F438369

General Info

Members Datasets Scaffolds Average Seq Length
414 246 820 144

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0024926|Ga0373954_0024926_1190_1723
Length 177
Sequence LIQVNLSDGSADKVVSYDGRRPSRQELETAMYKHILVPTDGSKLSTKAIRAATRLAELCGAKITGAYVIAPDLPPVYAEGVTYGGLSSRNYKELKEKEAKKALAVVDIEAQTCGLQASTISLTADQPWKAIIGAARSKKCDLIVMASHGRRGLSGLLLGSETAKVLTHSKTPVLVCR

Samples

Sample ID Description Type Environment
1 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
185 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.11
Nodule 0.24
Rhizoplane 7
Rhizosphere 85.75
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373954_0024926 3300035118 Bacteria 2730
2 JGI25404J52841_10005355 3300003659 Bacteria 2650
3 Ga0065707_11013937 3300005295 Unclassified 523
4 Ga0070658_10002337 3300005327 Bacteria 15918
5 Ga0070658_10071495 3300005327 Bacteria 2842
6 Ga0070658_10958612 3300005327 Bacteria 744
7 Ga0070658_11321121 3300005327 Bacteria 626
8 Ga0070683_100012404 3300005329 Bacteria 7406
9 Ga0070683_100934907 3300005329 Bacteria 832
10 Ga0070670_100025876 3300005331 Bacteria 5048
11 Ga0070677_10164310 3300005333 Bacteria 1044
12 Ga0068868_100012995 3300005338 Bacteria 6093
13 Ga0068868_100174670 3300005338 Bacteria 1780
14 Ga0070660_100288459 3300005339 Bacteria 1344
15 Ga0070689_100404118 3300005340 Bacteria 1155
16 Ga0070689_100408508 3300005340 Bacteria 1149
17 Ga0070687_100536116 3300005343 Bacteria 794
18 Ga0070687_101014338 3300005343 Bacteria 602
19 Ga0070661_100009347 3300005344 Bacteria 6779
20 Ga0070661_100746378 3300005344 Bacteria 800
21 Ga0070661_100753224 3300005344 Bacteria 796
22 Ga0070692_10174119 3300005345 Bacteria 1243
23 Ga0070671_100464095 3300005355 Bacteria 1087
24 Ga0070671_101161462 3300005355 Bacteria 679
25 Ga0070674_100060152 3300005356 Bacteria 2647
26 Ga0070673_100002778 3300005364 Bacteria 10763
27 Ga0070659_100097302 3300005366 Bacteria 2365
28 Ga0070667_100091853 3300005367 Bacteria 2611
29 Ga0070709_10027478 3300005434 Bacteria 3383
30 Ga0070709_10129641 3300005434 Bacteria 1720
31 Ga0070714_100121970 3300005435 Bacteria 2319
32 Ga0070714_100269307 3300005435 Bacteria 1579
33 Ga0070714_100527086 3300005435 Bacteria 1129
34 Ga0070713_100002300 3300005436 Bacteria 12433
35 Ga0070713_100013312 3300005436 Bacteria 6069
36 Ga0070713_102041846 3300005436 Bacteria 556
37 Ga0070710_10008526 3300005437 Bacteria 4992
38 Ga0070701_10047296 3300005438 Bacteria 2215
39 Ga0070701_10655297 3300005438 Bacteria 701
40 Ga0070711_100007756 3300005439 Bacteria 6538
41 Ga0070711_100069869 3300005439 Bacteria 2471
42 Ga0070711_100190158 3300005439 Bacteria 1577
43 Ga0070700_100769943 3300005441 Unclassified 772
44 Ga0070694_100236596 3300005444 Bacteria 1376
45 Ga0070694_100804049 3300005444 Bacteria 771
46 Ga0070663_100035277 3300005455 Bacteria 3469
47 Ga0070678_100072452 3300005456 Bacteria 2582
48 Ga0070678_100571647 3300005456 Bacteria 1006
49 Ga0070678_100613197 3300005456 Bacteria 973
50 Ga0070662_100268576 3300005457 Bacteria 1376
51 Ga0070681_10344340 3300005458 Bacteria 1401
52 Ga0068867_100075820 3300005459 Unclassified 2524
53 Ga0070706_101513571 3300005467 Bacteria 613
54 Ga0070699_100472294 3300005518 Bacteria 1138
55 Ga0070679_100032933 3300005530 Bacteria 5130
56 Ga0070679_100454016 3300005530 Bacteria 1226
57 Ga0070679_100501908 3300005530 Bacteria 1157
58 Ga0070684_100057481 3300005535 Bacteria 3397
59 Ga0070684_100203279 3300005535 Bacteria 1804
60 Ga0070684_100757393 3300005535 Unclassified 907
61 Ga0070697_101895438 3300005536 Unclassified 533
62 Ga0068853_100019012 3300005539 Bacteria 5693
63 Ga0068853_100450760 3300005539 Unclassified 1210
64 Ga0070686_100386823 3300005544 Bacteria 1060
65 Ga0070696_101120825 3300005546 Bacteria 662
66 Ga0070665_100050454 3300005548 Bacteria 4175
67 Ga0070665_100600466 3300005548 Unclassified 1114
68 Ga0070665_101387282 3300005548 Bacteria 712
