F438507

General Info

Members Datasets Scaffolds Average Seq Length
415 239 830 320

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100050628|Ga0070707_1000506283
Length 355
Sequence MPAHVTTNIRKLWLPTVATKRHKTNRVHFVVSCGRTILANMRTLYNEIEPYDSGFIRVSPVHELYYEQCGNPNGKPVVFLHGGPGAGLVPDYRRFFDAQAYRVILFEQRGSGRSTPHASLEDNTTWHLVQDIEQIREQFGIDKWLVFGGSWGSTLALAYAEKHPERVSGLVLRGIFLCRPKEIRWFYEDDQGASAIFPETWEQYVRIIPEAERGDMVEAYYRRLTSDNAAVRQEAAHAWSIWEGSALRLLPDQKMIDEFTEPEKAIALARIECHYFINNSFFETDNYLIEQIDRIRHIPAVIVHGRYDMVCPFMNAWDLHQAWPEAKLEIIPDAGHAATEPGIADALIRATDSFR

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
143 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
153 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
154 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
155 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
156 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
157 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
158 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
207 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
208 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
212 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
215 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
216 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
217 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
218 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
219 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
220 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
223 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
232 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
233 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
234 2904564687 Burkholderia sp. 571 Isolate Unclassified
235 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
236 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
237 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
238 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
239 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 0.48
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.65
Nodule 0.24
Rhizoplane 4.82
Rhizosphere 86.99
Stem 0
Stem Tuber 0
Unclassified 4.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100050628 3300005468 Bacteria 3982
2 CNAas_1001835 3300000532 Bacteria 1648
3 Ga0055528_1002644 3300003790 Bacteria 9462
4 Ga0065714_10064429 3300005288 Bacteria 141954
5 Ga0065704_10007673 3300005289 Bacteria 3716
6 Ga0065704_10086973 3300005289 Bacteria 3067
7 Ga0065712_10002180 3300005290 Bacteria 4750
8 Ga0065712_10067729 3300005290 Bacteria 142513
9 Ga0065712_10067807 3300005290 Bacteria 30871
10 Ga0065715_10094634 3300005293 Bacteria 4285
11 Ga0065715_10098855 3300005293 Bacteria 3489
12 Ga0065715_10119285 3300005293 Bacteria 2290
13 Ga0065715_10122264 3300005293 Bacteria 2206
14 Ga0065707_10023150 3300005295 Unclassified 1337
15 Ga0065707_10103612 3300005295 Bacteria 2731
16 Ga0070676_10235211 3300005328 Bacteria 1216
17 Ga0070690_100036393 3300005330 Bacteria 3093
18 Ga0070670_100000227 3300005331 Bacteria 51904
19 Ga0070670_100044226 3300005331 Bacteria 3829
20 Ga0068869_100162546 3300005334 Bacteria 1739
21 Ga0070666_10038792 3300005335 Bacteria 3171
22 Ga0070682_100000948 3300005337 Bacteria 16872
23 Ga0068868_100005497 3300005338 Bacteria 8914
24 Ga0070689_100065301 3300005340 Bacteria 2833
25 Ga0070692_10089811 3300005345 Bacteria 1668
26 Ga0070692_10094243 3300005345 Bacteria 1632
27 Ga0070692_10145321 3300005345 Bacteria 1346
28 Ga0070669_100008973 3300005353 Bacteria 7138
29 Ga0070671_100027979 3300005355 Bacteria 4642
30 Ga0070673_100122069 3300005364 Bacteria 2175
31 Ga0070701_10040082 3300005438 Bacteria 2379
32 Ga0070701_10106605 3300005438 Bacteria 1560
33 Ga0070705_100020230 3300005440 Bacteria 3518
34 Ga0070705_100039241 3300005440 Bacteria 2685
35 Ga0070705_100118071 3300005440 Bacteria 1708
36 Ga0070700_100000134 3300005441 Bacteria 44581
37 Ga0070700_100002526 3300005441 Bacteria 9333
38 Ga0070700_100008408 3300005441 Bacteria 5621
39 Ga0070700_100016113 3300005441 Bacteria 4253
40 Ga0070694_100002527 3300005444 Bacteria 10802
41 Ga0070694_100004795 3300005444 Bacteria 8142
42 Ga0070694_100005079 3300005444 Bacteria 7936
43 Ga0070694_100057022 3300005444 Bacteria 2655
44 Ga0070708_100286304 3300005445 Bacteria 1551
45 Ga0070662_100069763 3300005457 Bacteria 2588
46 Ga0070681_10042043 3300005458 Bacteria 4581
47 Ga0068867_100021741 3300005459 Bacteria 4579
48 Ga0068867_100374453 3300005459 Bacteria 1194
