F438360

General Info

Members Datasets Scaffolds Average Seq Length
414 234 828 109

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10170077|Ga0307413_101700771
Length 117
Sequence MSPRRVPEITHLQYLVLAMLREGPRLGRQVRQRLAQHGVRRSAPAFYQMMARLEDARLASGDYDQKIIDGQIIKERRYTLTPEGDAAWKKTRDFYLETIPDLADAVAGQRRKGPARA

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
208 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
214 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.31
Nodule 0
Rhizoplane 2.9
Rhizosphere 91.55
Stem 0
Stem Tuber 0
Unclassified 28.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10170077 3300031824 Bacteria 1541
2 Ga0065712_10102584 3300005290 Unclassified 2005
3 Ga0065712_10811672 3300005290 Unclassified 509
4 Ga0065715_10037385 3300005293 Bacteria 1191
5 Ga0065715_10143828 3300005293 Bacteria 1815
6 Ga0065715_10335270 3300005293 Bacteria 976
7 Ga0065707_10096306 3300005295 Bacteria 3282
8 Ga0065707_10857664 3300005295 Bacteria 580
9 Ga0070676_10018303 3300005328 Bacteria 3880
10 Ga0070676_10087557 3300005328 Unclassified 1901
11 Ga0070683_100404714 3300005329 Bacteria 1302
12 Ga0070690_100071437 3300005330 Bacteria 2255
13 Ga0070690_100366610 3300005330 Bacteria 1049
14 Ga0070670_100055719 3300005331 Bacteria 3393
15 Ga0068869_100224298 3300005334 Bacteria 1491
16 Ga0070666_11368450 3300005335 Unclassified 529
17 Ga0070680_100200716 3300005336 Bacteria 1682
18 Ga0070680_100662727 3300005336 Bacteria 897
19 Ga0070682_100579805 3300005337 Bacteria 882
20 Ga0070682_101083326 3300005337 Unclassified 670
21 Ga0068868_100154647 3300005338 Bacteria 1891
22 Ga0068868_100181649 3300005338 Bacteria 1746
23 Ga0070660_101503405 3300005339 Bacteria 573
24 Ga0070689_100057276 3300005340 Bacteria 3024
25 Ga0070689_100208974 3300005340 Bacteria 1597
26 Ga0070691_10026913 3300005341 Bacteria 2682
27 Ga0070691_10491508 3300005341 Bacteria 708
28 Ga0070687_100085724 3300005343 Bacteria 1730
29 Ga0070687_100130386 3300005343 Bacteria 1451
30 Ga0070687_100987872 3300005343 Unclassified 609
31 Ga0070687_101425331 3300005343 Bacteria 518
32 Ga0070661_100132641 3300005344 Bacteria 1872
33 Ga0070661_100212269 3300005344 Bacteria 1482
34 Ga0070692_10267355 3300005345 Bacteria 1031
35 Ga0070668_100164696 3300005347 Bacteria 1801
36 Ga0070669_100124816 3300005353 Bacteria 1968
37 Ga0070669_100127819 3300005353 Bacteria 1946
38 Ga0070669_101541919 3300005353 Bacteria 578
39 Ga0070669_101548425 3300005353 Unclassified 577
40 Ga0070675_100000980 3300005354 Bacteria 20412
41 Ga0070675_100273598 3300005354 Bacteria 1482
42 Ga0070675_100386267 3300005354 Bacteria 1247
43 Ga0070675_100717544 3300005354 Bacteria 911
44 Ga0070675_100936782 3300005354 Bacteria 794
45 Ga0070671_100030724 3300005355 Bacteria 4433
46 Ga0070671_101397320 3300005355 Bacteria 618
47 Ga0070674_100018130 3300005356 Bacteria 4444
48 Ga0070674_100363867 3300005356 Bacteria 1172
49 Ga0070673_100009823 3300005364 Bacteria 6445
50 Ga0070673_101779889 3300005364 Bacteria 583
51 Ga0070688_100571864 3300005365 Unclassified 862
52 Ga0070659_100024303 3300005366 Bacteria 4644
53 Ga0070659_100358885 3300005366 Bacteria 1224
54 Ga0070659_101010318 3300005366 Bacteria 730
55 Ga0070659_101097670 3300005366 Bacteria 701
56 Ga0070667_100205986 3300005367 Bacteria 1747
57 Ga0070667_100330370 3300005367 Unclassified 1377
58 Ga0070667_100958797 3300005367 Bacteria 797
59 Ga0070701_10215893 3300005438 Unclassified 1141
60 Ga0070711_101266421 3300005439 Bacteria 639
61 Ga0070705_100606522 3300005440 Bacteria 847
62 Ga0070705_101609235 3300005440 Unclassified 547
63 Ga0070700_100027276 3300005441 Bacteria 3385
64 Ga0070700_100116575 3300005441 Bacteria 1783
65 Ga0070700_100556870 3300005441 Bacteria 892
66 Ga0070700_101470185 3300005441 Bacteria 578
67 Ga0070694_100138115 3300005444 Bacteria 1768
68 Ga0070694_100325039 3300005444 Unclassified 1185
69 Ga0070694_101776389 3300005444 Bacteria 525
70 Ga0070663_100302276 3300005455 Bacteria 1281
71 Ga0070678_100395353 3300005456 Bacteria 1199