69 Ga0070704_100040929 3300005549 Bacteria 3194
70 Ga0070704_100117621 3300005549 Bacteria 2035
71 Ga0070704_100966498 3300005549 Bacteria 769
72 Ga0068855_100004013 3300005563 Bacteria 17975
73 Ga0068855_100059031 3300005563 Bacteria 4490
74 Ga0068855_100082459 3300005563 Bacteria 3727
75 Ga0068855_100226986 3300005563 Bacteria 2092
76 Ga0068855_100732076 3300005563 Bacteria 1056
77 Ga0068855_101655182 3300005563 Bacteria 654
78 Ga0070664_100014403 3300005564 Bacteria 6448
79 Ga0070664_100722141 3300005564 Bacteria 929
80 Ga0068854_100031326 3300005578 Bacteria 3695
81 Ga0068856_100167767 3300005614 Bacteria 2207
82 Ga0068856_101285942 3300005614 Bacteria 747
83 Ga0068856_102442827 3300005614 Bacteria 530
84 Ga0070702_100234338 3300005615 Bacteria 1235
85 Ga0070702_100393540 3300005615 Bacteria 989
86 Ga0070702_100822981 3300005615 Bacteria 720
87 Ga0068852_100003138 3300005616 Bacteria 11514
88 Ga0068852_100004579 3300005616 Bacteria 9792
89 Ga0068852_100006924 3300005616 Bacteria 8245
90 Ga0068852_100026588 3300005616 Bacteria 4706
91 Ga0068852_100557437 3300005616 Bacteria 1147
92 Ga0068859_100164925 3300005617 Bacteria 2295
93 Ga0068859_100550544 3300005617 Bacteria 1248
94 Ga0068864_100039878 3300005618 Bacteria 4015
95 Ga0068864_100189188 3300005618 Bacteria 1886
96 Ga0068864_100229842 3300005618 Bacteria 1715
97 Ga0068864_100476924 3300005618 Bacteria 1197
98 Ga0068861_101083792 3300005719 Bacteria 769
99 Ga0068851_10031433 3300005834 Bacteria 2637
100 Ga0068870_10432046 3300005840 Unclassified 864
101 Ga0068863_100185771 3300005841 Bacteria 1996
102 Ga0068863_100530667 3300005841 Bacteria 1161
103 Ga0068863_100564470 3300005841 Bacteria 1125
104 Ga0068863_101464821 3300005841 Bacteria 691
105 Ga0068858_100155833 3300005842 Bacteria 2149
106 Ga0068858_101190668 3300005842 Unclassified 749
107 Ga0068860_100283362 3300005843 Bacteria 1620
108 Ga0081455_10659961 3300005937 Bacteria 672
109 Ga0081540_1003623 3300005983 Bacteria 12125
110 Ga0081539_10017091 3300005985 Bacteria 5119
111 Ga0075365_10004963 3300006038 Bacteria 7121
112 Ga0075363_100005910 3300006048 Bacteria 5511
113 Ga0075364_10143540 3300006051 Bacteria 1607
114 Ga0075362_10260999 3300006177 Bacteria 854
115 Ga0075367_10263070 3300006178 Bacteria 1083
116 Ga0075366_10093823 3300006195 Bacteria 1799
117 Ga0097621_100013122 3300006237 Bacteria 6163
118 Ga0075370_10013636 3300006353 Bacteria 4325
119 Ga0068871_100034904 3300006358 Bacteria 3994
120 Ga0068871_100086442 3300006358 Bacteria 2605
121 Ga0068871_100468471 3300006358 Bacteria 1131
122 Ga0068871_100852838 3300006358 Bacteria 842
123 Ga0068871_101886823 3300006358 Bacteria 568
124 Ga0075428_100070228 3300006844 Bacteria 3829
125 Ga0075434_100060542 3300006871 Bacteria 3766
126 Ga0075434_100101649 3300006871 Bacteria 2882
127 Ga0075434_100375729 3300006871 Bacteria 1442
128 Ga0075434_101347446 3300006871 Unclassified 724
129 Ga0075429_100479446 3300006880 Bacteria 1090
130 Ga0075429_101177709 3300006880 Bacteria 669
131 Ga0068865_100376675 3300006881 Bacteria 1157
132 Ga0068865_101387444 3300006881 Unclassified 627
133 Ga0075436_100007137 3300006914 Bacteria 7646
134 Ga0097620_100164927 3300006931 Bacteria 2295
135 Ga0097620_100550547 3300006931 Bacteria 1248
136 Ga0075435_100281666 3300007076 Bacteria 1419
137 Ga0075435_100314189 3300007076 Bacteria 1341
138 Ga0105250_10489743 3300009092 Bacteria 557
139 Ga0105240_10023775 3300009093 Bacteria 8095
140 Ga0105240_10032510 3300009093 Bacteria 6754
141 Ga0105240_10076949 3300009093 Bacteria 4112
142 Ga0105240_10320294 3300009093 Bacteria 1768
143 Ga0105240_11313801 3300009093 Bacteria 762
144 Ga0111539_10000770 3300009094 Bacteria 41689
145 Ga0111539_11768004 3300009094 Bacteria 717
146 Ga0111539_12981515 3300009094 Unclassified 547
147 Ga0105245_10194300 3300009098 Bacteria 1946
148 Ga0105245_10345643 3300009098 Bacteria 1472
149 Ga0105245_10880201 3300009098 Unclassified 937
