F438312

General Info

Members Datasets Scaffolds Average Seq Length
414 265 828 188

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10772777|Ga0105241_107727772
Length 210
Sequence MTHSDDFRAAVASERKSKQGGPGMRKLIATVFNYSLDGLLADPDTEFWKFCFDLPENREPDDPAQLEFLRSAYAHVMGRTAYEGIAPAMTTNTDHPFSPILNAARKVVFSRTLKTADWPNTTIAAGDTAQEIEELRQGGDGHIVVWGGVSLWRSLMQLDLIDDLQVSLFPYVAGEGTRLFDGVPKSYRLDLVSSTASRSGIVELQYRRHR

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
130 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
137 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
261 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
262 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
263 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
264 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
265 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 4.83
Rhizosphere 91.55
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10772777 3300009174 Bacteria 883
2 JGI25407J50210_10027097 3300003373 Bacteria 1486
3 Ga0065712_10470878 3300005290 Bacteria 670
4 Ga0070683_100014204 3300005329 Bacteria 6958
5 Ga0070683_100836328 3300005329 Bacteria 883
6 Ga0068868_100766449 3300005338 Bacteria 868
7 Ga0070660_100607833 3300005339 Bacteria 914
8 Ga0070660_101066994 3300005339 Bacteria 683
9 Ga0070692_10062717 3300005345 Bacteria 1962
10 Ga0070659_100997750 3300005366 Bacteria 735
11 Ga0070709_10011022 3300005434 Bacteria 5023
12 Ga0070709_10203348 3300005434 Bacteria 1404
13 Ga0070714_100262171 3300005435 Bacteria 1601
14 Ga0070713_100004114 3300005436 Bacteria 9694
15 Ga0070713_100305394 3300005436 Bacteria 1466
16 Ga0070713_100411712 3300005436 Bacteria 1264
17 Ga0070713_100764663 3300005436 Bacteria 925
18 Ga0070713_100834976 3300005436 Bacteria 884
19 Ga0070710_10261791 3300005437 Bacteria 1115
20 Ga0070701_10349029 3300005438 Bacteria 924
21 Ga0070694_100483245 3300005444 Bacteria 983
22 Ga0070708_100042022 3300005445 Bacteria 4010
23 Ga0070663_100305747 3300005455 Bacteria 1274
24 Ga0070681_10669393 3300005458 Bacteria 953
25 Ga0068867_100225691 3300005459 Bacteria 1512
26 Ga0068867_100781810 3300005459 Bacteria 850
27 Ga0070685_10828056 3300005466 Bacteria 684
28 Ga0070706_100296577 3300005467 Bacteria 1509
29 Ga0070706_100833933 3300005467 Bacteria 853
30 Ga0070707_100052540 3300005468 Bacteria 3907
31 Ga0070707_100214326 3300005468 Bacteria 1876
32 Ga0070707_100824558 3300005468 Bacteria 891
33 Ga0070698_100022707 3300005471 Bacteria 6560
34 Ga0070698_100689290 3300005471 Bacteria 963
35 Ga0070698_100900119 3300005471 Bacteria 830
36 Ga0070699_100027236 3300005518 Bacteria 4931
37 Ga0070699_100118971 3300005518 Bacteria 2322
38 Ga0070699_100250328 3300005518 Bacteria 1583
39 Ga0070699_100936912 3300005518 Bacteria 794
40 Ga0070684_100000852 3300005535 Bacteria 21507
41 Ga0070684_100019270 3300005535 Bacteria 5641
42 Ga0070684_100238502 3300005535 Bacteria 1661
43 Ga0070684_101191991 3300005535 Bacteria 716
44 Ga0070697_100003405 3300005536 Bacteria 12224
45 Ga0070697_100187094 3300005536 Bacteria 1756
46 Ga0068853_100241766 3300005539 Bacteria 1655
47 Ga0070672_100458541 3300005543 Bacteria 1098
48 Ga0070695_100068533 3300005545 Bacteria 2317
49 Ga0070695_100081729 3300005545 Bacteria 2138
50 Ga0070696_100036095 3300005546 Bacteria 3406
51 Ga0070696_100283591 3300005546 Bacteria 1263
52 Ga0070665_100095326 3300005548 Bacteria 2980
53 Ga0070704_101342315 3300005549 Bacteria 655
54 Ga0068857_100021083 3300005577 Bacteria 5734
55 Ga0068857_100210750 3300005577 Bacteria 1773
56 Ga0068854_100003123 3300005578 Bacteria 10309
57 Ga0068856_100052635 3300005614 Bacteria 4015
58 Ga0068856_100300505 3300005614 Bacteria 1623
59 Ga0068852_100044743 3300005616 Bacteria 3763
60 Ga0068859_101051198 3300005617 Bacteria 895
61 Ga0068861_100259557 3300005719 Bacteria 1487
62 Ga0081455_10009248 3300005937 Bacteria 10153
63 Ga0081455_10015190 3300005937 Bacteria 7492
64 Ga0081455_10051439 3300005937 Bacteria 3534