49 Ga0070706_100000030 3300005467 Bacteria 153754
50 Ga0070706_100195329 3300005467 Bacteria 1890
51 Ga0070707_100056315 3300005468 Bacteria 3771
52 Ga0070698_100014448 3300005471 Bacteria 8339
53 Ga0070698_100021423 3300005471 Bacteria 6770
54 Ga0070697_100000906 3300005536 Bacteria 22306
55 Ga0070697_100033104 3300005536 Bacteria 4162
56 Ga0070697_100527639 3300005536 Bacteria 1034
57 Ga0068853_100197404 3300005539 Bacteria 1830
58 Ga0070672_100469124 3300005543 Bacteria 1086
59 Ga0070686_100064569 3300005544 Bacteria 2375
60 Ga0070695_100022117 3300005545 Bacteria 3897
61 Ga0070695_100125407 3300005545 Unclassified 1762
62 Ga0070695_100157491 3300005545 Bacteria 1591
63 Ga0070696_100318110 3300005546 Bacteria 1197
64 Ga0070665_100083360 3300005548 Bacteria 3202
65 Ga0070704_100011343 3300005549 Bacteria 5460
66 Ga0070704_100089873 3300005549 Bacteria 2286
67 Ga0070704_100401415 3300005549 Bacteria 1170
68 Ga0068857_100013891 3300005577 Bacteria 7010
69 Ga0068857_100088075 3300005577 Bacteria 2777
70 Ga0068857_100095416 3300005577 Bacteria 2665
71 Ga0068854_100257949 3300005578 Bacteria 1395
72 Ga0070702_100000976 3300005615 Bacteria 11281
73 Ga0070702_100031844 3300005615 Bacteria 2889
74 Ga0068852_100096395 3300005616 Bacteria 2659
75 Ga0068852_100098515 3300005616 Bacteria 2633
76 Ga0068859_100006626 3300005617 Bacteria 11762
77 Ga0068859_100009890 3300005617 Bacteria 9633
78 Ga0068859_100016923 3300005617 Bacteria 7319
79 Ga0068859_100018685 3300005617 Bacteria 6965
80 Ga0068859_100019075 3300005617 Bacteria 6887
81 Ga0068859_100023936 3300005617 Bacteria 6128
82 Ga0068859_100043411 3300005617 Bacteria 4518
83 Ga0068859_100133791 3300005617 Bacteria 2551
84 Ga0068864_100005841 3300005618 Bacteria 10094
85 Ga0068864_100011678 3300005618 Bacteria 7250
86 Ga0068864_100109411 3300005618 Bacteria 2460
87 Ga0068864_100116839 3300005618 Bacteria 2381
88 Ga0068864_100163008 3300005618 Unclassified 2028
89 Ga0068866_10061701 3300005718 Bacteria 1948
90 Ga0068861_100000894 3300005719 Bacteria 18099
91 Ga0068863_100176735 3300005841 Bacteria 2049
92 Ga0068863_100358568 3300005841 Bacteria 1421
93 Ga0068858_100009725 3300005842 Bacteria 9157
94 Ga0068858_100031988 3300005842 Bacteria 4888
95 Ga0068858_100039660 3300005842 Bacteria 4367
96 Ga0068858_100103151 3300005842 Bacteria 2661
97 Ga0068860_100029548 3300005843 Bacteria 5273
98 Ga0068860_100038622 3300005843 Bacteria 4567
99 Ga0068860_100203458 3300005843 Unclassified 1919
100 Ga0068860_100236247 3300005843 Bacteria 1777
101 Ga0068860_100487025 3300005843 Bacteria 1230
102 Ga0068862_100030087 3300005844 Bacteria 4575
103 Ga0081539_10006167 3300005985 Bacteria 11664
104 Ga0075363_100134969 3300006048 Bacteria 1386
105 Ga0075362_10006518 3300006177 Bacteria 4357
106 Ga0075367_10044551 3300006178 Bacteria 2601
107 Ga0075369_10003625 3300006186 Bacteria 5636
108 Ga0097621_100002385 3300006237 Bacteria 12874
109 Ga0097621_100021397 3300006237 Bacteria 5002
110 Ga0068871_100001823 3300006358 Bacteria 14382
111 Ga0068871_100315869 3300006358 Bacteria 1374
112 Ga0075428_100070569 3300006844 Bacteria 3819
113 Ga0075430_100032643 3300006846 Bacteria 4419
114 Ga0075431_100162014 3300006847 Bacteria 2300
115 Ga0075433_10007861 3300006852 Bacteria 8480
116 Ga0075433_10208305 3300006852 Bacteria 1738
117 Ga0075434_100483965 3300006871 Bacteria 1258
118 Ga0075429_100006045 3300006880 Bacteria 10470
119 Ga0075429_100031706 3300006880 Unclassified 4593
120 Ga0075429_100281592 3300006880 Bacteria 1456
121 Ga0068865_100060701 3300006881 Bacteria 2648
122 Ga0097620_100006626 3300006931 Bacteria 11762
123 Ga0097620_100009891 3300006931 Bacteria 9633
124 Ga0097620_100016923 3300006931 Bacteria 7319
125 Ga0097620_100018685 3300006931 Bacteria 6965
126 Ga0097620_100019076 3300006931 Bacteria 6887
127 Ga0097620_100023937 3300006931 Bacteria 6128
128 Ga0097620_100043411 3300006931 Bacteria 4518
129 Ga0097620_100098992 3300006931 Bacteria 2971
130 Ga0097620_100133788 3300006931 Bacteria 2551
131 Ga0079104_1000423 3300006946 Bacteria 48297
132 Ga0075435_100008157 3300007076 Bacteria 7501
133 Ga0105251_10000191 3300009011 Bacteria 62283
134 Ga0105240_10057136 3300009093 Bacteria 4878
135 Ga0111539_10026490 3300009094 Bacteria 7087
136 Ga0111539_10199231 3300009094 Bacteria 2335
137 Ga0111539_10600137 3300009094 Bacteria 1282
138 Ga0111539_10719182 3300009094 Unclassified 1162
139 Ga0105245_10076224 3300009098 Bacteria 3055
140 Ga0105245_10621047 3300009098 Bacteria 1109
141 Ga0105247_10001911 3300009101 Bacteria 14536
142 Ga0105247_10064316 3300009101 Bacteria 2279