150 Ga0105247_10161108 3300009101 Bacteria 1485
151 Ga0105247_11080763 3300009101 Unclassified 632
152 Ga0114129_10737924 3300009147 Bacteria 1262
153 Ga0105243_10071771 3300009148 Bacteria 2801
154 Ga0105243_10215044 3300009148 Bacteria 1695
155 Ga0105243_10520462 3300009148 Bacteria 1131
156 Ga0105243_11199796 3300009148 Bacteria 772
157 Ga0105241_10006556 3300009174 Bacteria 8580
158 Ga0105241_11389943 3300009174 Unclassified 672
159 Ga0105242_10182470 3300009176 Bacteria 1852
160 Ga0105248_10029877 3300009177 Bacteria 6082
161 Ga0105248_10495064 3300009177 Bacteria 1378
162 Ga0105248_11880552 3300009177 Bacteria 679
163 Ga0105237_10202319 3300009545 Bacteria 1986
164 Ga0105238_10012982 3300009551 Bacteria 8408
165 Ga0105238_10425596 3300009551 Bacteria 1323
166 Ga0105238_10736470 3300009551 Bacteria 999
167 Ga0105249_10200221 3300009553 Bacteria 1954
168 Ga0105239_10325376 3300010375 Unclassified 1734
169 Ga0105246_10430982 3300011119 Bacteria 1103
170 Ga0105246_11462166 3300011119 Unclassified 640
171 Ga0157341_1032608 3300012494 Bacteria 570
172 Ga0157370_10010253 3300013104 Bacteria 9894
173 Ga0157370_10237215 3300013104 Bacteria 1688
174 Ga0157370_11413501 3300013104 Bacteria 626
175 Ga0157369_10060223 3300013105 Bacteria 4094
176 Ga0157369_10522099 3300013105 Bacteria 1228
177 Ga0157369_10663019 3300013105 Bacteria 1075
178 Ga0157374_10015981 3300013296 Bacteria 6593
179 Ga0157374_11396570 3300013296 Bacteria 723
180 Ga0157378_10040195 3300013297 Bacteria 4147
181 Ga0157378_10052034 3300013297 Bacteria 3644
182 Ga0163162_10102348 3300013306 Bacteria 2957
183 Ga0163162_10244638 3300013306 Bacteria 1925
184 Ga0163162_10989669 3300013306 Bacteria 950
185 Ga0157372_10034312 3300013307 Bacteria 5577
186 Ga0157372_11099240 3300013307 Bacteria 920
187 Ga0157375_10006901 3300013308 Bacteria 9907
188 Ga0163163_10001936 3300014325 Bacteria 17537
189 Ga0163163_10086015 3300014325 Bacteria 3152
190 Ga0157380_10425404 3300014326 Bacteria 1268
191 Ga0157379_10071814 3300014968 Bacteria 3096
192 Ga0157376_10008792 3300014969 Bacteria 7307
193 Ga0157376_11438685 3300014969 Bacteria 721
194 Ga0163161_10108697 3300017792 Bacteria 2071
195 Ga0213872_10107671 3300021361 Bacteria 1239
196 Ga0213876_10037660 3300021384 Bacteria 2552
197 Ga0213876_10139310 3300021384 Bacteria 1290
198 Ga0213875_10361414 3300021388 Bacteria 690
199 Ga0213871_10117769 3300021441 Bacteria 790
200 Ga0209677_103177 3300025253 Bacteria 5528
201 Ga0209233_1008639 3300025261 Bacteria 3135
202 Ga0207697_10258140 3300025315 Unclassified 771
203 Ga0207656_10034744 3300025321 Bacteria 2106
204 Ga0207692_10044306 3300025898 Bacteria 2219
205 Ga0207692_10464120 3300025898 Bacteria 799
206 Ga0207710_10035331 3300025900 Bacteria 2199
207 Ga0207688_10510208 3300025901 Unclassified 754
208 Ga0207699_10118920 3300025906 Bacteria 1706
209 Ga0207699_10331934 3300025906 Bacteria 1069
210 Ga0207699_10501669 3300025906 Bacteria 876
211 Ga0207699_11306751 3300025906 Bacteria 537
212 Ga0207705_10020309 3300025909 Bacteria 4749
213 Ga0207705_10599616 3300025909 Bacteria 856
214 Ga0207705_10719394 3300025909 Bacteria 776
215 Ga0207654_10091675 3300025911 Bacteria 1854
216 Ga0207654_11016436 3300025911 Bacteria 603
217 Ga0207707_10224351 3300025912 Bacteria 1635
218 Ga0207695_10020822 3300025913 Bacteria 7498
219 Ga0207695_10134379 3300025913 Bacteria 2428
220 Ga0207695_10163908 3300025913 Bacteria 2152
221 Ga0207695_10487837 3300025913 Bacteria 1114
222 Ga0207693_10216576 3300025915 Bacteria 1505
223 Ga0207663_10039821 3300025916 Bacteria 2851
224 Ga0207663_10061701 3300025916 Bacteria 2380
225 Ga0207662_10108996 3300025918 Bacteria 1724
226 Ga0207662_10486616 3300025918 Bacteria 848
227 Ga0207662_10696107 3300025918 Bacteria 712
228 Ga0207657_10241215 3300025919 Bacteria 1443
229 Ga0207649_10026288 3300025920 Bacteria 3403
230 Ga0207652_10041958 3300025921 Bacteria 3891