72 Ga0070678_100419039 3300005456 Bacteria 1167
73 Ga0070662_101520672 3300005457 Bacteria 577
74 Ga0070681_11106289 3300005458 Bacteria 713
75 Ga0068867_100081918 3300005459 Bacteria 2433
76 Ga0068867_100110714 3300005459 Bacteria 2110
77 Ga0070707_100940424 3300005468 Bacteria 829
78 Ga0070679_100221224 3300005530 Bacteria 1854
79 Ga0070679_100410429 3300005530 Bacteria 1300
80 Ga0070684_100145227 3300005535 Bacteria 2147
81 Ga0070684_101793598 3300005535 Bacteria 579
82 Ga0068853_100400256 3300005539 Bacteria 1285
83 Ga0070672_100040315 3300005543 Bacteria 3582
84 Ga0070672_100056066 3300005543 Bacteria 3089
85 Ga0070686_100154823 3300005544 Bacteria 1608
86 Ga0070686_101950671 3300005544 Bacteria 502
87 Ga0070695_100397139 3300005545 Unclassified 1044
88 Ga0070696_100057126 3300005546 Bacteria 2723
89 Ga0070693_100026636 3300005547 Bacteria 3123
90 Ga0070693_100033150 3300005547 Bacteria 2848
91 Ga0070693_100139961 3300005547 Bacteria 1522
92 Ga0070665_100656312 3300005548 Unclassified 1062
93 Ga0070704_100048257 3300005549 Bacteria 2980
94 Ga0070704_100077825 3300005549 Bacteria 2431
95 Ga0068855_100860155 3300005563 Bacteria 960
96 Ga0068855_101347645 3300005563 Bacteria 737
97 Ga0068855_101907986 3300005563 Bacteria 602
98 Ga0070664_101751762 3300005564 Unclassified 589
99 Ga0070664_102311356 3300005564 Bacteria 510
100 Ga0068854_100068466 3300005578 Unclassified 2588
101 Ga0068854_100080372 3300005578 Bacteria 2405
102 Ga0068856_100587056 3300005614 Bacteria 1135
103 Ga0068856_100738323 3300005614 Bacteria 1004
104 Ga0070702_100058129 3300005615 Bacteria 2239
105 Ga0070702_100152163 3300005615 Unclassified 1486
106 Ga0068852_100145438 3300005616 Bacteria 2198
107 Ga0068852_100341929 3300005616 Bacteria 1459
108 Ga0068859_100478687 3300005617 Bacteria 1340
109 Ga0068859_100648050 3300005617 Bacteria 1148
110 Ga0068859_102535148 3300005617 Bacteria 564
111 Ga0068864_100042516 3300005618 Bacteria 3889
112 Ga0068866_10063983 3300005718 Unclassified 1919
113 Ga0068866_10175406 3300005718 Unclassified 1262
114 Ga0068861_100106647 3300005719 Bacteria 2238
115 Ga0068861_100205810 3300005719 Bacteria 1655
116 Ga0068861_100964663 3300005719 Bacteria 812
117 Ga0068851_10227091 3300005834 Unclassified 1051
118 Ga0068863_100294417 3300005841 Bacteria 1573
119 Ga0068863_101652075 3300005841 Unclassified 650
120 Ga0068863_101681188 3300005841 Bacteria 644
121 Ga0068858_100158256 3300005842 Bacteria 2132
122 Ga0068858_100987837 3300005842 Unclassified 825
123 Ga0068860_100093778 3300005843 Bacteria 2861
124 Ga0068860_100449511 3300005843 Unclassified 1281
125 Ga0068860_102094047 3300005843 Bacteria 587
126 Ga0068862_100095678 3300005844 Bacteria 2591
127 Ga0068862_100188520 3300005844 Bacteria 1854
128 Ga0068862_100244423 3300005844 Unclassified 1633
129 Ga0068862_100419712 3300005844 Bacteria 1255
130 Ga0081455_10137587 3300005937 Bacteria 1901
131 Ga0075365_10017677 3300006038 Bacteria 4369
132 Ga0075365_11205980 3300006038 Unclassified 532
133 Ga0075368_10110409 3300006042 Bacteria 1133
134 Ga0075364_10062856 3300006051 Bacteria 2437
135 Ga0075364_10073391 3300006051 Bacteria 2255
136 Ga0070712_100412051 3300006175 Unclassified 1118
137 Ga0075367_10316781 3300006178 Bacteria 983
138 Ga0075369_10188491 3300006186 Bacteria 950
139 Ga0075366_10065200 3300006195 Bacteria 2166
140 Ga0075366_10576080 3300006195 Bacteria 697
141 Ga0075370_10043554 3300006353 Unclassified 2537
142 Ga0068871_100340148 3300006358 Bacteria 1325
143 Ga0075428_100143366 3300006844 Bacteria 2597
144 Ga0075428_100148764 3300006844 Unclassified 2545
145 Ga0075428_101176581 3300006844 Bacteria 809
146 Ga0075428_101757488 3300006844 Unclassified 646
147 Ga0075428_101990371 3300006844 Unclassified 602
148 Ga0075430_100017919 3300006846 Bacteria 6027
149 Ga0075430_100055063 3300006846 Bacteria 3345
150 Ga0075430_100076217 3300006846 Bacteria 2811
151 Ga0075431_100117509 3300006847 Bacteria 2744
152 Ga0075431_100136548 3300006847 Unclassified 2528
153 Ga0075433_10170649 3300006852 Bacteria 1936
