2858901065 2858895516 Bacteria 7378898
391 2858903473 2858902515 Bacteria 7086037
392 2861527888 2861520306 Bacteria 8348283
393 2866067246 2866065130 Bacteria 6518152
394 2867306544 2867302475 Bacteria 7087181
395 2867313032 2867312974 Bacteria 7058875
396 2867511133 2867507094 Bacteria 6506033
397 2869052194 2869048445 Bacteria 6875584
398 2869068062 2869061728 Bacteria 7112407
399 2869070796 2869068681 Bacteria 7205615
400 2880493419 2880489317 Bacteria 7096270
401 2880498888 2880495981 Bacteria 7340502
402 2883825373 2883821847 Bacteria 5121194
403 2902585557 2902582711 Bacteria 6187705
404 2929220895 2929219909 Bacteria 6984360
405 2929227480 2929226422 Bacteria 7248583
406 2996225737 2996221748 Bacteria 6799777
407 649811432 649633069 Bacteria 6962533
408 8003830785 8003830390 Bacteria 6541657
409 8003860029 8003856774 Bacteria 7675274
410 8003871431 8003870546 Bacteria 7396674
411 8054710875 8054704163 Bacteria 7247792
412 8054727527 8054727385 Bacteria 7558670
413 8054734973 8054734606 Bacteria 6947278
414 8055413704 8055412473 Bacteria 6257500
415 8057569536 8057568493 Bacteria 7221719
416 Ga0501068_0013666
417 Ga0070658_10047129
418 Ga0070683_100065429
419 Ga0070680_100095232
420 Ga0068868_100301334
421 Ga0068868_100493967
422 Ga0070668_100214774
423 Ga0070714_100006966
424 Ga0070678_100485397
425 Ga0070681_10063508
426 Ga0068867_100114640
427 Ga0070706_100037289
428 Ga0070706_100156055
429 Ga0070707_100294537
430 Ga0070698_100068518
431 Ga0070699_100685245
432 Ga0070679_100570684
433 Ga0070684_100008820
434 Ga0070697_100611059
435 Ga0070695_100042986
436 Ga0070696_100092916
437 Ga0070693_100389151
438 Ga0068856_100140980
439 Ga0068864_100650116
440 Ga0068860_100253039
441 Ga0081455_10036310
442 Ga0081455_10414185
443 Ga0081538_10060304
444 Ga0075365_10017272
445 Ga0075365_10058626
446 Ga0075365_10169661
447 Ga0075364_10014647
448 Ga0075364_10045759
449 Ga0075364_10129401
450 Ga0075367_10030689
451 Ga0075428_100005933
452 Ga0075428_100144707
453 Ga0075428_100210528
454 Ga0075428_100239791
455 Ga0075430_100001121
456 Ga0075430_100083984
457 Ga0075431_100056249
458 Ga0075431_100072813
459 Ga0075431_100283137
460 Ga0075433_10036238
461 Ga0075433_10810429
462 Ga0075434_100006602
463 Ga0075429_100012928
464 Ga0075429_100051611
465 Ga0075429_100159126
466 Ga0075429_100223195
467 Ga0075435_100027517
468 Ga0111539_10119875
469 Ga0111539_10481075
470 Ga0105245_10374542
471 Ga0114129_10099858
472 Ga0114129_10142717
473 Ga0114129_10328990
474 Ga0105242_10387533
475 Ga0157313_1001182
476 Ga0157324_1002619
477 Ga0157316_1009562
478 Ga0157369_10184715
479 Ga0157372_10107896
480 Ga0157375_10927530
481 Ga0163163_10254741
482 Ga0182008_10043465
483 Ga0182008_10102107
484 Ga0157376_10679495
485 Ga0163161_10435967
486 Ga0207688_10027481
487 Ga0207684_10020905
488 Ga0207684_10080744
489 Ga0207684_10102161
490 Ga0207707_10125479
491 Ga0207707_10213388