143 Ga0114129_10007363 3300009147 Bacteria 15668
144 Ga0114129_10029018 3300009147 Bacteria 7837
145 Ga0114129_10129452 3300009147 Bacteria 3468
146 Ga0105243_10001003 3300009148 Bacteria 26105
147 Ga0105243_10003567 3300009148 Bacteria 12563
148 Ga0105243_10164663 3300009148 Bacteria 1915
149 Ga0105243_10221504 3300009148 Bacteria 1673
150 Ga0105243_10544702 3300009148 Bacteria 1108
151 Ga0105241_10090511 3300009174 Bacteria 2413
152 Ga0105241_10260636 3300009174 Bacteria 1473
153 Ga0105242_10036058 3300009176 Bacteria 3966
154 Ga0105242_10093437 3300009176 Bacteria 2536
155 Ga0105248_10004867 3300009177 Bacteria 14862
156 Ga0105248_10020282 3300009177 Bacteria 7365
157 Ga0105248_10300477 3300009177 Bacteria 1807
158 Ga0105237_10070536 3300009545 Bacteria 3490
159 Ga0105237_10117873 3300009545 Bacteria 2648
160 Ga0105237_10170367 3300009545 Bacteria 2177
161 Ga0105238_10085616 3300009551 Bacteria 3140
162 Ga0105249_10005744 3300009553 Bacteria 10729
163 Ga0105246_10030268 3300011119 Bacteria 3574
164 Ga0105246_10082410 3300011119 Bacteria 2296
165 Ga0157373_10043585 3300013100 Bacteria 3205
166 Ga0157374_10062619 3300013296 Bacteria 3487
167 Ga0157378_10002117 3300013297 Bacteria 17676
168 Ga0157378_10098117 3300013297 Bacteria 2671
169 Ga0163162_10003516 3300013306 Bacteria 14983
170 Ga0163162_10003922 3300013306 Bacteria 14284
171 Ga0163162_10013383 3300013306 Bacteria 8013
172 Ga0163162_10110256 3300013306 Bacteria 2849
173 Ga0163162_10124757 3300013306 Bacteria 2680
174 Ga0157372_10011616 3300013307 Bacteria 9375
175 Ga0157372_10055337 3300013307 Bacteria 4430
176 Ga0157372_10792771 3300013307 Bacteria 1101
177 Ga0157375_10007132 3300013308 Bacteria 9765
178 Ga0157375_10065059 3300013308 Bacteria 3633
179 Ga0157375_10330909 3300013308 Bacteria 1688
180 Ga0157375_10385851 3300013308 Bacteria 1567
181 Ga0163163_10000948 3300014325 Bacteria 24607
182 Ga0163163_10005288 3300014325 Bacteria 11142
183 Ga0163163_10057799 3300014325 Bacteria 3836
184 Ga0163163_10067497 3300014325 Bacteria 3556
185 Ga0163163_10224345 3300014325 Bacteria 1928
186 Ga0157380_10001046 3300014326 Bacteria 17695
187 Ga0157380_10019711 3300014326 Bacteria 5030
188 Ga0157379_10087050 3300014968 Bacteria 2801
189 Ga0157376_10038046 3300014969 Bacteria 3912
190 Ga0182007_10002528 3300015262 Bacteria 9008
191 Ga0163161_10063609 3300017792 Bacteria 2690
192 Ga0209673_1000028 3300025273 Bacteria 358901
193 Ga0209564_1016040 3300025295 Bacteria 3011
194 Ga0207713_1032996 3300025735 Bacteria 2266
195 Ga0207642_10191539 3300025899 Bacteria 1123
196 Ga0207710_10002095 3300025900 Bacteria 9443
197 Ga0207680_10049208 3300025903 Unclassified 2508
198 Ga0207645_10240426 3300025907 Bacteria 1196
199 Ga0207684_10000089 3300025910 Bacteria 172593
200 Ga0207684_10142206 3300025910 Bacteria 2063
201 Ga0207654_10177701 3300025911 Bacteria 1387
202 Ga0207707_10329106 3300025912 Bacteria 1318
203 Ga0207695_10003114 3300025913 Bacteria 23727
204 Ga0207695_10077180 3300025913 Bacteria 3384
205 Ga0207671_10066241 3300025914 Bacteria 2688
206 Ga0207671_10075742 3300025914 Bacteria 2517
207 Ga0207646_10157357 3300025922 Bacteria 2050
208 Ga0207681_10016280 3300025923 Bacteria 4649
209 Ga0207681_10020628 3300025923 Unclassified 4179
210 Ga0207694_10019215 3300025924 Bacteria 5165
211 Ga0207650_10000027 3300025925 Bacteria 257466
212 Ga0207650_10141860 3300025925 Bacteria 1889
213 Ga0207706_10351932 3300025933 Bacteria 1281
214 Ga0207709_10001274 3300025935 Bacteria 18018
215 Ga0207709_10005304 3300025935 Bacteria 7332
216 Ga0207709_10364843 3300025935 Bacteria 1094
217 Ga0207704_10160043 3300025938 Bacteria 1601
218 Ga0207691_10331109 3300025940 Bacteria 1305
219 Ga0207711_10002991 3300025941 Bacteria 14773
220 Ga0207711_10018225 3300025941 Bacteria 5836
221 Ga0207711_10060679 3300025941 Bacteria 3259
222 Ga0207689_10003721 3300025942 Bacteria 13902
223 Ga0207689_10201392 3300025942 Bacteria 1643
224 Ga0207651_10269725 3300025960 Bacteria 1401
225 Ga0207712_10103321 3300025961 Bacteria 2123
226 Ga0207677_10049272 3300026023 Bacteria 2841
227 Ga0207703_10048903 3300026035 Bacteria 3416
228 Ga0207703_10057007 3300026035 Bacteria 3184
229 Ga0207703_10120282 3300026035 Bacteria 2254
230 Ga0207703_10259071 3300026035 Bacteria 1571
231 Ga0207703_10267153 3300026035 Bacteria 1548
232 Ga0207708_10000028 3300026075 Bacteria 164263
233 Ga0207708_10005474 3300026075 Bacteria 9368
234 Ga0207708_10019545 3300026075 Bacteria 5108
235 Ga0207708_10032253 3300026075 Bacteria 3979
236 Ga0207641_10014903 3300026088 Bacteria 6374