154 Ga0075433_11700740 3300006852 Unclassified 543
155 Ga0075434_100000168 3300006871 Bacteria 41871
156 Ga0075434_100100452 3300006871 Bacteria 2899
157 Ga0075434_100187647 3300006871 Bacteria 2088
158 Ga0075434_100572006 3300006871 Bacteria 1149
159 Ga0075429_100112857 3300006880 Bacteria 2375
160 Ga0075429_100795332 3300006880 Bacteria 828
161 Ga0075429_100949463 3300006880 Unclassified 752
162 Ga0068865_100582025 3300006881 Unclassified 944
163 Ga0068865_100846526 3300006881 Unclassified 792
164 Ga0075436_100000615 3300006914 Bacteria 23315
165 Ga0075436_100669121 3300006914 Bacteria 768
166 Ga0097620_100478690 3300006931 Bacteria 1340
167 Ga0097620_100648111 3300006931 Bacteria 1148
168 Ga0097620_102534787 3300006931 Bacteria 564
169 Ga0075435_100000004 3300007076 Bacteria 122128
170 Ga0075435_100009945 3300007076 Bacteria 6927
171 Ga0075435_100023978 3300007076 Bacteria 4728
172 Ga0099794_10127158 3300007265 Bacteria 1285
173 Ga0099795_10204588 3300007788 Bacteria 834
174 Ga0105240_10025623 3300009093 Bacteria 7745
175 Ga0105240_10928258 3300009093 Unclassified 935
176 Ga0105240_12149605 3300009093 Bacteria 579
177 Ga0111539_10065801 3300009094 Bacteria 4282
178 Ga0111539_10140930 3300009094 Bacteria 2822
179 Ga0111539_10496485 3300009094 Unclassified 1421
180 Ga0111539_10965692 3300009094 Bacteria 991
181 Ga0111539_11094321 3300009094 Unclassified 926
182 Ga0111539_11212719 3300009094 Bacteria 876
183 Ga0111539_12807111 3300009094 Unclassified 564
184 Ga0105245_10917453 3300009098 Unclassified 918
185 Ga0105245_12284656 3300009098 Unclassified 595
186 Ga0105245_12646769 3300009098 Bacteria 555
187 Ga0105247_10896669 3300009101 Unclassified 684
188 Ga0114129_10019797 3300009147 Bacteria 9580
189 Ga0114129_10043804 3300009147 Bacteria 6297
190 Ga0114129_10489481 3300009147 Bacteria 1608
191 Ga0105243_10021101 3300009148 Bacteria 4943
192 Ga0105243_10463449 3300009148 Bacteria 1192
193 Ga0105241_10079363 3300009174 Bacteria 2566
194 Ga0105242_10026725 3300009176 Bacteria 4576
195 Ga0105242_10436425 3300009176 Bacteria 1231
196 Ga0105248_10421307 3300009177 Bacteria 1504
197 Ga0105249_10027172 3300009553 Bacteria 5162
198 Ga0105249_10070784 3300009553 Bacteria 3220
199 Ga0105249_10146187 3300009553 Bacteria 2272
200 Ga0105249_10658975 3300009553 Bacteria 1105
201 Ga0105239_10121950 3300010375 Bacteria 2896
202 Ga0105239_10332212 3300010375 Bacteria 1715
203 Ga0157378_10412310 3300013297 Unclassified 1333
204 Ga0157378_10447809 3300013297 Bacteria 1281
205 Ga0163162_11195543 3300013306 Unclassified 863
206 Ga0157372_10321253 3300013307 Bacteria 1802
207 Ga0157372_11686241 3300013307 Bacteria 729
208 Ga0157375_11896456 3300013308 Bacteria 707
209 Ga0163163_10034370 3300014325 Bacteria 4908
210 Ga0157380_11434611 3300014326 Bacteria 742
211 Ga0157380_11502586 3300014326 Unclassified 727
212 Ga0157377_11155239 3300014745 Archaea 597
213 Ga0157377_11251864 3300014745 Unclassified 577
214 Ga0157379_10034100 3300014968 Bacteria 4536
215 Ga0157376_11212921 3300014969 Bacteria 783
216 Ga0206356_10963908 3300020070 Unclassified 1103
217 Ga0206356_11017606 3300020070 Bacteria 1019
218 Ga0206353_11685023 3300020082 Unclassified 1424
219 Ga0206353_11692009 3300020082 Bacteria 712
220 Ga0207697_10017092 3300025315 Bacteria 2981
221 Ga0207642_10172621 3300025899 Unclassified 1171
222 Ga0207642_10937517 3300025899 Bacteria 556
223 Ga0207688_10025533 3300025901 Bacteria 3245
224 Ga0207688_10098304 3300025901 Bacteria 1687
225 Ga0207680_10115412 3300025903 Bacteria 1749
226 Ga0207647_10641704 3300025904 Unclassified 583
227 Ga0207645_10007786 3300025907 Bacteria 7539
228 Ga0207645_10029781 3300025907 Bacteria 3518
229 Ga0207654_10058103 3300025911 Unclassified 2251
230 Ga0207695_10609282 3300025913 Bacteria 973
231 Ga0207660_10148911 3300025917 Bacteria 1796
232 Ga0207660_11228761 3300025917 Bacteria 609
233 Ga0207662_10034814 3300025918 Bacteria 2939
234 Ga0207662_11092309 3300025918 Bacteria 567
235 Ga0207657_11476667 3300025919 Bacteria 509
236 Ga0207649_10243363 3300025920 Bacteria 1292