231 Ga0207652_10433122 3300025921 Bacteria 1186
232 Ga0207694_10074355 3300025924 Bacteria 2660
233 Ga0207694_10287606 3300025924 Bacteria 1351
234 Ga0207694_10370466 3300025924 Bacteria 1188
235 Ga0207650_10031931 3300025925 Unclassified 3807
236 Ga0207687_10445746 3300025927 Bacteria 1073
237 Ga0207687_11071396 3300025927 Unclassified 692
238 Ga0207700_10018728 3300025928 Bacteria 4660
239 Ga0207700_10062815 3300025928 Bacteria 2822
240 Ga0207700_11209975 3300025928 Bacteria 674
241 Ga0207664_10055718 3300025929 Bacteria 3138
242 Ga0207664_10383704 3300025929 Unclassified 1248
243 Ga0207664_10606051 3300025929 Bacteria 983
244 Ga0207644_10148829 3300025931 Bacteria 1810
245 Ga0207686_10066326 3300025934 Bacteria 2305
246 Ga0207709_10084702 3300025935 Bacteria 2053
247 Ga0207709_10384862 3300025935 Bacteria 1068
248 Ga0207670_10323088 3300025936 Bacteria 1215
249 Ga0207704_11276353 3300025938 Unclassified 627
250 Ga0207665_10139384 3300025939 Bacteria 1728
251 Ga0207691_10019762 3300025940 Bacteria 6370
252 Ga0207711_10303187 3300025941 Bacteria 1474
253 Ga0207711_10827200 3300025941 Unclassified 862
254 Ga0207679_10313681 3300025945 Bacteria 1356
255 Ga0207679_11216200 3300025945 Bacteria 691
256 Ga0207667_10005711 3300025949 Bacteria 15175
257 Ga0207667_10059504 3300025949 Bacteria 4001
258 Ga0207667_10075954 3300025949 Bacteria 3487
259 Ga0207667_10095244 3300025949 Bacteria 3074
260 Ga0207667_11345044 3300025949 Bacteria 689
261 Ga0207712_10796253 3300025961 Bacteria 831
262 Ga0207668_10286253 3300025972 Bacteria 1354
263 Ga0207640_10049748 3300025981 Unclassified 2716
264 Ga0207658_10093866 3300025986 Unclassified 2334
265 Ga0207677_10002792 3300026023 Bacteria 9224
266 Ga0207677_10117738 3300026023 Bacteria 1992
267 Ga0207703_10124632 3300026035 Bacteria 2216
268 Ga0207639_10129030 3300026041 Bacteria 2090
269 Ga0207678_10012944 3300026067 Bacteria 7319
270 Ga0207702_10045632 3300026078 Bacteria 3687
271 Ga0207702_10557024 3300026078 Bacteria 1122
272 Ga0207641_10165220 3300026088 Bacteria 2015
273 Ga0207641_10490825 3300026088 Bacteria 1191
274 Ga0207648_10099222 3300026089 Unclassified 2550
275 Ga0207676_10171212 3300026095 Bacteria 1892
276 Ga0207676_10416927 3300026095 Bacteria 1258
277 Ga0207676_11475230 3300026095 Bacteria 677
278 Ga0207675_100159228 3300026118 Bacteria 2153
279 Ga0207675_100696045 3300026118 Bacteria 1025
280 Ga0207683_10011755 3300026121 Bacteria 7470
281 Ga0207683_10406634 3300026121 Bacteria 1253
282 Ga0207698_10014541 3300026142 Bacteria 5236
283 Ga0207698_10016466 3300026142 Bacteria 4984
284 Ga0207698_10098540 3300026142 Bacteria 2416
285 Ga0207698_10258385 3300026142 Bacteria 1599
286 Ga0207698_10477021 3300026142 Bacteria 1209
287 Ga0207698_12202902 3300026142 Bacteria 564
288 Ga0207428_10004344 3300027907 Bacteria 13541
289 Ga0207428_10732518 3300027907 Bacteria 706
290 Ga0268266_10003891 3300028379 Bacteria 14536
291 Ga0268266_10069127 3300028379 Unclassified 3060
292 Ga0268264_10500386 3300028381 Bacteria 1185
293 Ga0265338_10541939 3300028800 Unclassified 815
294 Ga0265339_10098897 3300031249 Bacteria 1521
295 Ga0307408_100646690 3300031548 Bacteria 945
296 Ga0265314_10046020 3300031711 Bacteria 3081
297 Ga0307405_10410006 3300031731 Bacteria 1063
298 Ga0307413_11521589 3300031824 Bacteria 592
299 Ga0307412_10301310 3300031911 Bacteria 1267
300 Ga0307416_100155436 3300032002 Bacteria 2105
301 Ga0307416_100159610 3300032002 Bacteria 2082
302 Ga0307416_100836922 3300032002 Bacteria 1018
303 Ga0307415_101125649 3300032126 Bacteria 736
304 Ga0373943_0497449 3300035170 Bacteria 712
305 Ga0373946_0488979 3300035171 Bacteria 630
306 Ga0373962_0407583 3300035242 Bacteria 501
307 Ga0373933_0606821 3300035724 Bacteria 719
308 Ga0373937_0068001 3300036401 Bacteria 3284
309 Ga0373925_0019448 3300037068 Bacteria 4939
310 Ga0395899_0039896 3300037312 Bacteria 3513
311 Ga0395900_0162927 3300037418 Bacteria 2274