65 Ga0081455_10105908 3300005937 Bacteria 2246
66 Ga0081455_10118607 3300005937 Bacteria 2089
67 Ga0081538_10062235 3300005981 Bacteria 2130
68 Ga0075365_10006749 3300006038 Bacteria 6350
69 Ga0075365_10084466 3300006038 Bacteria 2155
70 Ga0075364_10097029 3300006051 Bacteria 1960
71 Ga0075364_10286868 3300006051 Bacteria 1120
72 Ga0075367_10194007 3300006178 Bacteria 1268
73 Ga0075428_100992770 3300006844 Bacteria 889
74 Ga0075430_100038599 3300006846 Bacteria 4044
75 Ga0075431_100098708 3300006847 Bacteria 3015
76 Ga0075431_100272305 3300006847 Bacteria 1715
77 Ga0075433_10400073 3300006852 Bacteria 1212
78 Ga0075434_100406939 3300006871 Bacteria 1382
79 Ga0075429_100140034 3300006880 Bacteria 2117
80 Ga0075436_100126055 3300006914 Bacteria 1794
81 Ga0097620_101051057 3300006931 Bacteria 895
82 Ga0099794_10246351 3300007265 Bacteria 921
83 Ga0105240_10065873 3300009093 Bacteria 4496
84 Ga0111539_10138069 3300009094 Bacteria 2855
85 Ga0111539_10684909 3300009094 Bacteria 1193
86 Ga0111539_11306284 3300009094 Bacteria 842
87 Ga0105245_10385468 3300009098 Bacteria 1397
88 Ga0105245_11461698 3300009098 Bacteria 734
89 Ga0114129_10022238 3300009147 Bacteria 9002
90 Ga0114129_10067619 3300009147 Bacteria 4983
91 Ga0114129_10338959 3300009147 Bacteria 1995
92 Ga0114129_10607826 3300009147 Bacteria 1416
93 Ga0105243_10013998 3300009148 Bacteria 6070
94 Ga0105243_10057349 3300009148 Bacteria 3101
95 Ga0105243_10357688 3300009148 Bacteria 1343
96 Ga0105242_10009979 3300009176 Bacteria 7270
97 Ga0105242_10068676 3300009176 Bacteria 2933
98 Ga0105237_10053868 3300009545 Bacteria 4033
99 Ga0105237_11029153 3300009545 Bacteria 830
100 Ga0105238_10004152 3300009551 Bacteria 14369
101 Ga0105249_10071808 3300009553 Bacteria 3199
102 Ga0105239_10138190 3300010375 Bacteria 2713
103 Ga0105239_10594174 3300010375 Bacteria 1262
104 Ga0105246_10085241 3300011119 Bacteria 2262
105 Ga0105246_10253185 3300011119 Bacteria 1399
106 Ga0157373_10271844 3300013100 Bacteria 1200
107 Ga0157369_10368331 3300013105 Bacteria 1491
108 Ga0157369_10541186 3300013105 Bacteria 1204
109 Ga0157378_10017341 3300013297 Bacteria 6318
110 Ga0157378_10077325 3300013297 Bacteria 3000
111 Ga0163162_10286313 3300013306 Bacteria 1780
112 Ga0157372_10662336 3300013307 Bacteria 1215
113 Ga0157375_10095543 3300013308 Bacteria 3043
114 Ga0157375_10542143 3300013308 Unclassified 1326
115 Ga0157380_10635593 3300014326 Bacteria 1062
116 Ga0157377_10204211 3300014745 Bacteria 1256
117 Ga0157376_11103845 3300014969 Bacteria 819
118 Ga0207692_10485357 3300025898 Bacteria 782
119 Ga0207647_10007457 3300025904 Bacteria 7901
120 Ga0207643_10522726 3300025908 Bacteria 760
121 Ga0207684_10387236 3300025910 Bacteria 1202
122 Ga0207684_10526886 3300025910 Bacteria 1012
123 Ga0207684_11206397 3300025910 Bacteria 626
124 Ga0207654_10050674 3300025911 Bacteria 2387
125 Ga0207707_10607192 3300025912 Bacteria 925
126 Ga0207695_10009756 3300025913 Bacteria 11814
127 Ga0207671_10000384 3300025914 Bacteria 62663
128 Ga0207693_10082719 3300025915 Bacteria 2514
129 Ga0207657_10072862 3300025919 Bacteria 2904
130 Ga0207657_10756059 3300025919 Bacteria 753
131 Ga0207646_10000147 3300025922 Bacteria 96075
132 Ga0207646_10118394 3300025922 Bacteria 2379
133 Ga0207646_11237703 3300025922 Bacteria 653
134 Ga0207694_10013909 3300025924 Bacteria 6067
135 Ga0207687_10149498 3300025927 Bacteria 1780
136 Ga0207700_10861465 3300025928 Bacteria 811
137 Ga0207664_10157636 3300025929 Bacteria 1934
138 Ga0207690_10905599 3300025932 Bacteria 732
139 Ga0207706_10638190 3300025933 Bacteria 913
140 Ga0207686_10291505 3300025934 Bacteria 1208
141 Ga0207709_10204290 3300025935 Bacteria 1413
142 Ga0207709_10275188 3300025935 Bacteria 1241
143 Ga0207709_11253445 3300025935 Bacteria 612
144 Ga0207691_10109967 3300025940 Bacteria 2452
145 Ga0207679_10317609 3300025945 Bacteria 1348
146 Ga0207667_10022193 3300025949 Bacteria 7020
147 Ga0207712_10034345 3300025961 Bacteria 3437
148 Ga0207640_10085933 3300025981 Bacteria 2164