237 Ga0207649_10399890 3300025920 Bacteria 1028
238 Ga0207652_10157755 3300025921 Bacteria 2033
239 Ga0207681_10147084 3300025923 Bacteria 1762
240 Ga0207681_10801740 3300025923 Bacteria 787
241 Ga0207650_10085350 3300025925 Bacteria 2402
242 Ga0207659_10008192 3300025926 Bacteria 6476
243 Ga0207659_10115115 3300025926 Bacteria 2051
244 Ga0207659_10872363 3300025926 Bacteria 774
245 Ga0207687_10246714 3300025927 Unclassified 1418
246 Ga0207687_11286141 3300025927 Bacteria 629
247 Ga0207644_10072543 3300025931 Bacteria 2521
248 Ga0207644_10186144 3300025931 Bacteria 1630
249 Ga0207690_10487547 3300025932 Bacteria 996
250 Ga0207690_10893084 3300025932 Bacteria 737
251 Ga0207686_10016407 3300025934 Bacteria 4158
252 Ga0207686_10250028 3300025934 Bacteria 1295
253 Ga0207709_10183108 3300025935 Unclassified 1481
254 Ga0207670_10207756 3300025936 Unclassified 1491
255 Ga0207670_10254606 3300025936 Unclassified 1358
256 Ga0207669_10141924 3300025937 Unclassified 1669
257 Ga0207704_10557087 3300025938 Bacteria 932
258 Ga0207691_10005509 3300025940 Bacteria 12231
259 Ga0207691_10007081 3300025940 Bacteria 10824
260 Ga0207711_10719259 3300025941 Bacteria 931
261 Ga0207689_10025118 3300025942 Bacteria 4994
262 Ga0207689_10147624 3300025942 Unclassified 1937
263 Ga0207661_10223419 3300025944 Bacteria 1665
264 Ga0207679_11171984 3300025945 Unclassified 705
265 Ga0207667_10694947 3300025949 Bacteria 1020
266 Ga0207667_11305647 3300025949 Unclassified 702
267 Ga0207667_11674213 3300025949 Bacteria 603
268 Ga0207651_10093760 3300025960 Bacteria 2205
269 Ga0207712_10249588 3300025961 Unclassified 1434
270 Ga0207668_11033631 3300025972 Bacteria 735
271 Ga0207640_10070988 3300025981 Bacteria 2344
272 Ga0207658_10173268 3300025986 Bacteria 1780
273 Ga0207658_10747794 3300025986 Unclassified 885
274 Ga0207677_10560441 3300026023 Bacteria 997
275 Ga0207703_10287116 3300026035 Bacteria 1496
276 Ga0207703_11542836 3300026035 Unclassified 639
277 Ga0207678_10333643 3300026067 Bacteria 1306
278 Ga0207678_10469284 3300026067 Bacteria 1095
279 Ga0207708_10015813 3300026075 Bacteria 5663
280 Ga0207708_10144803 3300026075 Bacteria 1867
281 Ga0207708_10511560 3300026075 Bacteria 1008
282 Ga0207702_10469778 3300026078 Bacteria 1223
283 Ga0207641_10154837 3300026088 Unclassified 2079
284 Ga0207641_11207356 3300026088 Unclassified 756
285 Ga0207648_10004388 3300026089 Bacteria 14504
286 Ga0207648_10006114 3300026089 Bacteria 12004
287 Ga0207676_10574580 3300026095 Bacteria 1080
288 Ga0207674_11780631 3300026116 Unclassified 583
289 Ga0207675_100103580 3300026118 Bacteria 2682
290 Ga0207675_100258029 3300026118 Unclassified 1688
291 Ga0207675_101552136 3300026118 Bacteria 683
292 Ga0207683_10093733 3300026121 Bacteria 2676
293 Ga0207698_10083630 3300026142 Bacteria 2584
294 Ga0207698_10098579 3300026142 Bacteria 2415
295 Ga0209813_10024855 3300027866 Unclassified 1717
296 Ga0209813_10079688 3300027866 Bacteria 1080
297 Ga0268266_10653977 3300028379 Bacteria 1012
298 Ga0268265_10102350 3300028380 Bacteria 2317
299 Ga0268265_10207077 3300028380 Unclassified 1706
300 Ga0268265_10655348 3300028380 Unclassified 1010
301 Ga0268264_10155386 3300028381 Bacteria 2055
302 Ga0268264_10464486 3300028381 Bacteria 1228
303 Ga0268264_11916399 3300028381 Unclassified 602
304 Ga0307408_100126657 3300031548 Bacteria 1987
305 Ga0307410_10042838 3300031852 Unclassified 2995
306 Ga0307406_10189895 3300031901 Bacteria 1503
307 Ga0307407_10046449 3300031903 Unclassified 2459
308 Ga0307412_10952792 3300031911 Bacteria 755
309 Ga0307409_100041929 3300031995 Unclassified 3423
310 Ga0307409_100647984 3300031995 Bacteria 1050
311 Ga0307416_100087435 3300032002 Bacteria 2661
312 Ga0307416_100144800 3300032002 Bacteria 2167
313 Ga0307416_100328237 3300032002 Bacteria 1536
314 Ga0307416_100699088 3300032002 Bacteria 1103
315 Ga0307416_102242034 3300032002 Unclassified 647
316 Ga0307414_10164868 3300032004 Unclassified 1765
317 Ga0307415_100239188 3300032126 Unclassified 1467
318 Ga0307415_100616543 3300032126 Unclassified 968