237 Ga0207641_10099800 3300026088 Bacteria 2555
238 Ga0207641_10104048 3300026088 Bacteria 2506
239 Ga0207648_10395281 3300026089 Bacteria 1252
240 Ga0207676_10018540 3300026095 Bacteria 5060
241 Ga0207676_10023036 3300026095 Bacteria 4587
242 Ga0207676_10144303 3300026095 Bacteria 2042
243 Ga0207676_10146644 3300026095 Unclassified 2028
244 Ga0207676_10228680 3300026095 Unclassified 1661
245 Ga0207674_10042499 3300026116 Bacteria 4695
246 Ga0207674_10113537 3300026116 Bacteria 2682
247 Ga0207674_10173549 3300026116 Bacteria 2109
248 Ga0207675_100002832 3300026118 Bacteria 17069
249 Ga0207675_100031845 3300026118 Bacteria 4912
250 Ga0207675_100089647 3300026118 Bacteria 2890
251 Ga0207698_10375520 3300026142 Bacteria 1351
252 Ga0207698_10482608 3300026142 Bacteria 1203
253 Ga0268266_10187871 3300028379 Bacteria 1885
254 Ga0268264_10018868 3300028381 Bacteria 5639
255 Ga0268264_10051561 3300028381 Bacteria 3428
256 Ga0268264_10130899 3300028381 Bacteria 2224
257 Ga0268264_10407235 3300028381 Unclassified 1308
258 Ga0307511_10002167 3300030521 Bacteria 20642
259 Ga0265327_10087678 3300031251 Bacteria 1524
260 Ga0307408_100178420 3300031548 Bacteria 1701
261 Ga0307408_100225082 3300031548 Bacteria 1533
262 Ga0265314_10004885 3300031711 Bacteria 12258
263 Ga0316578_10035541 3300031728 Bacteria 2865
264 Ga0316578_10065873 3300031728 Bacteria 2140
265 Ga0307405_10007788 3300031731 Bacteria 5390
266 Ga0316042_111087 3300031816 Eukaryota 1202
267 Ga0307413_10195017 3300031824 Bacteria 1457
268 Ga0316043_108601 3300031828 Eukaryota 1430
269 Ga0307406_10002824 3300031901 Bacteria 9464
270 Ga0307406_10155153 3300031901 Bacteria 1639
271 Ga0307407_10152244 3300031903 Bacteria 1504
272 Ga0307407_10283758 3300031903 Bacteria 1148
273 Ga0307411_10018432 3300032005 Bacteria 4004
274 Ga0307411_10044196 3300032005 Bacteria 2856
275 Ga0307415_100120161 3300032126 Bacteria 1968
276 Ga0307415_100412349 3300032126 Bacteria 1156
277 Ga0307507_10093905 3300033179 Bacteria 2553
278 Ga0373930_0005699 3300034816 Bacteria 2078
279 Ga0373951_0002540 3300035091 Bacteria 4586
280 Ga0373961_0029447 3300035241 Bacteria 1521
281 Ga0316574_0026169 3300035398 Bacteria 3507
282 Ga0373931_0054381 3300035691 Bacteria 2139
283 Ga0316582_0047787 3300036647 Bacteria 2703
284 Ga0316584_0080500 3300036712 Bacteria 2440
285 Ga0395900_0127852 3300037418 Bacteria 2605
286 Ga0395898_0201831 3300037466 Bacteria 1898
287 Ga0395898_0289327 3300037466 Bacteria 1563
288 Ga0395898_0353304 3300037466 Bacteria 1402
289 Ga0400484_23503 3300038725 Bacteria 5264
290 Ga0400488_17537 3300038741 Bacteria 1291
291 Ga0400488_51927 3300038741 Unclassified 2757
292 Ga0400483_011932 3300039062 Bacteria 1326
293 Ga0400483_036882 3300039062 Bacteria 5620
294 Ga0400483_081387 3300039062 Bacteria 4046
295 Ga0400483_122638 3300039062 Bacteria 1104
296 Ga0400483_176321 3300039062 Bacteria 4715
297 Ga0400483_216249 3300039062 Unclassified 1669
298 Ga0400483_242436 3300039062 Unclassified 3323
299 Ga0400483_272981 3300039062 Bacteria 2168
300 Ga0439466_0009184 3300041411 Bacteria 3703
301 Ga0439451_012808 3300042009 Bacteria 1694
302 Ga0439452_008268 3300042010 Bacteria 3143
303 Ga0439458_0016833 3300042157 Bacteria 1664
304 Ga0495627_000774 3300046453 Bacteria 23729
305 Ga0495627_003290 3300046453 Bacteria 7227
306 Ga0495591_009057 3300046458 Bacteria 3996
307 Ga0495591_037481 3300046458 Bacteria 1402
308 Ga0495653_0040466 3300046463 Bacteria 3642
309 Ga0495605_0000095 3300046474 Bacteria 112622
310 Ga0495605_0015180 3300046474 Bacteria 4197
311 Ga0495605_0022969 3300046474 Bacteria 3286
312 Ga0495639_0039945 3300046475 Bacteria 2110
313 Ga0495594_0004380 3300046499 Bacteria 7264
314 Ga0495607_0006625 3300046501 Bacteria 8121
315 Ga0495583_0000015 3300046506 Bacteria 316392
316 Ga0495583_0000779 3300046506 Bacteria 39867
317 Ga0495606_0000093 3300046507 Bacteria 152281
318 Ga0495610_0014582 3300046512 Bacteria 4609
319 Ga0495610_0032387 3300046512 Bacteria 2715
320 Ga0495620_0000042 3300046515 Bacteria 112107
321 Ga0495632_0004428 3300046519 Bacteria 9547
322 Ga0495644_0003962 3300046523 Bacteria 5819
323 Ga0495654_0011396 3300046530 Bacteria 4813
324 Ga0495598_0003620 3300046537 Bacteria 3296
325 Ga0495609_0000053 3300046538 Bacteria 149126
326 Ga0495609_0000133 3300046538 Bacteria 79787
327 Ga0495621_0017725 3300046539 Bacteria 2305
328 Ga0495621_0074194 3300046539 Bacteria 1258
329 Ga0495597_0002956 3300046542 Bacteria 10300
330 Ga0495645_0075430 3300046543 Bacteria 2427
331 Ga0495633_0000115 3300046558 Bacteria 108676