149 Ga0207677_10200425 3300026023 Bacteria 1586
150 Ga0207677_10543997 3300026023 Bacteria 1011
151 Ga0207703_10663615 3300026035 Bacteria 990
152 Ga0207678_10371658 3300026067 Bacteria 1235
153 Ga0207678_10629443 3300026067 Bacteria 942
154 Ga0207702_10173726 3300026078 Bacteria 1978
155 Ga0207702_10880836 3300026078 Bacteria 887
156 Ga0207648_10023866 3300026089 Bacteria 5470
157 Ga0207648_10178910 3300026089 Bacteria 1877
158 Ga0207674_10037231 3300026116 Bacteria 5062
159 Ga0207674_10109437 3300026116 Bacteria 2739
160 Ga0207674_10389582 3300026116 Bacteria 1347
161 Ga0207698_10150623 3300026142 Bacteria 2018
162 Ga0207698_10719565 3300026142 Bacteria 995
163 Ga0209970_1033445 3300027614 Bacteria 899
164 Ga0207428_10040439 3300027907 Bacteria 3782
165 Ga0268265_10582037 3300028380 Bacteria 1067
166 Ga0265338_10004761 3300028800 Bacteria 18148
167 Ga0307513_10090708 3300031456 Bacteria 3116
168 Ga0307408_100324082 3300031548 Bacteria 1299
169 Ga0307405_10049125 3300031731 Bacteria 2606
170 Ga0307406_10055649 3300031901 Bacteria 2530
171 Ga0307407_10178767 3300031903 Bacteria 1404
172 Ga0307412_10249954 3300031911 Bacteria 1376
173 Ga0307409_101574702 3300031995 Bacteria 685
174 Ga0307416_100057995 3300032002 Bacteria 3136
175 Ga0307416_102351623 3300032002 Bacteria 633
176 Ga0307414_10118482 3300032004 Bacteria 2031
177 Ga0307411_10088254 3300032005 Bacteria 2156
178 Ga0307415_100022844 3300032126 Bacteria 3870
179 Ga0307415_100439175 3300032126 Bacteria 1125
180 Ga0373926_0138592 3300035083 Bacteria 923
181 Ga0373932_0244516 3300035112 Bacteria 653
182 Ga0373943_0180313 3300035170 Bacteria 1160
183 Ga0373935_0004801 3300035692 Bacteria 7947
184 Ga0373927_0034341 3300035695 Bacteria 3300
185 Ga0373947_0271235 3300035725 Bacteria 1126
186 Ga0395899_0055965 3300037312 Bacteria 2916
187 Ga0395900_0071670 3300037418 Bacteria 3562
188 Ga0395900_0075468 3300037418 Bacteria 3466
189 Ga0395900_0137967 3300037418 Bacteria 2498
190 Ga0395900_0397404 3300037418 Bacteria 1343
191 Ga0395898_0171332 3300037466 Bacteria 2075
192 Ga0395905_0117123 3300037471 Bacteria 2503
193 Ga0395905_0278906 3300037471 Bacteria 1557
194 Ga0395905_0361181 3300037471 Bacteria 1345
195 Ga0395901_0009463 3300038443 Bacteria 9887
196 Ga0395901_0013918 3300038443 Bacteria 8187
197 Ga0395901_0072825 3300038443 Bacteria 3582
198 Ga0395901_1137280 3300038443 Bacteria 749
199 Ga0439439_0024859 3300041406 Bacteria 1505
200 Ga0439453_0019133 3300041408 Bacteria 1217
201 Ga0451807_1416612 3300041486 Bacteria 750
202 Ga0451853_0646852 3300041512 Bacteria 2419
203 Ga0439433_0023955 3300041999 Bacteria 1374
204 Ga0439448_0224493 3300042005 Bacteria 661
205 Ga0439462_0002556 3300042015 Bacteria 4244
206 Ga0450923_019344 3300042125 Bacteria 1311
207 Ga0450906_019174 3300042145 Bacteria 1226
208 Ga0439446_0020763 3300042156 Bacteria 1852
209 Ga0439434_0050538 3300042435 Bacteria 1288
210 Ga0450893_0099244 3300042532 Bacteria 592
211 Ga0466957_0469874 3300044842 Unclassified 869
212 Ga0466959_0346120 3300045049 Bacteria 1014
213 Ga0466958_0040776 3300045836 Bacteria 2791
214 Ga0495592_0297538 3300046454 Bacteria 1050
215 Ga0495603_0017419 3300046455 Bacteria 4347
216 Ga0495603_0055607 3300046455 Bacteria 2345
217 Ga0495603_0128493 3300046455 Bacteria 1476
218 Ga0495629_0015439 3300046459 Bacteria 5483
219 Ga0495629_0045479 3300046459 Bacteria 3080
220 Ga0495641_0011979 3300046461 Bacteria 4888
221 Ga0495651_0280759 3300046462 Bacteria 1125
222 Ga0495653_0439446 3300046463 Bacteria 822
223 Ga0495580_0249134 3300046472 Bacteria 1216
224 Ga0495582_0124774 3300046473 Bacteria 1452
225 Ga0495582_0138856 3300046473 Bacteria 1376
226 Ga0495639_0070604 3300046475 Bacteria 1613
227 Ga0495662_0006360 3300046476 Bacteria 5903
228 Ga0495594_0102243 3300046499 Bacteria 1612
229 Ga0495607_0262676 3300046501 Bacteria 826
230 Ga0495606_0002443 3300046507 Bacteria 21597
231 Ga0495616_0339062 3300046513 Bacteria 628
232 Ga0495630_0005428 3300046517 Bacteria 9000