492 Ga0207707_10888101
493 Ga0207657_10364440
494 Ga0207700_10294413
495 Ga0207700_10342757
496 Ga0207664_10018673
497 Ga0207709_10186010
498 Ga0207704_10519737
499 Ga0207677_10078786
500 Ga0207708_10207764
501 Ga0207702_10121295
502 Ga0207648_10061772
503 Ga0207648_10249748
504 Ga0207683_10150151
505 Ga0209999_1034283
506 Ga0207428_10021742
507 Ga0265334_10093571
508 Ga0307515_10075296
509 Ga0265338_10115817
510 Ga0265327_10069920
511 Ga0307408_100276741
512 Ga0316579_10017826
513 Ga0316576_10007177
514 Ga0307405_10016292
515 Ga0316577_10022734
516 Ga0307410_10033712
517 Ga0307407_10372145
518 Ga0307409_100271311
519 Ga0307416_100020306
520 Ga0307416_100256053
521 Ga0307416_100272114
522 Ga0307414_10052199
523 Ga0307411_10113627
524 Ga0307415_100059898
525 Ga0307415_100350541
526 Ga0316580_10050928
527 Ga0373951_0000536
528 Ga0373943_0039274
529 Ga0373942_0000505
530 Ga0316574_0037657
531 Ga0316574_0080398
532 Ga0316574_0108265
533 Ga0373947_0035673
534 Ga0316582_0012507
535 Ga0395901_0151915
536 Ga0436365_0147265
537 Ga0451797_0621492
538 Ga0451806_614865
539 Ga0451837_0166454
540 Ga0451839_0254273
541 Ga0451843_1577166
542 Ga0451853_0474197
543 Ga0439432_057148
544 Ga0439452_014983
545 Ga0439457_034315
546 Ga0466972_0072864
547 Ga0466965_0010674
548 Ga0466965_0036025
549 Ga0466965_0102838
550 Ga0466966_0032729
551 Ga0466966_0107418
552 Ga0466961_0003469
553 Ga0466961_0282892
554 Ga0466963_0019596
555 Ga0466963_0067830
556 Ga0466971_0012391
557 Ga0466970_0090970
558 Ga0466957_0118108
559 Ga0466957_0220148
560 Ga0466960_0001621
561 Ga0466960_0002963
562 Ga0466960_0033636
563 Ga0466959_0169223
564 Ga0466958_0074960
565 Ga0466958_0126827
566 Ga0466967_0042237
567 Ga0466967_0070590
568 Ga0466967_0544750
569 Ga0466967_0672304
570 Ga0495653_0014866
571 Ga0495630_0038374
572 Ga0495663_0125577
573 Ga0495665_0061688
574 Ga0495588_0106065
575 Ga0495647_0156171
576 Ga0495658_0193685
577 Ga0495672_0011488
578 Ga0495676_0189176
579 Ga0495673_0179408
580 Ga0495602_0411146
581 Ga0496101_0020333
582 Ga0496102_0005539
583 Ga0496102_0386881
584 Ga0496102_0425390
585 Ga0496103_0015216
586 Ga0496104_0093564
587 Ga0496104_0288904
588 Ga0496106_0072245
589 Ga0496107_0093444
590 Ga0496108_0059653
591 Ga0496108_0179705
592 Ga0496109_0183750
593 Ga0496109_0186847
594 Ga0496110_0283726
595 Ga0496110_0462759
596 Ga0496110_0691599
597 Ga0496110_1152091
598 Ga0496111_0044607
599 Ga0496111_0461423
600 Ga0496113_0054850
601 Ga0496113_0082364
602 Ga0496114_0172105
603 Ga0496115_0090931
604 Ga0501318_012923
605 Ga0501318_026176
606 Ga0501321_023098
607 Ga0501325_001671
608 Ga0501031_0000175
609 Ga0501031_0073590
610 Ga0501031_0085436
611 Ga0501031_0105860
612 Ga0501031_0118773
613 Ga0501032_0001450
614 Ga0501032_0002831
615 Ga0501032_0075019
616 Ga0501033_0006903
617 Ga0501033_0022368
618 Ga0501034_0000918
619 Ga0501034_0004886
620 Ga0501034_0009594
621 Ga0501034_0357260