319 Ga0373930_0142301 3300034816 Unclassified 597
320 Ga0373940_0270052 3300035088 Bacteria 578
321 Ga0373951_0201956 3300035091 Unclassified 579
322 Ga0373939_0034511 3300035114 Unclassified 1485
323 Ga0373942_0176718 3300035207 Bacteria 698
324 Ga0373961_0116186 3300035241 Bacteria 882
325 Ga0373962_0089729 3300035242 Unclassified 945
326 Ga0373962_0246934 3300035242 Unclassified 619
327 Ga0373931_0735372 3300035691 Unclassified 654
328 Ga0395905_0320388 3300037471 Bacteria 1440
329 Ga0436364_1199661 3300037853 Unclassified 627
330 Ga0439439_0121784 3300041406 Bacteria 728
331 Ga0439433_0019610 3300041999 Bacteria 1507
332 Ga0439446_0020293 3300042156 Bacteria 1871
333 Ga0439464_0030020 3300042439 Bacteria 1521
334 Ga0451577_0434612 3300042876 Unclassified 1192
335 Ga0466963_0884297 3300044694 Unclassified 630
336 Ga0451576_1098816 3300045051 Unclassified 832
337 Ga0495580_0630091 3300046472 Unclassified 707
338 Ga0495659_0320198 3300046664 Unclassified 658
339 Ga0496104_1085144 3300048907 Bacteria 704
340 Ga0496106_0122468 3300048909 Bacteria 2034
341 Ga0496106_0256696 3300048909 Bacteria 1398
342 Ga0496106_1288197 3300048909 Unclassified 568
343 Ga0496108_1191415 3300048911 Bacteria 644
344 Ga0496109_0159292 3300048912 Bacteria 2115
345 Ga0496109_0245671 3300048912 Unclassified 1685
346 Ga0496109_1782625 3300048912 Unclassified 549
347 Ga0496111_1005763 3300048914 Unclassified 597
348 Ga0496112_0428760 3300048915 Bacteria 1261
349 Ga0496112_0897751 3300048915 Bacteria 808
350 Ga0496113_0699477 3300048916 Unclassified 809
351 Ga0501034_0005753 3300049571 Bacteria 13484
352 Ga0501037_0695715 3300049573 Unclassified 677
353 Ga0501038_0877833 3300049574 Unclassified 663
354 Ga0501039_1400802 3300049575 Unclassified 538
355 Ga0501042_0576543 3300049578 Bacteria 818
356 Ga0501043_0242215 3300049579 Bacteria 1391
357 Ga0501046_0203648 3300049580 Bacteria 1472
358 Ga0501047_0039914 3300049581 Bacteria 4540
359 Ga0501047_0068687 3300049581 Bacteria 3413
360 Ga0501047_0453210 3300049581 Bacteria 1112
361 Ga0501069_0131305 3300049585 Bacteria 1434
362 Ga0501071_0101353 3300049587 Bacteria 2123
363 Ga0501072_0078071 3300049588 Bacteria 2622
364 Ga0501072_0450022 3300049588 Unclassified 1020
365 Ga0501076_0291903 3300049592 Bacteria 1336
366 Ga0501076_0658902 3300049592 Bacteria 864
367 Ga0501233_106192 3300049668 Bacteria 747
368 Ga0501239_005139 3300049672 Bacteria 1313
369 Ga0501225_0267420 3300049705 Bacteria 568
370 Ga0501080_0992821 3300049742 Bacteria 728
371 Ga0501081_0201367 3300049743 Bacteria 1444
372 Ga0501083_0466570 3300049744 Unclassified 822
373 Ga0501264_028213 3300049761 Unclassified 633
374 Ga0501212_114933 3300049851 Bacteria 517
375 nmdc:mga00v17_110491_c1 3300050491 Bacteria 1743
376 nmdc:mga00v17_146125_c1 3300050491 Bacteria 1518
377 nmdc:mga0yw44_22131_c1 3300050492 Bacteria 3558
378 nmdc:mga0k408_11712_c1 3300050493 Bacteria 4782
379 nmdc:mga06z11_218140_c1 3300050494 Unclassified 1114
380 nmdc:mga06z11_604980_c1 3300050494 Bacteria 667
381 nmdc:mga04h51_35093_c1 3300050495 Unclassified 1606
382 nmdc:mga07m45_146675_c1 3300050496 Unclassified 1368
383 nmdc:mga05p37_136834_c1 3300050507 Unclassified 3003
384 nmdc:mga05p37_38192_c1 3300050507 Bacteria 5888
385 nmdc:mga09592_103332_c1 3300050508 Bacteria 2441
386 nmdc:mga09592_521159_c1 3300050508 Unclassified 1022
387 nmdc:mga09592_769582_c1 3300050508 Bacteria 816
388 nmdc:mga0qj67_539156_c1 3300050509 Unclassified 936
389 nmdc:mga0qj67_59075_c1 3300050509 Bacteria 3041
390 nmdc:mga0qj67_98076_c1 3300050509 Unclassified 2361
391 nmdc:mga06r32_202255_c1 3300050510 Unclassified 1974
392 nmdc:mga06r32_363127_c1 3300050510 Bacteria 1432
393 nmdc:mga06r32_724021_c1 3300050510 Unclassified 959
394 nmdc:mga06r32_863060_c1 3300050510 Unclassified 863
395 nmdc:mga08y16_213471_c1 3300050511 Bacteria 1998
396 nmdc:mga08y16_306399_c1 3300050511 Unclassified 1636
397 nmdc:mga08y16_440204_c1 3300050511 Bacteria 1330
398 nmdc:mga08y16_51147_c1 3300050511 Bacteria 4322