233 Ga0495630_0059389 3300046517 Bacteria 2869
234 Ga0495637_0235535 3300046520 Bacteria 663
235 Ga0495652_0069571 3300046529 Bacteria 2946
236 Ga0495665_0032048 3300046531 Bacteria 2811
237 Ga0495665_0104844 3300046531 Bacteria 1483
238 Ga0495640_0034974 3300046533 Bacteria 3558
239 Ga0495586_0228019 3300046535 Bacteria 1060
240 Ga0495645_0127590 3300046543 Bacteria 1786
241 Ga0495667_0041205 3300046559 Bacteria 3063
242 Ga0495656_0000313 3300046615 Bacteria 16745
243 Ga0495668_0001449 3300046616 Bacteria 22924
244 Ga0495634_0025231 3300046642 Bacteria 4163
245 Ga0495611_0258331 3300046648 Bacteria 807
246 Ga0495625_0001962 3300046660 Bacteria 23234
247 Ga0495635_0005925 3300046663 Bacteria 8529
248 Ga0495659_0350837 3300046664 Bacteria 631
249 Ga0495588_0033663 3300046674 Bacteria 2589
250 Ga0495657_0286494 3300046675 Bacteria 985
251 Ga0495599_0406866 3300046678 Bacteria 810
252 Ga0495646_0110413 3300046680 Bacteria 1566
253 Ga0495647_0024241 3300046681 Bacteria 2207
254 Ga0495658_0309222 3300046683 Bacteria 1000
255 Ga0495613_0015912 3300046689 Bacteria 5600
256 Ga0495613_0393183 3300046689 Bacteria 947
257 Ga0495624_0015807 3300046690 Bacteria 5082
258 Ga0495670_0008933 3300046691 Bacteria 4928
259 Ga0495670_0080327 3300046691 Bacteria 1661
260 Ga0495600_0058266 3300046809 Bacteria 2523
261 Ga0495581_0006367 3300047315 Bacteria 6848
262 Ga0495581_0016825 3300047315 Bacteria 4251
263 Ga0495581_0346713 3300047315 Bacteria 867
264 Ga0495604_0115473 3300047317 Bacteria 1951
265 Ga0495636_0010295 3300047318 Bacteria 3692
266 Ga0495674_0094516 3300047319 Bacteria 2550
267 Ga0495676_0148243 3300047321 Bacteria 1673
268 Ga0495676_0309266 3300047321 Bacteria 1064
269 Ga0495676_0356060 3300047321 Bacteria 978
270 Ga0495680_0008691 3300047322 Bacteria 9210
271 Ga0495683_0118731 3300047323 Bacteria 1257
272 Ga0495679_047914 3300047446 Bacteria 1295
273 Ga0495684_0006029 3300047471 Bacteria 9422
274 Ga0495593_0013287 3300047673 Bacteria 4699
275 Ga0495593_0101197 3300047673 Bacteria 1478
276 Ga0495614_0085467 3300048089 Bacteria 1369
277 Ga0495626_0000566 3300048091 Bacteria 36732
278 Ga0496100_0053007 3300048903 Bacteria 2640
279 Ga0496100_1089503 3300048903 Bacteria 629
280 Ga0496101_0028511 3300048904 Bacteria 3898
281 Ga0496102_0153950 3300048905 Bacteria 2161
282 Ga0496102_0968412 3300048905 Bacteria 772
283 Ga0496103_0131221 3300048906 Bacteria 1600
284 Ga0496104_0343364 3300048907 Bacteria 1406
285 Ga0496105_0209332 3300048908 Bacteria 1590
286 Ga0496106_0004265 3300048909 Bacteria 10639
287 Ga0496107_0061654 3300048910 Bacteria 2715
288 Ga0496108_0098913 3300048911 Bacteria 2486
289 Ga0496108_0350167 3300048911 Bacteria 1289
290 Ga0496109_0003979 3300048912 Bacteria 12339
291 Ga0496109_0088259 3300048912 Bacteria 2866
292 Ga0496112_0008029 3300048915 Bacteria 9417
293 Ga0496113_0214200 3300048916 Bacteria 1534
294 Ga0496113_0311811 3300048916 Unclassified 1260
295 Ga0496114_0120706 3300048917 Bacteria 2254
296 Ga0496114_0301039 3300048917 Bacteria 1416
297 Ga0501295_079042 3300049518 Bacteria 746
298 Ga0501031_0000382 3300049568 Bacteria 25981
299 Ga0501031_0000527 3300049568 Bacteria 22405
300 Ga0501032_0041282 3300049569 Bacteria 3134
301 Ga0501032_0062878 3300049569 Bacteria 2486
302 Ga0501033_0008594 3300049570 Bacteria 7903
303 Ga0501033_0264267 3300049570 Bacteria 1217
304 Ga0501034_0407512 3300049571 Bacteria 1282
305 Ga0501034_0841126 3300049571 Bacteria 808
306 Ga0501036_0000292 3300049572 Bacteria 34675
307 Ga0501036_0078081 3300049572 Bacteria 2800
308 Ga0501037_0003900 3300049573 Bacteria 10822
309 Ga0501038_0001801 3300049574 Bacteria 19835
310 Ga0501039_0000651 3300049575 Bacteria 25068
311 Ga0501039_0013582 3300049575 Bacteria 6228
312 Ga0501040_0000811 3300049576 Bacteria 19470
313 Ga0501040_0003029 3300049576 Bacteria 10892
314 Ga0501041_0000446 3300049577 Bacteria 20944
315 Ga0501041_0028753 3300049577 Bacteria 3353
316 Ga0501042_0000873 3300049578 Bacteria 16854