622 Ga0501036_0000427
623 Ga0501036_0001609
624 Ga0501036_0008068
625 Ga0501036_0076351
626 Ga0501037_0001429
627 Ga0501037_0001829
628 Ga0501037_0061691
629 Ga0501037_0157387
630 Ga0501037_0183970
631 Ga0501038_0000459
632 Ga0501038_0011092
633 Ga0501038_0060361
634 Ga0501038_0239448
635 Ga0501039_0000992
636 Ga0501039_0004319
637 Ga0501039_0008199
638 Ga0501039_0082892
639 Ga0501039_0127449
640 Ga0501040_0003942
641 Ga0501040_0013673
642 Ga0501040_0683549
643 Ga0501041_0180528
644 Ga0501042_0023167
645 Ga0501042_0239224
646 Ga0501043_0000323
647 Ga0501043_0007104
648 Ga0501043_0674754
649 Ga0501046_0002007
650 Ga0501046_0004776
651 Ga0501046_0034553
652 Ga0501046_0268620
653 Ga0501046_0330149
654 Ga0501047_0000772
655 Ga0501047_0099221
656 Ga0501048_0000332
657 Ga0501048_0003737
658 Ga0501048_0017179
659 Ga0501067_0024443
660 Ga0501068_0000026
661 Ga0501068_0018777
662 Ga0501068_0024932
663 Ga0501068_0203353
664 Ga0501068_0220066
665 Ga0501068_0325770
666 Ga0501069_0000015
667 Ga0501069_0000475
668 Ga0501069_0017991
669 Ga0501069_0057065
670 Ga0501069_0267127
671 Ga0501070_0000066
672 Ga0501070_0000507
673 Ga0501070_0000579
674 Ga0501070_0005552
675 Ga0501070_0042194
676 Ga0501070_0054169
677 Ga0501071_0001763
678 Ga0501071_0012532
679 Ga0501071_0025611
680 Ga0501071_0113766
681 Ga0501071_0191913
682 Ga0501071_0302286
683 Ga0501071_0373106
684 Ga0501072_0006131
685 Ga0501072_0041488
686 Ga0501072_0171685
687 Ga0501072_0362381
688 Ga0501073_0005988
689 Ga0501073_0136314
690 Ga0501073_0198071
691 Ga0501074_0031412
692 Ga0501074_0152949
693 Ga0501075_0000485
694 Ga0501075_0003482
695 Ga0501076_0009846
696 Ga0501076_0071431
697 Ga0501076_0081698
698 Ga0501076_0109740
699 Ga0501076_0421671
700 Ga0501076_0857266
701 Ga0501077_0009962
702 Ga0501077_0036298
703 Ga0501079_0005194
704 Ga0501079_0137243
705 Ga0501079_0315212
706 Ga0501080_0000328
707 Ga0501080_0000773
708 Ga0501080_0000901
709 Ga0501080_0049797
710 Ga0501080_0068115
711 Ga0501080_0080669
712 Ga0501080_0244219
713 Ga0501080_0315559
714 Ga0501080_0467427
715 Ga0501081_0007814
716 Ga0501081_0066359
717 Ga0501081_0121529
718 Ga0501081_0538489
719 Ga0501081_0539796
720 Ga0501083_0000693
721 Ga0501083_0009378
722 Ga0501083_0050859
723 Ga0501083_0056982
724 Ga0501083_0122418
725 Ga0501035_0003658
726 Ga0501035_0256347
727 Ga0501035_0291331
728 Ga0501044_0001724
729 Ga0501044_0005153
730 Ga0501045_0000470
731 Ga0501045_0001275
732 Ga0501045_0016564
733 Ga0501045_0366720
734 Ga0501045_0562080
735 nmdc:mga00v17_320939_c1
736 nmdc:mga0yw44_159488_c1
737 nmdc:mga0yw44_375649_c1
738 nmdc:mga0yw44_571374_c1
739 nmdc:mga0yw44_62281_c1
740 nmdc:mga06z11_102858_c1
741 nmdc:mga04h51_107024_c1
742 nmdc:mga05p37_1065861_c1
743 nmdc:mga05p37_117756_c1
744 nmdc:mga05p37_198495_c1
745 nmdc:mga05p37_35401_c1
746 nmdc:mga05p37_94975_c1
747 nmdc:mga05p37_97400_c1
748 nmdc:mga09592_15785_c1
749 nmdc:mga09592_194761_c1