399 nmdc:mga08y16_52056_c1 3300050511 Bacteria 4284
400 nmdc:mga0n895_239173_c1 3300050512 Bacteria 1842
401 nmdc:mga0n895_6_c1 3300050512 Bacteria 122829
402 nmdc:mga0n895_781945_c1 3300050512 Bacteria 946
403 nmdc:mga0rr50_119716_c1 3300050513 Bacteria 2094
404 nmdc:mga0rr50_25402_c1 3300050513 Bacteria 4118
405 nmdc:mga0rr50_7_c1 3300050513 Bacteria 297175
406 nmdc:mga08x19_67_c1 3300050514 Bacteria 80016
407 nmdc:mga0a205_1403392_c1 3300050515 Unclassified 546
408 nmdc:mga0a205_77482_c1 3300050515 Bacteria 3212
409 nmdc:mga0sz30_110745_c1 3300050516 Unclassified 1203
410 Ga0500628_065411 3300053129 Bacteria 899
411 Ga0501084_0624493 3300054114 Unclassified 910
412 Ga0501084_1303985 3300054114 Bacteria 609
413 Ga0590071_111723 3300059421 Unclassified 694
414 Ga0501082_1029638 3300060353 Unclassified 720
415 Ga0307413_10170077
416 Ga0065712_10102584
417 Ga0065712_10811672
418 Ga0065715_10037385
419 Ga0065715_10143828
420 Ga0065715_10335270
421 Ga0065707_10096306
422 Ga0065707_10857664
423 Ga0070676_10018303
424 Ga0070676_10087557
425 Ga0070683_100404714
426 Ga0070690_100071437
427 Ga0070690_100366610
428 Ga0070670_100055719
429 Ga0068869_100224298
430 Ga0070666_11368450
431 Ga0070680_100200716
432 Ga0070680_100662727
433 Ga0070682_100579805
434 Ga0070682_101083326
435 Ga0068868_100154647
436 Ga0068868_100181649
437 Ga0070660_101503405
438 Ga0070689_100057276
439 Ga0070689_100208974
440 Ga0070691_10026913
441 Ga0070691_10491508
442 Ga0070687_100085724
443 Ga0070687_100130386
444 Ga0070687_100987872
445 Ga0070687_101425331
446 Ga0070661_100132641
447 Ga0070661_100212269
448 Ga0070692_10267355
449 Ga0070668_100164696
450 Ga0070669_100124816
451 Ga0070669_100127819
452 Ga0070669_101541919
453 Ga0070669_101548425
454 Ga0070675_100000980
455 Ga0070675_100273598
456 Ga0070675_100386267
457 Ga0070675_100717544
458 Ga0070675_100936782
459 Ga0070671_100030724
460 Ga0070671_101397320
461 Ga0070674_100018130
462 Ga0070674_100363867
463 Ga0070673_100009823
464 Ga0070673_101779889
465 Ga0070688_100571864
466 Ga0070659_100024303
467 Ga0070659_100358885
468 Ga0070659_101010318
469 Ga0070659_101097670
470 Ga0070667_100205986
471 Ga0070667_100330370
472 Ga0070667_100958797
473 Ga0070701_10215893
474 Ga0070711_101266421
475 Ga0070705_100606522
476 Ga0070705_101609235
477 Ga0070700_100027276
478 Ga0070700_100116575
479 Ga0070700_100556870
480 Ga0070700_101470185
481 Ga0070694_100138115
482 Ga0070694_100325039
483 Ga0070694_101776389
484 Ga0070663_100302276
485 Ga0070678_100395353
486 Ga0070678_100419039
487 Ga0070662_101520672
488 Ga0070681_11106289
489 Ga0068867_100081918
490 Ga0068867_100110714
491 Ga0070707_100940424
492 Ga0070679_100221224
493 Ga0070679_100410429
494 Ga0070684_100145227
495 Ga0070684_101793598
496 Ga0068853_100400256
497 Ga0070672_100040315
498 Ga0070672_100056066
499 Ga0070686_100154823
500 Ga0070686_101950671
501 Ga0070695_100397139
502 Ga0070696_100057126
503 Ga0070693_100026636
504 Ga0070693_100033150
505 Ga0070693_100139961
506 Ga0070665_100656312
507 Ga0070704_100048257
508 Ga0070704_100077825
509 Ga0068855_100860155
510 Ga0068855_101347645
511 Ga0068855_101907986
512 Ga0070664_101751762
513 Ga0070664_102311356
514 Ga0068854_100068466
515 Ga0068854_100080372
516 Ga0068856_100587056
517 Ga0068856_100738323
518 Ga0070702_100058129
519 Ga0070702_100152163
520 Ga0068852_100145438
521 Ga0068852_100341929
522 Ga0068859_100478687
523 Ga0068859_100648050
524 Ga0068859_102535148
525 Ga0068864_100042516
526 Ga0068866_10063983
527 Ga0068866_10175406
528 Ga0068861_100106647
529 Ga0068861_100205810
530 Ga0068861_100964663
531 Ga0068851_10227091
532 Ga0068863_100294417
533 Ga0068863_101652075
534 Ga0068863_101681188
535 Ga0068858_100158256
536 Ga0068858_100987837
537 Ga0068860_100093778
538 Ga0068860_100449511
539 Ga0068860_102094047
540 Ga0068862_100095678
541 Ga0068862_100188520
542 Ga0068862_100244423
543 Ga0068862_100419712
544 Ga0081455_10137587
545 Ga0075365_10017677
546 Ga0075365_11205980
547 Ga0075368_10110409
548 Ga0075364_10062856
549 Ga0075364_10073391