317 Ga0501043_0002605 3300049579 Bacteria 15214
318 Ga0501043_0028259 3300049579 Bacteria 4402
319 Ga0501046_0005915 3300049580 Bacteria 10895
320 Ga0501048_0000535 3300049582 Bacteria 26783
321 Ga0501048_0003212 3300049582 Bacteria 12449
322 Ga0501067_0011714 3300049583 Bacteria 4858
323 Ga0501067_0026804 3300049583 Bacteria 3191
324 Ga0501068_0001694 3300049584 Bacteria 11742
325 Ga0501068_0060891 3300049584 Bacteria 2292
326 Ga0501068_0071059 3300049584 Bacteria 2124
327 Ga0501068_0206462 3300049584 Bacteria 1247
328 Ga0501069_0013715 3300049585 Bacteria 4323
329 Ga0501069_0049639 3300049585 Bacteria 2332
330 Ga0501069_0066295 3300049585 Bacteria 2019
331 Ga0501070_0001660 3300049586 Bacteria 19720
332 Ga0501070_0035027 3300049586 Bacteria 4196
333 Ga0501071_0000307 3300049587 Bacteria 23410
334 Ga0501071_0000334 3300049587 Bacteria 22757
335 Ga0501071_0144101 3300049587 Bacteria 1775
336 Ga0501071_0160422 3300049587 Bacteria 1680
337 Ga0501072_0000435 3300049588 Bacteria 29920
338 Ga0501072_0219623 3300049588 Bacteria 1515
339 Ga0501072_0574709 3300049588 Bacteria 889
340 Ga0501072_0787163 3300049588 Bacteria 745
341 Ga0501073_0003641 3300049589 Bacteria 11583
342 Ga0501074_0001075 3300049590 Bacteria 17840
343 Ga0501074_0002541 3300049590 Bacteria 12723
344 Ga0501075_0000166 3300049591 Bacteria 34245
345 Ga0501075_0010300 3300049591 Bacteria 6569
346 Ga0501075_0213931 3300049591 Bacteria 1470
347 Ga0501075_0332070 3300049591 Bacteria 1159
348 Ga0501075_0427100 3300049591 Bacteria 1010
349 Ga0501076_0001596 3300049592 Bacteria 15252
350 Ga0501076_0015251 3300049592 Bacteria 5805
351 Ga0501076_0167482 3300049592 Bacteria 1791
352 Ga0501076_0284232 3300049592 Bacteria 1355
353 Ga0501076_0498259 3300049592 Bacteria 1004
354 Ga0501076_0857971 3300049592 Bacteria 749
355 Ga0501077_0004992 3300049593 Bacteria 8043
356 Ga0501077_0056776 3300049593 Bacteria 2485
357 Ga0501077_0557134 3300049593 Bacteria 736
358 Ga0501202_022154 3300049652 Bacteria 1275
359 Ga0501079_0001674 3300049741 Bacteria 15764
360 Ga0501079_0035423 3300049741 Bacteria 3841
361 Ga0501079_0157202 3300049741 Bacteria 1772
362 Ga0501079_0169761 3300049741 Bacteria 1701
363 Ga0501079_0229566 3300049741 Bacteria 1450
364 Ga0501079_0801362 3300049741 Bacteria 742
365 Ga0501080_0000525 3300049742 Bacteria 30085
366 Ga0501080_0004112 3300049742 Bacteria 12894
367 Ga0501080_0391108 3300049742 Bacteria 1252
368 Ga0501080_0523370 3300049742 Bacteria 1058
369 Ga0501081_0004992 3300049743 Bacteria 8540
370 Ga0501081_0037312 3300049743 Bacteria 3315
371 Ga0501081_0092717 3300049743 Bacteria 2126
372 Ga0501083_0009026 3300049744 Bacteria 7037
373 Ga0501035_0026257 3300049822 Bacteria 5330
374 Ga0501035_0032290 3300049822 Bacteria 4764
375 Ga0501044_0040464 3300049823 Bacteria 4858
376 Ga0501045_0000320 3300049824 Bacteria 28123
377 Ga0501045_0014620 3300049824 Bacteria 5565
378 nmdc:mga00v17_270371_c1 3300050491 Bacteria 1103
379 nmdc:mga0yw44_19784_c1 3300050492 Bacteria 3720
380 nmdc:mga0yw44_460348_c1 3300050492 Bacteria 862
381 nmdc:mga06z11_384637_c1 3300050494 Bacteria 843
382 nmdc:mga05p37_1077178_c1 3300050507 Bacteria 844
383 nmdc:mga05p37_278662_c1 3300050507 Bacteria 1995
384 nmdc:mga05p37_777996_c1 3300050507 Bacteria 1051
385 nmdc:mga05p37_99936_c2 3300050507 Bacteria 3028
386 nmdc:mga09592_407060_c1 3300050508 Bacteria 1176
387 nmdc:mga0qj67_332149_c1 3300050509 Bacteria 1230
388 nmdc:mga06r32_201546_c1 3300050510 Bacteria 1978
389 nmdc:mga08y16_44406_c1 3300050511 Bacteria 4656
390 nmdc:mga08y16_45455_c1 3300050511 Bacteria 4601
391 nmdc:mga08y16_606671_c1 3300050511 Bacteria 1103
392 nmdc:mga0n895_262346_c1 3300050512 Bacteria 1753
393 nmdc:mga0rr50_837976_c1 3300050513 Bacteria 784
394 nmdc:mga08x19_97652_c1 3300050514 Bacteria 1945
395 nmdc:mga0a205_532305_c1 3300050515 Bacteria 1031
396 Ga0495601_0421929 3300053077 Bacteria 864
397 Ga0495612_0314766 3300053078 Bacteria 703
398 Ga0495619_0082597 3300053085 Bacteria 2166