750 nmdc:mga09592_20431_c1
751 nmdc:mga09592_238099_c1
752 nmdc:mga09592_307925_c1
753 nmdc:mga09592_5104_c1
754 nmdc:mga09592_589975_c1
755 nmdc:mga0qj67_177911_c1
756 nmdc:mga0qj67_180395_c1
757 nmdc:mga0qj67_1944_c1
758 nmdc:mga06r32_27632_c1
759 nmdc:mga06r32_277289_c1
760 nmdc:mga08y16_17869_c1
761 nmdc:mga08y16_227800_c1
762 nmdc:mga08y16_617882_c1
763 nmdc:mga0n895_139855_c1
764 nmdc:mga0rr50_6947_c1
765 nmdc:mga0a205_14835_c1
766 Ga0495601_0277085
767 Ga0500643_006135
768 Ga0500641_0007675
769 Ga0500569_136265
770 Ga0501084_0000396
771 Ga0501084_0006905
772 Ga0501084_0008393
773 Ga0501084_0196644
774 Ga0501084_0742025
775 Ga0501082_0005628
776 Ga0501082_0014685
777 Ga0466962_0011633
778 Ga0530510_0012347
779 Ga0530510_0043127
780 Ga0530510_0052647
781 Ga0530510_0077215
782 Ga0530510_0202095
783 Ga0530510_0206016
784 2501944664
785 2515720582
786 2623586788
787 2643827931
788 2644531022
789 2676480446
790 2753263537
791 2772646235
792 2799184644
793 2831938652
794 2832006400
795 2855671423
796 2855680676
797 2855684813
798 2856860697
799 2857292119
800 2857486122
801 2858850914
802 2858870795
803 2858883725
804 2858894195
805 2858901065
806 2858903473
807 2861527888
808 2866067246
809 2867306544
810 2867313032
811 2867511133
812 2869052194
813 2869068062
814 2869070796
815 2880493419
816 2880498888
817 2883825373
818 2902585557
819 2929220895
820 2929227480
821 2996225737
822 649811432
823 8003830785
824 8003860029
825 8003871431
826 8054710875
827 8054727527
828 8054734973
829 8055413704
830 8057569536

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

18

158

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9739 1 228
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.971 1 229
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9655 1 217
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9627 1 229
8idd-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc 0.9617 1 224
ID Description Score Start End Superfamily
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9883 2 225 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9754 2 225 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.95 2 221 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9482 1 216 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9469 1 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6I1GG25-F1-model_v4 Cell division ATP-binding protein FtsE 0.9909 2 226 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A087A2T3-F1-model_v4 Cell division ATP-binding protein FtsE 0.99 2 226 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A249L385-F1-model_v4 Cell division ATP-binding protein FtsE 0.9889 1 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A6J6SH26-F1-model_v4 Cell division ATP-binding protein FtsE 0.9882 1 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A2I1LMG1-F1-model_v4 deleted 0.9815 1 229

Map