312 Ga0395905_0196363 3300037471 Bacteria 1892
313 Ga0436364_0708967 3300037853 Bacteria 2316
314 Ga0395901_0137159 3300038443 Bacteria 2571
315 Ga0436365_0847353 3300039437 Bacteria 1263
316 Ga0436365_1550977 3300039437 Bacteria 3921
317 Ga0436360_0645289 3300039438 Bacteria 1256
318 Ga0436361_0658449 3300039447 Bacteria 5135
319 Ga0436361_0937161 3300039447 Bacteria 602
320 Ga0436363_1432495 3300039450 Bacteria 605
321 Ga0451793_1593678 3300041452 Bacteria 693
322 Ga0451807_2486081 3300041486 Unclassified 1355
323 Ga0451837_1189306 3300041494 Bacteria 906
324 Ga0439432_142926 3300042006 Bacteria 703
325 Ga0451577_0411895 3300042876 Bacteria 1227
326 Ga0451577_0444869 3300042876 Bacteria 1177
327 Ga0466957_0591134 3300044842 Bacteria 776
328 Ga0451576_0812066 3300045051 Bacteria 982
329 Ga0451576_0981488 3300045051 Bacteria 885
330 Ga0495580_0002694 3300046472 Bacteria 15363
331 Ga0495594_0514892 3300046499 Bacteria 679
332 Ga0495630_0242790 3300046517 Bacteria 1376
333 Ga0495644_0035529 3300046523 Bacteria 1882
334 Ga0495598_0256581 3300046537 Bacteria 649
335 Ga0495621_0058378 3300046539 Bacteria 1395
336 Ga0495621_0426793 3300046539 Bacteria 565
337 Ga0495645_0221063 3300046543 Bacteria 1274
338 Ga0495667_0060020 3300046559 Bacteria 2495
339 Ga0495635_0348936 3300046663 Bacteria 987
340 Ga0495658_0896708 3300046683 Bacteria 567
341 Ga0495680_0029255 3300047322 Bacteria 4512
342 Ga0496100_0182129 3300048903 Unclassified 1520
343 Ga0496101_0246658 3300048904 Bacteria 1391
344 Ga0496101_0265954 3300048904 Bacteria 1338
345 Ga0496102_0106720 3300048905 Bacteria 2607
346 Ga0496102_0652353 3300048905 Bacteria 976
347 Ga0496104_0006867 3300048907 Bacteria 10035
348 Ga0496104_0095878 3300048907 Bacteria 2838
349 Ga0496104_0162464 3300048907 Bacteria 2142
350 Ga0496105_0266547 3300048908 Bacteria 1384
351 Ga0496106_0000036 3300048909 Bacteria 124990
352 Ga0496106_0072421 3300048909 Bacteria 2635
353 Ga0496106_0072882 3300048909 Bacteria 2627
354 Ga0496106_0299586 3300048909 Unclassified 1289
355 Ga0496108_0005236 3300048911 Bacteria 10475
356 Ga0496109_0266022 3300048912 Bacteria 1615
357 Ga0496109_0439809 3300048912 Bacteria 1232
358 Ga0496110_0000804 3300048913 Bacteria 21978
359 Ga0496110_0013589 3300048913 Bacteria 6739
360 Ga0496110_0659395 3300048913 Bacteria 946
361 Ga0496110_1190300 3300048913 Bacteria 671
362 Ga0496111_0167634 3300048914 Bacteria 1631
363 Ga0496112_0000992 3300048915 Bacteria 20760
364 Ga0496113_0260128 3300048916 Bacteria 1386
365 Ga0496113_1564240 3300048916 Unclassified 508
366 Ga0496115_0024858 3300048918 Bacteria 4659
367 Ga0496115_0033420 3300048918 Bacteria 4061
368 Ga0496115_0089637 3300048918 Bacteria 2512
369 Ga0496118_0084156 3300048921 Bacteria 2220
370 Ga0496121_0037323 3300048924 Bacteria 4317
371 Ga0496121_0097605 3300048924 Bacteria 2276
372 Ga0496121_0213156 3300048924 Bacteria 1366
373 Ga0501032_0139667 3300049569 Bacteria 1596
374 Ga0501042_1057144 3300049578 Bacteria 592
375 Ga0501046_0446668 3300049580 Bacteria 930
376 Ga0501047_0025440 3300049581 Bacteria 5690
377 Ga0501067_0086319 3300049583 Bacteria 1741
378 Ga0501068_0084435 3300049584 Bacteria 1953
379 Ga0501069_0001356 3300049585 Bacteria 12012
380 Ga0501070_0003137 3300049586 Bacteria 14390
381 Ga0501070_0081472 3300049586 Bacteria 2678
382 Ga0501072_0098090 3300049588 Bacteria 2329
383 Ga0501073_0004830 3300049589 Bacteria 10113
384 Ga0501073_0548217 3300049589 Unclassified 799
385 Ga0501074_0013164 3300049590 Bacteria 6015
386 Ga0501079_0075339 3300049741 Bacteria 2609
387 Ga0501080_0005873 3300049742 Bacteria 10994
388 Ga0501080_0170282 3300049742 Bacteria 2009
389 Ga0501083_0253427 3300049744 Bacteria 1145
390 Ga0501035_0299118 3300049822 Bacteria 1356
391 Ga0501044_0382983 3300049823 Bacteria 1321
392 nmdc:mga03n38_6776_c1 3300050490 Bacteria 4009
393 nmdc:mga00v17_180431_c1 3300050491 Bacteria 1362
394 nmdc:mga0yw44_111010_c1 3300050492 Bacteria 1757