550 Ga0070712_100412051
551 Ga0075367_10316781
552 Ga0075369_10188491
553 Ga0075366_10065200
554 Ga0075366_10576080
555 Ga0075370_10043554
556 Ga0068871_100340148
557 Ga0075428_100143366
558 Ga0075428_100148764
559 Ga0075428_101176581
560 Ga0075428_101757488
561 Ga0075428_101990371
562 Ga0075430_100017919
563 Ga0075430_100055063
564 Ga0075430_100076217
565 Ga0075431_100117509
566 Ga0075431_100136548
567 Ga0075433_10170649
568 Ga0075433_11700740
569 Ga0075434_100000168
570 Ga0075434_100100452
571 Ga0075434_100187647
572 Ga0075434_100572006
573 Ga0075429_100112857
574 Ga0075429_100795332
575 Ga0075429_100949463
576 Ga0068865_100582025
577 Ga0068865_100846526
578 Ga0075436_100000615
579 Ga0075436_100669121
580 Ga0097620_100478690
581 Ga0097620_100648111
582 Ga0097620_102534787
583 Ga0075435_100000004
584 Ga0075435_100009945
585 Ga0075435_100023978
586 Ga0099794_10127158
587 Ga0099795_10204588
588 Ga0105240_10025623
589 Ga0105240_10928258
590 Ga0105240_12149605
591 Ga0111539_10065801
592 Ga0111539_10140930
593 Ga0111539_10496485
594 Ga0111539_10965692
595 Ga0111539_11094321
596 Ga0111539_11212719
597 Ga0111539_12807111
598 Ga0105245_10917453
599 Ga0105245_12284656
600 Ga0105245_12646769
601 Ga0105247_10896669
602 Ga0114129_10019797
603 Ga0114129_10043804
604 Ga0114129_10489481
605 Ga0105243_10021101
606 Ga0105243_10463449
607 Ga0105241_10079363
608 Ga0105242_10026725
609 Ga0105242_10436425
610 Ga0105248_10421307
611 Ga0105249_10027172
612 Ga0105249_10070784
613 Ga0105249_10146187
614 Ga0105249_10658975
615 Ga0105239_10121950
616 Ga0105239_10332212
617 Ga0157378_10412310
618 Ga0157378_10447809
619 Ga0163162_11195543
620 Ga0157372_10321253
621 Ga0157372_11686241
622 Ga0157375_11896456
623 Ga0163163_10034370
624 Ga0157380_11434611
625 Ga0157380_11502586
626 Ga0157377_11155239
627 Ga0157377_11251864
628 Ga0157379_10034100
629 Ga0157376_11212921
630 Ga0206356_10963908
631 Ga0206356_11017606
632 Ga0206353_11685023
633 Ga0206353_11692009
634 Ga0207697_10017092
635 Ga0207642_10172621
636 Ga0207642_10937517
637 Ga0207688_10025533
638 Ga0207688_10098304
639 Ga0207680_10115412
640 Ga0207647_10641704
641 Ga0207645_10007786
642 Ga0207645_10029781
643 Ga0207654_10058103
644 Ga0207695_10609282
645 Ga0207660_10148911
646 Ga0207660_11228761
647 Ga0207662_10034814
648 Ga0207662_11092309
649 Ga0207657_11476667
650 Ga0207649_10243363
651 Ga0207649_10399890
652 Ga0207652_10157755
653 Ga0207681_10147084
654 Ga0207681_10801740
655 Ga0207650_10085350
656 Ga0207659_10008192
657 Ga0207659_10115115
658 Ga0207659_10872363
659 Ga0207687_10246714
660 Ga0207687_11286141
661 Ga0207644_10072543
662 Ga0207644_10186144
663 Ga0207690_10487547
664 Ga0207690_10893084
665 Ga0207686_10016407
666 Ga0207686_10250028
667 Ga0207709_10183108
668 Ga0207670_10207756
669 Ga0207670_10254606
670 Ga0207669_10141924
671 Ga0207704_10557087
672 Ga0207691_10005509
673 Ga0207691_10007081
674 Ga0207711_10719259
675 Ga0207689_10025118
676 Ga0207689_10147624
677 Ga0207661_10223419
678 Ga0207679_11171984
679 Ga0207667_10694947
680 Ga0207667_11305647
681 Ga0207667_11674213
682 Ga0207651_10093760
683 Ga0207712_10249588
684 Ga0207668_11033631
685 Ga0207640_10070988
686 Ga0207658_10173268
687 Ga0207658_10747794
688 Ga0207677_10560441
689 Ga0207703_10287116
690 Ga0207703_11542836
691 Ga0207678_10333643
692 Ga0207678_10469284
693 Ga0207708_10015813
694 Ga0207708_10144803
695 Ga0207708_10511560
696 Ga0207702_10469778
697 Ga0207641_10154837
698 Ga0207641_11207356
699 Ga0207648_10004388
700 Ga0207648_10006114
701 Ga0207676_10574580
702 Ga0207674_11780631
703 Ga0207675_100103580
704 Ga0207675_100258029
705 Ga0207675_101552136
706 Ga0207683_10093733
707 Ga0207698_10083630
708 Ga0207698_10098579
709 Ga0209813_10024855
710 Ga0209813_10079688
711 Ga0268266_10653977
712 Ga0268265_10102350
713 Ga0268265_10207077
714 Ga0268265_10655348
715 Ga0268264_10155386
716 Ga0268264_10464486
717 Ga0268264_11916399
718 Ga0307408_100126657
719 Ga0307410_10042838
720 Ga0307406_10189895
721 Ga0307407_10046449
722 Ga0307412_10952792
723 Ga0307409_100041929