399 Ga0501084_0000470 3300054114 Bacteria 31185
400 Ga0501084_0093369 3300054114 Bacteria 2526
401 Ga0501084_1282724 3300054114 Bacteria 614
402 Ga0501082_0000726 3300060353 Bacteria 29032
403 Ga0501082_0010480 3300060353 Bacteria 7976
404 Ga0501082_0253202 3300060353 Bacteria 1532
405 Ga0530510_0008620 3300061734 Bacteria 7123
406 Ga0530510_0016363 3300061734 Bacteria 5248
407 Ga0530510_0076416 3300061734 Bacteria 2433
408 Ga0530510_0376512 3300061734 Bacteria 1068
409 2676493047 2675903060 Bacteria 10051191
410 2884703299 2884693830 Bacteria 11273186
411 2895449286 2895442618 Bacteria 11027144
412 8001784969 8001781756 Bacteria 9586736
413 8055066360 8055066027 Bacteria 9479577
414 8055180326 8055172936 Bacteria 9305943
415 Ga0105241_10772777
416 JGI25407J50210_10027097
417 Ga0065712_10470878
418 Ga0070683_100014204
419 Ga0070683_100836328
420 Ga0068868_100766449
421 Ga0070660_100607833
422 Ga0070660_101066994
423 Ga0070692_10062717
424 Ga0070659_100997750
425 Ga0070709_10011022
426 Ga0070709_10203348
427 Ga0070714_100262171
428 Ga0070713_100004114
429 Ga0070713_100305394
430 Ga0070713_100411712
431 Ga0070713_100764663
432 Ga0070713_100834976
433 Ga0070710_10261791
434 Ga0070701_10349029
435 Ga0070694_100483245
436 Ga0070708_100042022
437 Ga0070663_100305747
438 Ga0070681_10669393
439 Ga0068867_100225691
440 Ga0068867_100781810
441 Ga0070685_10828056
442 Ga0070706_100296577
443 Ga0070706_100833933
444 Ga0070707_100052540
445 Ga0070707_100214326
446 Ga0070707_100824558
447 Ga0070698_100022707
448 Ga0070698_100689290
449 Ga0070698_100900119
450 Ga0070699_100027236
451 Ga0070699_100118971
452 Ga0070699_100250328
453 Ga0070699_100936912
454 Ga0070684_100000852
455 Ga0070684_100019270
456 Ga0070684_100238502
457 Ga0070684_101191991
458 Ga0070697_100003405
459 Ga0070697_100187094
460 Ga0068853_100241766
461 Ga0070672_100458541
462 Ga0070695_100068533
463 Ga0070695_100081729
464 Ga0070696_100036095
465 Ga0070696_100283591
466 Ga0070665_100095326
467 Ga0070704_101342315
468 Ga0068857_100021083
469 Ga0068857_100210750
470 Ga0068854_100003123
471 Ga0068856_100052635
472 Ga0068856_100300505
473 Ga0068852_100044743
474 Ga0068859_101051198
475 Ga0068861_100259557
476 Ga0081455_10009248
477 Ga0081455_10015190
478 Ga0081455_10051439
479 Ga0081455_10105908
480 Ga0081455_10118607
481 Ga0081538_10062235
482 Ga0075365_10006749
483 Ga0075365_10084466
484 Ga0075364_10097029
485 Ga0075364_10286868
486 Ga0075367_10194007
487 Ga0075428_100992770
488 Ga0075430_100038599
489 Ga0075431_100098708
490 Ga0075431_100272305
491 Ga0075433_10400073
492 Ga0075434_100406939
493 Ga0075429_100140034
494 Ga0075436_100126055
495 Ga0097620_101051057
496 Ga0099794_10246351
497 Ga0105240_10065873
498 Ga0111539_10138069
499 Ga0111539_10684909
500 Ga0111539_11306284
501 Ga0105245_10385468
502 Ga0105245_11461698
503 Ga0114129_10022238
504 Ga0114129_10067619
505 Ga0114129_10338959
506 Ga0114129_10607826
507 Ga0105243_10013998
508 Ga0105243_10057349
509 Ga0105243_10357688
510 Ga0105242_10009979
511 Ga0105242_10068676
512 Ga0105237_10053868
513 Ga0105237_11029153
514 Ga0105238_10004152
515 Ga0105249_10071808
516 Ga0105239_10138190
517 Ga0105239_10594174
518 Ga0105246_10085241
519 Ga0105246_10253185
520 Ga0157373_10271844
521 Ga0157369_10368331
522 Ga0157369_10541186
523 Ga0157378_10017341
524 Ga0157378_10077325
525 Ga0163162_10286313
526 Ga0157372_10662336
527 Ga0157375_10095543
528 Ga0157375_10542143
529 Ga0157380_10635593
530 Ga0157377_10204211
531 Ga0157376_11103845
532 Ga0207692_10485357
533 Ga0207647_10007457
534 Ga0207643_10522726
535 Ga0207684_10387236
536 Ga0207684_10526886
537 Ga0207684_11206397
538 Ga0207654_10050674
539 Ga0207707_10607192
540 Ga0207695_10009756
541 Ga0207671_10000384
542 Ga0207693_10082719
543 Ga0207657_10072862
544 Ga0207657_10756059
545 Ga0207646_10000147
546 Ga0207646_10118394
547 Ga0207646_11237703
548 Ga0207694_10013909
549 Ga0207687_10149498
550 Ga0207700_10861465
551 Ga0207664_10157636
552 Ga0207690_10905599