395 nmdc:mga0yw44_47264_c1 3300050492 Bacteria 2589
396 nmdc:mga0k408_41890_c1 3300050493 Bacteria 2637
397 nmdc:mga06z11_158443_c1 3300050494 Bacteria 1292
398 nmdc:mga07m45_14060_c1 3300050496 Bacteria 4257
399 nmdc:mga05p37_1301533_c1 3300050507 Bacteria 741
400 nmdc:mga09592_110050_c2 3300050508 Bacteria 1920
401 nmdc:mga08y16_15155_c1 3300050511 Bacteria 8105
402 nmdc:mga0n895_101704_c1 3300050512 Bacteria 2884
403 nmdc:mga0n895_363608_c1 3300050512 Bacteria 1465
404 nmdc:mga0n895_47016_c1 3300050512 Bacteria 4218
405 nmdc:mga0rr50_269630_c1 3300050513 Bacteria 1418
406 nmdc:mga08x19_6732_c1 3300050514 Bacteria 6821
407 Ga0500616_0071319 3300053153 Bacteria 1770
408 Ga0501084_0211575 3300054114 Bacteria 1636
409 Ga0501082_0040806 3300060353 Bacteria 4002
410 2513893066 2513237141 Bacteria 8496279
411 Ga0373954_0024926
412 JGI25404J52841_10005355
413 Ga0065707_11013937
414 Ga0070658_10002337
415 Ga0070658_10071495
416 Ga0070658_10958612
417 Ga0070658_11321121
418 Ga0070683_100012404
419 Ga0070683_100934907
420 Ga0070670_100025876
421 Ga0070677_10164310
422 Ga0068868_100012995
423 Ga0068868_100174670
424 Ga0070660_100288459
425 Ga0070689_100404118
426 Ga0070689_100408508
427 Ga0070687_100536116
428 Ga0070687_101014338
429 Ga0070661_100009347
430 Ga0070661_100746378
431 Ga0070661_100753224
432 Ga0070692_10174119
433 Ga0070671_100464095
434 Ga0070671_101161462
435 Ga0070674_100060152
436 Ga0070673_100002778
437 Ga0070659_100097302
438 Ga0070667_100091853
439 Ga0070709_10027478
440 Ga0070709_10129641
441 Ga0070714_100121970
442 Ga0070714_100269307
443 Ga0070714_100527086
444 Ga0070713_100002300
445 Ga0070713_100013312
446 Ga0070713_102041846
447 Ga0070710_10008526
448 Ga0070701_10047296
449 Ga0070701_10655297
450 Ga0070711_100007756
451 Ga0070711_100069869
452 Ga0070711_100190158
453 Ga0070700_100769943
454 Ga0070694_100236596
455 Ga0070694_100804049
456 Ga0070663_100035277
457 Ga0070678_100072452
458 Ga0070678_100571647
459 Ga0070678_100613197
460 Ga0070662_100268576
461 Ga0070681_10344340
462 Ga0068867_100075820
463 Ga0070706_101513571
464 Ga0070699_100472294
465 Ga0070679_100032933
466 Ga0070679_100454016
467 Ga0070679_100501908
468 Ga0070684_100057481
469 Ga0070684_100203279
470 Ga0070684_100757393
471 Ga0070697_101895438
472 Ga0068853_100019012
473 Ga0068853_100450760
474 Ga0070686_100386823
475 Ga0070696_101120825
476 Ga0070665_100050454
477 Ga0070665_100600466
478 Ga0070665_101387282
479 Ga0070704_100040929
480 Ga0070704_100117621
481 Ga0070704_100966498
482 Ga0068855_100004013
483 Ga0068855_100059031
484 Ga0068855_100082459
485 Ga0068855_100226986
486 Ga0068855_100732076
487 Ga0068855_101655182
488 Ga0070664_100014403
489 Ga0070664_100722141
490 Ga0068854_100031326
491 Ga0068856_100167767
492 Ga0068856_101285942
493 Ga0068856_102442827
494 Ga0070702_100234338
495 Ga0070702_100393540
496 Ga0070702_100822981
497 Ga0068852_100003138
498 Ga0068852_100004579
499 Ga0068852_100006924
500 Ga0068852_100026588
501 Ga0068852_100557437
502 Ga0068859_100164925
503 Ga0068859_100550544
504 Ga0068864_100039878
505 Ga0068864_100189188
506 Ga0068864_100229842
507 Ga0068864_100476924
508 Ga0068861_101083792
509 Ga0068851_10031433
510 Ga0068870_10432046
511 Ga0068863_100185771
512 Ga0068863_100530667
513 Ga0068863_100564470
514 Ga0068863_101464821
515 Ga0068858_100155833
516 Ga0068858_101190668
517 Ga0068860_100283362
518 Ga0081455_10659961
519 Ga0081540_1003623
520 Ga0081539_10017091
521 Ga0075365_10004963
522 Ga0075363_100005910
523 Ga0075364_10143540
524 Ga0075362_10260999
525 Ga0075367_10263070
526 Ga0075366_10093823
527 Ga0097621_100013122
528 Ga0075370_10013636
529 Ga0068871_100034904
530 Ga0068871_100086442
531 Ga0068871_100468471
532 Ga0068871_100852838
533 Ga0068871_101886823
534 Ga0075428_100070228
535 Ga0075434_100060542
536 Ga0075434_100101649
537 Ga0075434_100375729
538 Ga0075434_101347446
539 Ga0075429_100479446