332 Ga0495611_0087049 3300046648 Bacteria 1442
333 Ga0495661_0001033 3300046665 Bacteria 24720
334 Ga0495658_0121817 3300046683 Bacteria 1578
335 Ga0495670_0004647 3300046691 Bacteria 6731
336 Ga0495671_0004646 3300046692 Bacteria 8137
337 Ga0495660_0005301 3300046810 Bacteria 7722
338 Ga0495636_0069389 3300047318 Bacteria 1502
339 Ga0495683_0000030 3300047323 Bacteria 150551
340 Ga0495673_0001151 3300047469 Bacteria 22526
341 Ga0495673_0022055 3300047469 Bacteria 3128
342 Ga0496101_0040744 3300048904 Bacteria 3308
343 Ga0496102_0123704 3300048905 Bacteria 2417
344 Ga0496103_0017643 3300048906 Bacteria 4272
345 Ga0496104_0439357 3300048907 Bacteria 1217
346 Ga0496105_0093968 3300048908 Bacteria 2476
347 Ga0496106_0215147 3300048909 Bacteria 1531
348 Ga0496107_0014066 3300048910 Bacteria 5602
349 Ga0496107_0126384 3300048910 Bacteria 1886
350 Ga0496108_0217391 3300048911 Bacteria 1660
351 Ga0496110_0095295 3300048913 Bacteria 2665
352 Ga0496111_0062958 3300048914 Bacteria 2690
353 Ga0496112_0131466 3300048915 Bacteria 2474
354 Ga0496112_0158166 3300048915 Bacteria 2233
355 Ga0496112_0193902 3300048915 Bacteria 1993
356 Ga0496112_0231393 3300048915 Bacteria 1803
357 Ga0496112_0481856 3300048915 Bacteria 1177
358 Ga0496113_0033918 3300048916 Bacteria 3720
359 Ga0496114_0004089 3300048917 Bacteria 11274
360 Ga0496114_0074748 3300048917 Bacteria 2853
361 Ga0496115_0018378 3300048918 Bacteria 5366
362 Ga0496119_0000060 3300048922 Bacteria 172646
363 Ga0496122_0062429 3300048925 Bacteria 2727
364 Ga0496123_0052232 3300048926 Bacteria 2714
365 Ga0496124_0234766 3300048927 Bacteria 1368
366 Ga0495678_000017 3300049459 Bacteria 282592
367 Ga0495682_0000264 3300049460 Bacteria 41397
368 Ga0501296_002719 3300049519 Bacteria 1866
369 Ga0501038_0007588 3300049574 Bacteria 10004
370 Ga0501070_0001032 3300049586 Bacteria 25035
371 Ga0501202_007758 3300049652 Bacteria 1945
372 Ga0501216_000302 3300049660 Bacteria 5501
373 Ga0501217_001814 3300049661 Bacteria 4092
374 Ga0501217_009527 3300049661 Bacteria 2114
375 Ga0501217_013609 3300049661 Bacteria 1828
376 Ga0501223_010599 3300049663 Bacteria 1852
377 Ga0501227_004378 3300049665 Bacteria 3039
378 Ga0501233_001349 3300049668 Bacteria 4210
379 Ga0501233_003372 3300049668 Bacteria 2871
380 Ga0501235_005698 3300049669 Bacteria 2709
381 Ga0501235_014799 3300049669 Bacteria 1719
382 Ga0501240_014075 3300049673 Bacteria 1119
383 Ga0501260_005509 3300049689 Bacteria 1193
384 Ga0501221_012962 3300049704 Bacteria 1526
385 Ga0501225_0012312 3300049705 Bacteria 2402
386 Ga0501225_0012922 3300049705 Bacteria 2341
387 Ga0501225_0021467 3300049705 Bacteria 1783
388 Ga0501283_015394 3300049779 Bacteria 1177
389 Ga0501226_002301 3300049853 Bacteria 2344
390 nmdc:mga07m45_59605_c1 3300050496 Bacteria 2160
391 nmdc:mga05p37_117202_c2 3300050507 Bacteria 2327
392 nmdc:mga05p37_276386_c1 3300050507 Bacteria 2005
393 nmdc:mga05p37_331506_c1 3300050507 Bacteria 1797
394 nmdc:mga05p37_558244_c1 3300050507 Bacteria 1302
395 nmdc:mga09592_125490_c1 3300050508 Unclassified 2206
396 nmdc:mga08y16_120509_c1 3300050511 Bacteria 2730
397 nmdc:mga08y16_135743_c1 3300050511 Bacteria 2557
398 nmdc:mga08y16_387154_c1 3300050511 Unclassified 1433
399 nmdc:mga0n895_150427_c1 3300050512 Unclassified 2358
400 nmdc:mga0n895_292129_c1 3300050512 Bacteria 1652
401 nmdc:mga0n895_597556_c1 3300050512 Bacteria 1106
402 nmdc:mga0n895_89650_c1 3300050512 Bacteria 3076
403 nmdc:mga0rr50_163971_c1 3300050513 Bacteria 1806
404 nmdc:mga0a205_38978_c1 3300050515 Bacteria 4572
405 nmdc:mga0a205_45629_c1 3300050515 Bacteria 4226
406 nmdc:mga0a205_68672_c1 3300050515 Unclassified 3423
407 Ga0500583_0001216 3300053092 Bacteria 7372
408 Ga0500555_030842 3300053103 Bacteria 1520
409 Ga0500655_023720 3300053133 Bacteria 1159
410 2904565128 2904564687 Bacteria 7609577
411 2904572176 2904571731 Bacteria 7608790
412 2946035182 2946033335 Bacteria 3835514
413 3007419955 3007419365 Bacteria 7026924
414 8020944204 8020938398 Bacteria 7472757
415 8020953987 8020953355 Bacteria 7439080
416 Ga0070707_100050628
417 CNAas_1001835
418 Ga0055528_1002644
419 Ga0065714_10064429
420 Ga0065704_10007673
421 Ga0065704_10086973
422 Ga0065712_10002180
423 Ga0065712_10067729
424 Ga0065712_10067807
425 Ga0065715_10094634
426 Ga0065715_10098855
427 Ga0065715_10119285
428 Ga0065715_10122264
429 Ga0065707_10023150
430 Ga0065707_10103612
431 Ga0070676_10235211
432 Ga0070690_100036393
433 Ga0070670_100000227
434 Ga0070670_100044226
435 Ga0068869_100162546
436 Ga0070666_10038792
437 Ga0070682_100000948