553 Ga0207706_10638190
554 Ga0207686_10291505
555 Ga0207709_10204290
556 Ga0207709_10275188
557 Ga0207709_11253445
558 Ga0207691_10109967
559 Ga0207679_10317609
560 Ga0207667_10022193
561 Ga0207712_10034345
562 Ga0207640_10085933
563 Ga0207677_10200425
564 Ga0207677_10543997
565 Ga0207703_10663615
566 Ga0207678_10371658
567 Ga0207678_10629443
568 Ga0207702_10173726
569 Ga0207702_10880836
570 Ga0207648_10023866
571 Ga0207648_10178910
572 Ga0207674_10037231
573 Ga0207674_10109437
574 Ga0207674_10389582
575 Ga0207698_10150623
576 Ga0207698_10719565
577 Ga0209970_1033445
578 Ga0207428_10040439
579 Ga0268265_10582037
580 Ga0265338_10004761
581 Ga0307513_10090708
582 Ga0307408_100324082
583 Ga0307405_10049125
584 Ga0307406_10055649
585 Ga0307407_10178767
586 Ga0307412_10249954
587 Ga0307409_101574702
588 Ga0307416_100057995
589 Ga0307416_102351623
590 Ga0307414_10118482
591 Ga0307411_10088254
592 Ga0307415_100022844
593 Ga0307415_100439175
594 Ga0373926_0138592
595 Ga0373932_0244516
596 Ga0373943_0180313
597 Ga0373935_0004801
598 Ga0373927_0034341
599 Ga0373947_0271235
600 Ga0395899_0055965
601 Ga0395900_0071670
602 Ga0395900_0075468
603 Ga0395900_0137967
604 Ga0395900_0397404
605 Ga0395898_0171332
606 Ga0395905_0117123
607 Ga0395905_0278906
608 Ga0395905_0361181
609 Ga0395901_0009463
610 Ga0395901_0013918
611 Ga0395901_0072825
612 Ga0395901_1137280
613 Ga0439439_0024859
614 Ga0439453_0019133
615 Ga0451807_1416612
616 Ga0451853_0646852
617 Ga0439433_0023955
618 Ga0439448_0224493
619 Ga0439462_0002556
620 Ga0450923_019344
621 Ga0450906_019174
622 Ga0439446_0020763
623 Ga0439434_0050538
624 Ga0450893_0099244
625 Ga0466957_0469874
626 Ga0466959_0346120
627 Ga0466958_0040776
628 Ga0495592_0297538
629 Ga0495603_0017419
630 Ga0495603_0055607
631 Ga0495603_0128493
632 Ga0495629_0015439
633 Ga0495629_0045479
634 Ga0495641_0011979
635 Ga0495651_0280759
636 Ga0495653_0439446
637 Ga0495580_0249134
638 Ga0495582_0124774
639 Ga0495582_0138856
640 Ga0495639_0070604
641 Ga0495662_0006360
642 Ga0495594_0102243
643 Ga0495607_0262676
644 Ga0495606_0002443
645 Ga0495616_0339062
646 Ga0495630_0005428
647 Ga0495630_0059389
648 Ga0495637_0235535
649 Ga0495652_0069571
650 Ga0495665_0032048
651 Ga0495665_0104844
652 Ga0495640_0034974
653 Ga0495586_0228019
654 Ga0495645_0127590
655 Ga0495667_0041205
656 Ga0495656_0000313
657 Ga0495668_0001449
658 Ga0495634_0025231
659 Ga0495611_0258331
660 Ga0495625_0001962
661 Ga0495635_0005925
662 Ga0495659_0350837
663 Ga0495588_0033663
664 Ga0495657_0286494
665 Ga0495599_0406866
666 Ga0495646_0110413
667 Ga0495647_0024241
668 Ga0495658_0309222
669 Ga0495613_0015912
670 Ga0495613_0393183
671 Ga0495624_0015807
672 Ga0495670_0008933
673 Ga0495670_0080327
674 Ga0495600_0058266
675 Ga0495581_0006367
676 Ga0495581_0016825
677 Ga0495581_0346713
678 Ga0495604_0115473
679 Ga0495636_0010295
680 Ga0495674_0094516
681 Ga0495676_0148243
682 Ga0495676_0309266
683 Ga0495676_0356060
684 Ga0495680_0008691
685 Ga0495683_0118731
686 Ga0495679_047914
687 Ga0495684_0006029
688 Ga0495593_0013287
689 Ga0495593_0101197
690 Ga0495614_0085467
691 Ga0495626_0000566
692 Ga0496100_0053007
693 Ga0496100_1089503
694 Ga0496101_0028511
695 Ga0496102_0153950
696 Ga0496102_0968412
697 Ga0496103_0131221
698 Ga0496104_0343364
699 Ga0496105_0209332
700 Ga0496106_0004265
701 Ga0496107_0061654
702 Ga0496108_0098913
703 Ga0496108_0350167
704 Ga0496109_0003979
705 Ga0496109_0088259
706 Ga0496112_0008029
707 Ga0496113_0214200
708 Ga0496113_0311811
709 Ga0496114_0120706
710 Ga0496114_0301039
711 Ga0501295_079042
712 Ga0501031_0000382
713 Ga0501031_0000527
714 Ga0501032_0041282
715 Ga0501032_0062878
716 Ga0501033_0008594
717 Ga0501033_0264267
718 Ga0501034_0407512
719 Ga0501034_0841126
720 Ga0501036_0000292
721 Ga0501036_0078081
722 Ga0501037_0003900
723 Ga0501038_0001801
724 Ga0501039_0000651
725 Ga0501039_0013582
726 Ga0501040_0000811
727 Ga0501040_0003029
728 Ga0501041_0000446
729 Ga0501041_0028753
730 Ga0501042_0000873
731 Ga0501043_0002605