724 Ga0307409_100647984
725 Ga0307416_100087435
726 Ga0307416_100144800
727 Ga0307416_100328237
728 Ga0307416_100699088
729 Ga0307416_102242034
730 Ga0307414_10164868
731 Ga0307415_100239188
732 Ga0307415_100616543
733 Ga0373930_0142301
734 Ga0373940_0270052
735 Ga0373951_0201956
736 Ga0373939_0034511
737 Ga0373942_0176718
738 Ga0373961_0116186
739 Ga0373962_0089729
740 Ga0373962_0246934
741 Ga0373931_0735372
742 Ga0395905_0320388
743 Ga0436364_1199661
744 Ga0439439_0121784
745 Ga0439433_0019610
746 Ga0439446_0020293
747 Ga0439464_0030020
748 Ga0451577_0434612
749 Ga0466963_0884297
750 Ga0451576_1098816
751 Ga0495580_0630091
752 Ga0495659_0320198
753 Ga0496104_1085144
754 Ga0496106_0122468
755 Ga0496106_0256696
756 Ga0496106_1288197
757 Ga0496108_1191415
758 Ga0496109_0159292
759 Ga0496109_0245671
760 Ga0496109_1782625
761 Ga0496111_1005763
762 Ga0496112_0428760
763 Ga0496112_0897751
764 Ga0496113_0699477
765 Ga0501034_0005753
766 Ga0501037_0695715
767 Ga0501038_0877833
768 Ga0501039_1400802
769 Ga0501042_0576543
770 Ga0501043_0242215
771 Ga0501046_0203648
772 Ga0501047_0039914
773 Ga0501047_0068687
774 Ga0501047_0453210
775 Ga0501069_0131305
776 Ga0501071_0101353
777 Ga0501072_0078071
778 Ga0501072_0450022
779 Ga0501076_0291903
780 Ga0501076_0658902
781 Ga0501233_106192
782 Ga0501239_005139
783 Ga0501225_0267420
784 Ga0501080_0992821
785 Ga0501081_0201367
786 Ga0501083_0466570
787 Ga0501264_028213
788 Ga0501212_114933
789 nmdc:mga00v17_110491_c1
790 nmdc:mga00v17_146125_c1
791 nmdc:mga0yw44_22131_c1
792 nmdc:mga0k408_11712_c1
793 nmdc:mga06z11_218140_c1
794 nmdc:mga06z11_604980_c1
795 nmdc:mga04h51_35093_c1
796 nmdc:mga07m45_146675_c1
797 nmdc:mga05p37_136834_c1
798 nmdc:mga05p37_38192_c1
799 nmdc:mga09592_103332_c1
800 nmdc:mga09592_521159_c1
801 nmdc:mga09592_769582_c1
802 nmdc:mga0qj67_539156_c1
803 nmdc:mga0qj67_59075_c1
804 nmdc:mga0qj67_98076_c1
805 nmdc:mga06r32_202255_c1
806 nmdc:mga06r32_363127_c1
807 nmdc:mga06r32_724021_c1
808 nmdc:mga06r32_863060_c1
809 nmdc:mga08y16_213471_c1
810 nmdc:mga08y16_306399_c1
811 nmdc:mga08y16_440204_c1
812 nmdc:mga08y16_51147_c1
813 nmdc:mga08y16_52056_c1
814 nmdc:mga0n895_239173_c1
815 nmdc:mga0n895_6_c1
816 nmdc:mga0n895_781945_c1
817 nmdc:mga0rr50_119716_c1
818 nmdc:mga0rr50_25402_c1
819 nmdc:mga0rr50_7_c1
820 nmdc:mga08x19_67_c1
821 nmdc:mga0a205_1403392_c1
822 nmdc:mga0a205_77482_c1
823 nmdc:mga0sz30_110745_c1
824 Ga0500628_065411
825 Ga0501084_0624493
826 Ga0501084_1303985
827 Ga0590071_111723
828 Ga0501082_1029638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

16

90

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dym-assembly1.cif.gz_A-2 crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution 0.8448 10 103
6fuu-assembly1.cif.gz_A transcriptional regulator lmrr with bound heme 0.8224 13 103
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.8186 12 101
1ub9-assembly1.cif.gz_A-2 structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 0.8113 16 102
7q34-assembly2.cif.gz_C crystal structure of the multidrug binding transcriptional regulator lmrr in complex squaraine dye 0.806 15 107
ID Description Score Start End Superfamily
af_Q9VJY7_173_249_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8945 42 80 1.10.10.10
af_Q58335_10_98_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8557 13 104 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8448 10 103 1.10.10.10
6fuuA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8224 13 103 1.10.10.10
2mlgA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8184 10 80 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A517SER6-F1-model_v4 Transcriptional regulator PadR-like family protein 0.9611 1 96
AF-A0A5C5XLX5-F1-model_v4 Transcriptional regulator PadR-like family protein 0.9524 4 102
AF-A0A7V7SW48-F1-model_v4 PadR family transcriptional regulator 0.9489 5 101
AF-A0A353B8M7-F1-model_v4 PadR family transcriptional regulator 0.9442 4 101
AF-A0A7V7MMU5-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.924 5 101

Map