438 Ga0068868_100005497
439 Ga0070689_100065301
440 Ga0070692_10089811
441 Ga0070692_10094243
442 Ga0070692_10145321
443 Ga0070669_100008973
444 Ga0070671_100027979
445 Ga0070673_100122069
446 Ga0070701_10040082
447 Ga0070701_10106605
448 Ga0070705_100020230
449 Ga0070705_100039241
450 Ga0070705_100118071
451 Ga0070700_100000134
452 Ga0070700_100002526
453 Ga0070700_100008408
454 Ga0070700_100016113
455 Ga0070694_100002527
456 Ga0070694_100004795
457 Ga0070694_100005079
458 Ga0070694_100057022
459 Ga0070708_100286304
460 Ga0070662_100069763
461 Ga0070681_10042043
462 Ga0068867_100021741
463 Ga0068867_100374453
464 Ga0070706_100000030
465 Ga0070706_100195329
466 Ga0070707_100056315
467 Ga0070698_100014448
468 Ga0070698_100021423
469 Ga0070697_100000906
470 Ga0070697_100033104
471 Ga0070697_100527639
472 Ga0068853_100197404
473 Ga0070672_100469124
474 Ga0070686_100064569
475 Ga0070695_100022117
476 Ga0070695_100125407
477 Ga0070695_100157491
478 Ga0070696_100318110
479 Ga0070665_100083360
480 Ga0070704_100011343
481 Ga0070704_100089873
482 Ga0070704_100401415
483 Ga0068857_100013891
484 Ga0068857_100088075
485 Ga0068857_100095416
486 Ga0068854_100257949
487 Ga0070702_100000976
488 Ga0070702_100031844
489 Ga0068852_100096395
490 Ga0068852_100098515
491 Ga0068859_100006626
492 Ga0068859_100009890
493 Ga0068859_100016923
494 Ga0068859_100018685
495 Ga0068859_100019075
496 Ga0068859_100023936
497 Ga0068859_100043411
498 Ga0068859_100133791
499 Ga0068864_100005841
500 Ga0068864_100011678
501 Ga0068864_100109411
502 Ga0068864_100116839
503 Ga0068864_100163008
504 Ga0068866_10061701
505 Ga0068861_100000894
506 Ga0068863_100176735
507 Ga0068863_100358568
508 Ga0068858_100009725
509 Ga0068858_100031988
510 Ga0068858_100039660
511 Ga0068858_100103151
512 Ga0068860_100029548
513 Ga0068860_100038622
514 Ga0068860_100203458
515 Ga0068860_100236247
516 Ga0068860_100487025
517 Ga0068862_100030087
518 Ga0081539_10006167
519 Ga0075363_100134969
520 Ga0075362_10006518
521 Ga0075367_10044551
522 Ga0075369_10003625
523 Ga0097621_100002385
524 Ga0097621_100021397
525 Ga0068871_100001823
526 Ga0068871_100315869
527 Ga0075428_100070569
528 Ga0075430_100032643
529 Ga0075431_100162014
530 Ga0075433_10007861
531 Ga0075433_10208305
532 Ga0075434_100483965
533 Ga0075429_100006045
534 Ga0075429_100031706
535 Ga0075429_100281592
536 Ga0068865_100060701
537 Ga0097620_100006626
538 Ga0097620_100009891
539 Ga0097620_100016923
540 Ga0097620_100018685
541 Ga0097620_100019076
542 Ga0097620_100023937
543 Ga0097620_100043411
544 Ga0097620_100098992
545 Ga0097620_100133788
546 Ga0079104_1000423
547 Ga0075435_100008157
548 Ga0105251_10000191
549 Ga0105240_10057136
550 Ga0111539_10026490
551 Ga0111539_10199231
552 Ga0111539_10600137
553 Ga0111539_10719182
554 Ga0105245_10076224
555 Ga0105245_10621047
556 Ga0105247_10001911
557 Ga0105247_10064316
558 Ga0114129_10007363
559 Ga0114129_10029018
560 Ga0114129_10129452
561 Ga0105243_10001003
562 Ga0105243_10003567
563 Ga0105243_10164663
564 Ga0105243_10221504
565 Ga0105243_10544702
566 Ga0105241_10090511
567 Ga0105241_10260636
568 Ga0105242_10036058
569 Ga0105242_10093437
570 Ga0105248_10004867
571 Ga0105248_10020282
572 Ga0105248_10300477
573 Ga0105237_10070536
574 Ga0105237_10117873
575 Ga0105237_10170367
576 Ga0105238_10085616
577 Ga0105249_10005744
578 Ga0105246_10030268
579 Ga0105246_10082410
580 Ga0157373_10043585
581 Ga0157374_10062619
582 Ga0157378_10002117
583 Ga0157378_10098117
584 Ga0163162_10003516
585 Ga0163162_10003922
586 Ga0163162_10013383
587 Ga0163162_10110256
588 Ga0163162_10124757
589 Ga0157372_10011616
590 Ga0157372_10055337
591 Ga0157372_10792771
592 Ga0157375_10007132
593 Ga0157375_10065059
594 Ga0157375_10330909
595 Ga0157375_10385851
596 Ga0163163_10000948
597 Ga0163163_10005288
598 Ga0163163_10057799
599 Ga0163163_10067497
600 Ga0163163_10224345
601 Ga0157380_10001046
602 Ga0157380_10019711
603 Ga0157379_10087050
604 Ga0157376_10038046
605 Ga0182007_10002528
606 Ga0163161_10063609
607 Ga0209673_1000028
608 Ga0209564_1016040
609 Ga0207713_1032996
610 Ga0207642_10191539
611 Ga0207710_10002095
612 Ga0207680_10049208
613 Ga0207645_10240426
614 Ga0207684_10000089
615 Ga0207684_10142206
616 Ga0207654_10177701
617 Ga0207707_10329106
618 Ga0207695_10003114
619 Ga0207695_10077180
620 Ga0207671_10066241
621 Ga0207671_10075742
622 Ga0207646_10157357
623 Ga0207681_10016280
624 Ga0207681_10020628
625 Ga0207694_10019215
626 Ga0207650_10000027
627 Ga0207650_10141860
628 Ga0207706_10351932
629 Ga0207709_10001274
630 Ga0207709_10005304