540 Ga0075429_101177709
541 Ga0068865_100376675
542 Ga0068865_101387444
543 Ga0075436_100007137
544 Ga0097620_100164927
545 Ga0097620_100550547
546 Ga0075435_100281666
547 Ga0075435_100314189
548 Ga0105250_10489743
549 Ga0105240_10023775
550 Ga0105240_10032510
551 Ga0105240_10076949
552 Ga0105240_10320294
553 Ga0105240_11313801
554 Ga0111539_10000770
555 Ga0111539_11768004
556 Ga0111539_12981515
557 Ga0105245_10194300
558 Ga0105245_10345643
559 Ga0105245_10880201
560 Ga0105247_10161108
561 Ga0105247_11080763
562 Ga0114129_10737924
563 Ga0105243_10071771
564 Ga0105243_10215044
565 Ga0105243_10520462
566 Ga0105243_11199796
567 Ga0105241_10006556
568 Ga0105241_11389943
569 Ga0105242_10182470
570 Ga0105248_10029877
571 Ga0105248_10495064
572 Ga0105248_11880552
573 Ga0105237_10202319
574 Ga0105238_10012982
575 Ga0105238_10425596
576 Ga0105238_10736470
577 Ga0105249_10200221
578 Ga0105239_10325376
579 Ga0105246_10430982
580 Ga0105246_11462166
581 Ga0157341_1032608
582 Ga0157370_10010253
583 Ga0157370_10237215
584 Ga0157370_11413501
585 Ga0157369_10060223
586 Ga0157369_10522099
587 Ga0157369_10663019
588 Ga0157374_10015981
589 Ga0157374_11396570
590 Ga0157378_10040195
591 Ga0157378_10052034
592 Ga0163162_10102348
593 Ga0163162_10244638
594 Ga0163162_10989669
595 Ga0157372_10034312
596 Ga0157372_11099240
597 Ga0157375_10006901
598 Ga0163163_10001936
599 Ga0163163_10086015
600 Ga0157380_10425404
601 Ga0157379_10071814
602 Ga0157376_10008792
603 Ga0157376_11438685
604 Ga0163161_10108697
605 Ga0213872_10107671
606 Ga0213876_10037660
607 Ga0213876_10139310
608 Ga0213875_10361414
609 Ga0213871_10117769
610 Ga0209677_103177
611 Ga0209233_1008639
612 Ga0207697_10258140
613 Ga0207656_10034744
614 Ga0207692_10044306
615 Ga0207692_10464120
616 Ga0207710_10035331
617 Ga0207688_10510208
618 Ga0207699_10118920
619 Ga0207699_10331934
620 Ga0207699_10501669
621 Ga0207699_11306751
622 Ga0207705_10020309
623 Ga0207705_10599616
624 Ga0207705_10719394
625 Ga0207654_10091675
626 Ga0207654_11016436
627 Ga0207707_10224351
628 Ga0207695_10020822
629 Ga0207695_10134379
630 Ga0207695_10163908
631 Ga0207695_10487837
632 Ga0207693_10216576
633 Ga0207663_10039821
634 Ga0207663_10061701
635 Ga0207662_10108996
636 Ga0207662_10486616
637 Ga0207662_10696107
638 Ga0207657_10241215
639 Ga0207649_10026288
640 Ga0207652_10041958
641 Ga0207652_10433122
642 Ga0207694_10074355
643 Ga0207694_10287606
644 Ga0207694_10370466
645 Ga0207650_10031931
646 Ga0207687_10445746
647 Ga0207687_11071396
648 Ga0207700_10018728
649 Ga0207700_10062815
650 Ga0207700_11209975
651 Ga0207664_10055718
652 Ga0207664_10383704
653 Ga0207664_10606051
654 Ga0207644_10148829
655 Ga0207686_10066326
656 Ga0207709_10084702
657 Ga0207709_10384862
658 Ga0207670_10323088
659 Ga0207704_11276353
660 Ga0207665_10139384
661 Ga0207691_10019762
662 Ga0207711_10303187
663 Ga0207711_10827200
664 Ga0207679_10313681
665 Ga0207679_11216200
666 Ga0207667_10005711
667 Ga0207667_10059504
668 Ga0207667_10075954
669 Ga0207667_10095244
670 Ga0207667_11345044
671 Ga0207712_10796253
672 Ga0207668_10286253
673 Ga0207640_10049748
674 Ga0207658_10093866
675 Ga0207677_10002792
676 Ga0207677_10117738
677 Ga0207703_10124632
678 Ga0207639_10129030
679 Ga0207678_10012944
680 Ga0207702_10045632
681 Ga0207702_10557024
682 Ga0207641_10165220
683 Ga0207641_10490825
684 Ga0207648_10099222
685 Ga0207676_10171212
686 Ga0207676_10416927
687 Ga0207676_11475230
688 Ga0207675_100159228
689 Ga0207675_100696045
690 Ga0207683_10011755
691 Ga0207683_10406634
692 Ga0207698_10014541
693 Ga0207698_10016466
694 Ga0207698_10098540
695 Ga0207698_10258385
696 Ga0207698_10477021
697 Ga0207698_12202902
698 Ga0207428_10004344
699 Ga0207428_10732518
700 Ga0268266_10003891
701 Ga0268266_10069127
702 Ga0268264_10500386
703 Ga0265338_10541939
704 Ga0265339_10098897
705 Ga0307408_100646690
706 Ga0265314_10046020
707 Ga0307405_10410006
708 Ga0307413_11521589