732 Ga0501043_0028259
733 Ga0501046_0005915
734 Ga0501048_0000535
735 Ga0501048_0003212
736 Ga0501067_0011714
737 Ga0501067_0026804
738 Ga0501068_0001694
739 Ga0501068_0060891
740 Ga0501068_0071059
741 Ga0501068_0206462
742 Ga0501069_0013715
743 Ga0501069_0049639
744 Ga0501069_0066295
745 Ga0501070_0001660
746 Ga0501070_0035027
747 Ga0501071_0000307
748 Ga0501071_0000334
749 Ga0501071_0144101
750 Ga0501071_0160422
751 Ga0501072_0000435
752 Ga0501072_0219623
753 Ga0501072_0574709
754 Ga0501072_0787163
755 Ga0501073_0003641
756 Ga0501074_0001075
757 Ga0501074_0002541
758 Ga0501075_0000166
759 Ga0501075_0010300
760 Ga0501075_0213931
761 Ga0501075_0332070
762 Ga0501075_0427100
763 Ga0501076_0001596
764 Ga0501076_0015251
765 Ga0501076_0167482
766 Ga0501076_0284232
767 Ga0501076_0498259
768 Ga0501076_0857971
769 Ga0501077_0004992
770 Ga0501077_0056776
771 Ga0501077_0557134
772 Ga0501202_022154
773 Ga0501079_0001674
774 Ga0501079_0035423
775 Ga0501079_0157202
776 Ga0501079_0169761
777 Ga0501079_0229566
778 Ga0501079_0801362
779 Ga0501080_0000525
780 Ga0501080_0004112
781 Ga0501080_0391108
782 Ga0501080_0523370
783 Ga0501081_0004992
784 Ga0501081_0037312
785 Ga0501081_0092717
786 Ga0501083_0009026
787 Ga0501035_0026257
788 Ga0501035_0032290
789 Ga0501044_0040464
790 Ga0501045_0000320
791 Ga0501045_0014620
792 nmdc:mga00v17_270371_c1
793 nmdc:mga0yw44_19784_c1
794 nmdc:mga0yw44_460348_c1
795 nmdc:mga06z11_384637_c1
796 nmdc:mga05p37_1077178_c1
797 nmdc:mga05p37_278662_c1
798 nmdc:mga05p37_777996_c1
799 nmdc:mga05p37_99936_c2
800 nmdc:mga09592_407060_c1
801 nmdc:mga0qj67_332149_c1
802 nmdc:mga06r32_201546_c1
803 nmdc:mga08y16_44406_c1
804 nmdc:mga08y16_45455_c1
805 nmdc:mga08y16_606671_c1
806 nmdc:mga0n895_262346_c1
807 nmdc:mga0rr50_837976_c1
808 nmdc:mga08x19_97652_c1
809 nmdc:mga0a205_532305_c1
810 Ga0495601_0421929
811 Ga0495612_0314766
812 Ga0495619_0082597
813 Ga0501084_0000470
814 Ga0501084_0093369
815 Ga0501084_1282724
816 Ga0501082_0000726
817 Ga0501082_0010480
818 Ga0501082_0253202
819 Ga0530510_0008620
820 Ga0530510_0016363
821 Ga0530510_0076416
822 Ga0530510_0376512
823 2676493047
824 2884703299
825 2895449286
826 8001784969
827 8055066360
828 8055180326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

25

203

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4omf-assembly1.cif.gz_B-2 the f420-reducing [nife]-hydrogenase complex from methanothermobacter marburgensis, the first x-ray structure of a group 3 family member 0.7043 48 87
3jce-assembly1.cif.gz_x structure of escherichia coli ef4 in pretranslocational ribosomes (pre ef4) 0.6993 141 186
5a9y-assembly1.cif.gz_A-2 structure of ppgpp bipa 0.6968 140 186
4f9p-assembly1.cif.gz_B crystal structure of the human btn3a1 ectodomain in complex with the 103.2 single chain antibody 0.672 165 188
4f9p-assembly1.cif.gz_A crystal structure of the human btn3a1 ectodomain in complex with the 103.2 single chain antibody 0.6716 165 188
ID Description Score Start End Superfamily
af_F7FH45_6_315_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7289 162 185 1.10.510.10
af_Q96PN8_4_268_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.72 162 185 1.10.510.10
af_B0G189_453_564_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7001 143 186 3.30.70.240
af_A0A2R8QSU7_595_766_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.6991 167 187 3.30.980.10
af_P9WK97_418_527_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6857 141 186 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A6G9YDQ8-F1-model_v4 Dihydrofolate reductase 0.8001 49 187 GO:0008703
GO:0009231
AF-A0A2W1K4Y4-F1-model_v4 Dihydrofolate reductase 0.7973 40 187 GO:0008703
GO:0009231
AF-A0A1Q7TPW9-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.7921 40 188 GO:0008703
GO:0009231
AF-A0A7V9JGY0-F1-model_v4 Dihydrofolate reductase family protein 0.7921 49 188 GO:0008703
GO:0009231
AF-A0A3N5KVN4-F1-model_v4 Dihydrofolate reductase 0.789 36 188 GO:0008703
GO:0009231

Map