631 Ga0207709_10364843
632 Ga0207704_10160043
633 Ga0207691_10331109
634 Ga0207711_10002991
635 Ga0207711_10018225
636 Ga0207711_10060679
637 Ga0207689_10003721
638 Ga0207689_10201392
639 Ga0207651_10269725
640 Ga0207712_10103321
641 Ga0207677_10049272
642 Ga0207703_10048903
643 Ga0207703_10057007
644 Ga0207703_10120282
645 Ga0207703_10259071
646 Ga0207703_10267153
647 Ga0207708_10000028
648 Ga0207708_10005474
649 Ga0207708_10019545
650 Ga0207708_10032253
651 Ga0207641_10014903
652 Ga0207641_10099800
653 Ga0207641_10104048
654 Ga0207648_10395281
655 Ga0207676_10018540
656 Ga0207676_10023036
657 Ga0207676_10144303
658 Ga0207676_10146644
659 Ga0207676_10228680
660 Ga0207674_10042499
661 Ga0207674_10113537
662 Ga0207674_10173549
663 Ga0207675_100002832
664 Ga0207675_100031845
665 Ga0207675_100089647
666 Ga0207698_10375520
667 Ga0207698_10482608
668 Ga0268266_10187871
669 Ga0268264_10018868
670 Ga0268264_10051561
671 Ga0268264_10130899
672 Ga0268264_10407235
673 Ga0307511_10002167
674 Ga0265327_10087678
675 Ga0307408_100178420
676 Ga0307408_100225082
677 Ga0265314_10004885
678 Ga0316578_10035541
679 Ga0316578_10065873
680 Ga0307405_10007788
681 Ga0316042_111087
682 Ga0307413_10195017
683 Ga0316043_108601
684 Ga0307406_10002824
685 Ga0307406_10155153
686 Ga0307407_10152244
687 Ga0307407_10283758
688 Ga0307411_10018432
689 Ga0307411_10044196
690 Ga0307415_100120161
691 Ga0307415_100412349
692 Ga0307507_10093905
693 Ga0373930_0005699
694 Ga0373951_0002540
695 Ga0373961_0029447
696 Ga0316574_0026169
697 Ga0373931_0054381
698 Ga0316582_0047787
699 Ga0316584_0080500
700 Ga0395900_0127852
701 Ga0395898_0201831
702 Ga0395898_0289327
703 Ga0395898_0353304
704 Ga0400484_23503
705 Ga0400488_17537
706 Ga0400488_51927
707 Ga0400483_011932
708 Ga0400483_036882
709 Ga0400483_081387
710 Ga0400483_122638
711 Ga0400483_176321
712 Ga0400483_216249
713 Ga0400483_242436
714 Ga0400483_272981
715 Ga0439466_0009184
716 Ga0439451_012808
717 Ga0439452_008268
718 Ga0439458_0016833
719 Ga0495627_000774
720 Ga0495627_003290
721 Ga0495591_009057
722 Ga0495591_037481
723 Ga0495653_0040466
724 Ga0495605_0000095
725 Ga0495605_0015180
726 Ga0495605_0022969
727 Ga0495639_0039945
728 Ga0495594_0004380
729 Ga0495607_0006625
730 Ga0495583_0000015
731 Ga0495583_0000779
732 Ga0495606_0000093
733 Ga0495610_0014582
734 Ga0495610_0032387
735 Ga0495620_0000042
736 Ga0495632_0004428
737 Ga0495644_0003962
738 Ga0495654_0011396
739 Ga0495598_0003620
740 Ga0495609_0000053
741 Ga0495609_0000133
742 Ga0495621_0017725
743 Ga0495621_0074194
744 Ga0495597_0002956
745 Ga0495645_0075430
746 Ga0495633_0000115
747 Ga0495611_0087049
748 Ga0495661_0001033
749 Ga0495658_0121817
750 Ga0495670_0004647
751 Ga0495671_0004646
752 Ga0495660_0005301
753 Ga0495636_0069389
754 Ga0495683_0000030
755 Ga0495673_0001151
756 Ga0495673_0022055
757 Ga0496101_0040744
758 Ga0496102_0123704
759 Ga0496103_0017643
760 Ga0496104_0439357
761 Ga0496105_0093968
762 Ga0496106_0215147
763 Ga0496107_0014066
764 Ga0496107_0126384
765 Ga0496108_0217391
766 Ga0496110_0095295
767 Ga0496111_0062958
768 Ga0496112_0131466
769 Ga0496112_0158166
770 Ga0496112_0193902
771 Ga0496112_0231393
772 Ga0496112_0481856
773 Ga0496113_0033918
774 Ga0496114_0004089
775 Ga0496114_0074748
776 Ga0496115_0018378
777 Ga0496119_0000060
778 Ga0496122_0062429
779 Ga0496123_0052232
780 Ga0496124_0234766
781 Ga0495678_000017
782 Ga0495682_0000264
783 Ga0501296_002719
784 Ga0501038_0007588
785 Ga0501070_0001032
786 Ga0501202_007758
787 Ga0501216_000302
788 Ga0501217_001814
789 Ga0501217_009527
790 Ga0501217_013609
791 Ga0501223_010599
792 Ga0501227_004378
793 Ga0501233_001349
794 Ga0501233_003372
795 Ga0501235_005698
796 Ga0501235_014799
797 Ga0501240_014075
798 Ga0501260_005509
799 Ga0501221_012962
800 Ga0501225_0012312
801 Ga0501225_0012922
802 Ga0501225_0021467
803 Ga0501283_015394
804 Ga0501226_002301
805 nmdc:mga07m45_59605_c1
806 nmdc:mga05p37_117202_c2
807 nmdc:mga05p37_276386_c1
808 nmdc:mga05p37_331506_c1
809 nmdc:mga05p37_558244_c1
810 nmdc:mga09592_125490_c1
811 nmdc:mga08y16_120509_c1
812 nmdc:mga08y16_135743_c1
813 nmdc:mga08y16_387154_c1
814 nmdc:mga0n895_150427_c1
815 nmdc:mga0n895_292129_c1
816 nmdc:mga0n895_597556_c1
817 nmdc:mga0n895_89650_c1
818 nmdc:mga0rr50_163971_c1
819 nmdc:mga0a205_38978_c1
820 nmdc:mga0a205_45629_c1
821 nmdc:mga0a205_68672_c1
822 Ga0500583_0001216
823 Ga0500555_030842
824 Ga0500655_023720
825 2904565128
826 2904572176
827 2946035182
828 3007419955
829 8020944204
830 8020953987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