709 Ga0307412_10301310
710 Ga0307416_100155436
711 Ga0307416_100159610
712 Ga0307416_100836922
713 Ga0307415_101125649
714 Ga0373943_0497449
715 Ga0373946_0488979
716 Ga0373962_0407583
717 Ga0373933_0606821
718 Ga0373937_0068001
719 Ga0373925_0019448
720 Ga0395899_0039896
721 Ga0395900_0162927
722 Ga0395905_0196363
723 Ga0436364_0708967
724 Ga0395901_0137159
725 Ga0436365_0847353
726 Ga0436365_1550977
727 Ga0436360_0645289
728 Ga0436361_0658449
729 Ga0436361_0937161
730 Ga0436363_1432495
731 Ga0451793_1593678
732 Ga0451807_2486081
733 Ga0451837_1189306
734 Ga0439432_142926
735 Ga0451577_0411895
736 Ga0451577_0444869
737 Ga0466957_0591134
738 Ga0451576_0812066
739 Ga0451576_0981488
740 Ga0495580_0002694
741 Ga0495594_0514892
742 Ga0495630_0242790
743 Ga0495644_0035529
744 Ga0495598_0256581
745 Ga0495621_0058378
746 Ga0495621_0426793
747 Ga0495645_0221063
748 Ga0495667_0060020
749 Ga0495635_0348936
750 Ga0495658_0896708
751 Ga0495680_0029255
752 Ga0496100_0182129
753 Ga0496101_0246658
754 Ga0496101_0265954
755 Ga0496102_0106720
756 Ga0496102_0652353
757 Ga0496104_0006867
758 Ga0496104_0095878
759 Ga0496104_0162464
760 Ga0496105_0266547
761 Ga0496106_0000036
762 Ga0496106_0072421
763 Ga0496106_0072882
764 Ga0496106_0299586
765 Ga0496108_0005236
766 Ga0496109_0266022
767 Ga0496109_0439809
768 Ga0496110_0000804
769 Ga0496110_0013589
770 Ga0496110_0659395
771 Ga0496110_1190300
772 Ga0496111_0167634
773 Ga0496112_0000992
774 Ga0496113_0260128
775 Ga0496113_1564240
776 Ga0496115_0024858
777 Ga0496115_0033420
778 Ga0496115_0089637
779 Ga0496118_0084156
780 Ga0496121_0037323
781 Ga0496121_0097605
782 Ga0496121_0213156
783 Ga0501032_0139667
784 Ga0501042_1057144
785 Ga0501046_0446668
786 Ga0501047_0025440
787 Ga0501067_0086319
788 Ga0501068_0084435
789 Ga0501069_0001356
790 Ga0501070_0003137
791 Ga0501070_0081472
792 Ga0501072_0098090
793 Ga0501073_0004830
794 Ga0501073_0548217
795 Ga0501074_0013164
796 Ga0501079_0075339
797 Ga0501080_0005873
798 Ga0501080_0170282
799 Ga0501083_0253427
800 Ga0501035_0299118
801 Ga0501044_0382983
802 nmdc:mga03n38_6776_c1
803 nmdc:mga00v17_180431_c1
804 nmdc:mga0yw44_111010_c1
805 nmdc:mga0yw44_47264_c1
806 nmdc:mga0k408_41890_c1
807 nmdc:mga06z11_158443_c1
808 nmdc:mga07m45_14060_c1
809 nmdc:mga05p37_1301533_c1
810 nmdc:mga09592_110050_c2
811 nmdc:mga08y16_15155_c1
812 nmdc:mga0n895_101704_c1
813 nmdc:mga0n895_363608_c1
814 nmdc:mga0n895_47016_c1
815 nmdc:mga0rr50_269630_c1
816 nmdc:mga08x19_6732_c1
817 Ga0500616_0071319
818 Ga0501084_0211575
819 Ga0501082_0040806
820 2513893066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

31

177

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.9061 2 141
5ahw-assembly2.cif.gz_D crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8939 2 142
5ahw-assembly2.cif.gz_D crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8607 2 142
4wny-assembly1.cif.gz_A-2 crystal structure of a protein from the universal stress protein family from burkholderia pseudomallei 0.8605 2 141
5ahw-assembly1.cif.gz_B crystal structure of universal stress protein msmeg_3811 in complex with camp 0.8503 2 142
ID Description Score Start End Superfamily
4wnyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9061 2 141 3.40.50.620
af_Q57951_25_170_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8633 1 140 3.40.50.620
4wnyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8605 2 141 3.40.50.620
3qtbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8518 3 142 3.40.50.620
5ahwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8503 2 142 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7V5N0L7-F1-model_v4 Universal stress protein 0.933 1 109
AF-A0A822V3S8-F1-model_v4 Universal stress protein 0.9193 1 141 GO:0005737
AF-A0A7W2BG25-F1-model_v4 deleted 0.9185 1 142
AF-A0A2M9PDC8-F1-model_v4 Universal stress protein 0.9134 1 142 GO:0005737
AF-A0A7W2BG25-F1-model_v4 deleted 0.9123 1 142

Map