75

342

0.8

PF12146

Hydrolase_4

Serine aminopeptidase, S33

71

340

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

77

345

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
1azw-assembly1.cif.gz_B proline iminopeptidase from xanthomonas campestris pv. citri 0.996 1 314
1x2e-assembly1.cif.gz_A the crystal structure of prolyl aminopeptidase complexed with ala-tboda 0.9928 1 314
1azw-assembly1.cif.gz_B proline iminopeptidase from xanthomonas campestris pv. citri 0.9897 1 314
5yhp-assembly1.cif.gz_A proline iminopeptidase from psychrophilic yeast glaciozyma antarctica 0.985 4 314
1x2e-assembly1.cif.gz_A the crystal structure of prolyl aminopeptidase complexed with ala-tboda 0.9834 1 314
ID Description Score Start End Superfamily
af_I1ME45_71_383_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9937 1 313 3.40.50.1820
af_Q0DGS8_1_242_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9925 71 314 3.40.50.1820
af_Q0DGS8_1_242_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9884 71 314 3.40.50.1820
af_I1ME45_71_383_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9842 1 313 3.40.50.1820
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8235 7 124 3.40.50.12270
ID Description Score Start End GO Terms
AF-A0A7Z8LT33-F1-model_v4 deleted 0.9972 2 314
AF-M5CV36-F1-model_v4 deleted 0.9968 40 314
AF-A0A7W7FF57-F1-model_v4 deleted 0.9967 1 314
AF-A0A0A9DRL7-F1-model_v4 prolyl aminopeptidase (EC 3.4.11.5) (Prolyl aminopeptidase) 0.9967 2 132 GO:0004177
GO:0005737
GO:0006508
AF-A0A1U8Z8T6-F1-model_v4 deleted 0.9966 1 314

Map