F438308

General Info

Members Datasets Scaffolds Average Seq Length
414 228 414 192

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10002119|Ga0105245_1000211914
Length 240
Sequence MRRAGADRSTLRYDAIRTILRRQAIRVNDDRWRYPPSVPPVRVDPKKVREFEDEAAFYAWLTKHAASADEVWIKIHKVRSGKRSITPAEAIDVVLCWGWIDGIRKGFDEHSFLQRYCPRGKKSVWSEINVANVARLTKAGKMQPAGLAQVEAAKADGRWAKAYRMKKNEAPADLMAAIEASPKARAMYATLSAQNRFSLTFRTTSLKTEEGRKKKIRAFVEMLERGETIYPNGKGSTSRK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
106 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
182 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
226 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
227 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
228 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 10.63
Rhizosphere 82.61
Stem 0
Stem Tuber 0
Unclassified 4.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003221 3300001979 Bacteria 7201
2 Ga0070683_100002905 3300005329 Bacteria 13726
3 Ga0070683_100007526 3300005329 Bacteria 9206
4 Ga0070683_100009855 3300005329 Bacteria 8188
5 Ga0070683_100482347 3300005329 Bacteria 1184
6 Ga0070683_100651088 3300005329 Bacteria 1009
7 Ga0070666_10074428 3300005335 Bacteria 2315
8 Ga0070682_100000009 3300005337 Bacteria 291635
9 Ga0068868_100004415 3300005338 Bacteria 9862
10 Ga0070689_100270259 3300005340 Bacteria 1407
11 Ga0070687_100193912 3300005343 Bacteria 1226
12 Ga0070661_100000255 3300005344 Bacteria 43552
13 Ga0070661_100428572 3300005344 Unclassified 1049
14 Ga0070668_100454064 3300005347 Bacteria 1102
15 Ga0070669_100027471 3300005353 Bacteria 4095
16 Ga0070675_100000196 3300005354 Bacteria 38134
17 Ga0070674_100000001 3300005356 Bacteria 277173
18 Ga0070674_100018561 3300005356 Bacteria 4400
19 Ga0070688_100000732 3300005365 Bacteria 16204
20 Ga0070688_100000747 3300005365 Bacteria 16013
21 Ga0070688_100590190 3300005365 Bacteria 849
22 Ga0070667_100020328 3300005367 Bacteria 5511
23 Ga0070667_100057522 3300005367 Bacteria 3287
24 Ga0070667_100269900 3300005367 Bacteria 1525
25 Ga0070714_100023861 3300005435 Bacteria 5031
26 Ga0070714_100421754 3300005435 Bacteria 1264
27 Ga0070713_100073917 3300005436 Bacteria 2887
28 Ga0070710_10210494 3300005437 Bacteria 1232
29 Ga0070663_100087080 3300005455 Bacteria 2308
30 Ga0070678_100087460 3300005456 Bacteria 2380
31 Ga0070678_100346534 3300005456 Bacteria 1276
32 Ga0070685_10000191 3300005466 Bacteria 41016
33 Ga0070685_10001568 3300005466 Bacteria 12047
34 Ga0070685_10050754 3300005466 Bacteria 2397
35 Ga0070685_10103752 3300005466 Bacteria 1740
36 Ga0070679_100027963 3300005530 Bacteria 5556
37 Ga0070684_100005142 3300005535 Bacteria 10001
38 Ga0070684_100020700 3300005535 Bacteria 5457
39 Ga0070684_100286729 3300005535 Unclassified 1509
40 Ga0070684_100604092 3300005535 Bacteria 1020
41 Ga0070672_100001124 3300005543 Bacteria 16332
42 Ga0070665_100000022 3300005548 Bacteria 379286
43 Ga0070665_100018209 3300005548 Bacteria 7045
44 Ga0070665_100056076 3300005548 Bacteria 3951
45 Ga0070665_100248110 3300005548 Bacteria 1781
46 Ga0070665_100521002 3300005548 Bacteria 1200
47 Ga0070704_100576497 3300005549 Bacteria 986
48 Ga0070664_100022844 3300005564 Bacteria 5160
49 Ga0070664_100037281 3300005564 Bacteria 4087
50 Ga0068854_100000267 3300005578 Bacteria 35526
51 Ga0068856_100001040 3300005614 Bacteria 29492
52 Ga0068856_100020478 3300005614 Bacteria 6425
53 Ga0068856_100305108 3300005614 Bacteria 1610
54 Ga0068856_100442069 3300005614 Bacteria 1321
55 Ga0070702_100092698 3300005615 Bacteria 1835
56 Ga0070702_100381127 3300005615 Bacteria 1003
57 Ga0068864_100673429 3300005618 Bacteria 1009
58 Ga0068866_10000140 3300005718 Bacteria 32464
59 Ga0068866_10002382 3300005718 Bacteria 7793
60 Ga0068866_10243572 3300005718 Bacteria 1096
61 Ga0068861_100126814 3300005719 Bacteria 2066
62 Ga0068861_100836327 3300005719 Bacteria 867
63 Ga0068851_10000258 3300005834 Bacteria 25137
64 Ga0068851_10001500 3300005834 Bacteria 10232
65 Ga0068870_10111610 3300005840 Bacteria 1562
66 Ga0068863_100000050 3300005841 Bacteria 130200
67 Ga0068863_100017941 3300005841 Bacteria 6773
68 Ga0068858_100000017 3300005842 Bacteria 186913
69 Ga0068858_100000264 3300005842 Bacteria 55994
70 Ga0068858_100285904 3300005842 Bacteria 1571
71 Ga0081540_1000181 3300005983 Bacteria 65791
72 Ga0081540_1078676 3300005983 Bacteria 1493
73 Ga0081539_10001515 3300005985 Bacteria 39009
74 Ga0070717_10000024 3300006028 Bacteria 158890
75 Ga0075363_100279945 3300006048 Bacteria 965
76 Ga0070716_100351870 3300006173 Bacteria 1043
77 Ga0070712_100004518 3300006175 Bacteria 8592
78 Ga0097621_100125702 3300006237 Bacteria 2178
79 Ga0097621_100337548 3300006237 Bacteria 1337
80 Ga0075370_10215331 3300006353 Bacteria 1134
81 Ga0068871_100494950 3300006358 Unclassified 1101
82 Ga0075430_100260358 3300006846 Bacteria 1437
83 Ga0075429_100002516 3300006880 Bacteria 15436
84 Ga0105240_11184737 3300009093 Bacteria 810
85 Ga0105245_10002119 3300009098 Bacteria 17969
86 Ga0105245_10004280 3300009098 Bacteria 12655
87 Ga0105245_10004472 3300009098 Bacteria 12358
88 Ga0105245_10203875 3300009098 Bacteria 1901
89 Ga0105247_10185294 3300009101 Unclassified 1391
90 Ga0105243_10324238 3300009148 Bacteria 1405
91 Ga0105243_10679184 3300009148 Bacteria 1001
92 Ga0105243_10812774 3300009148 Bacteria 922
93 Ga0105243_11071452 3300009148 Bacteria 813
94 Ga0105241_10528325 3300009174 Bacteria 1056
95 Ga0105242_10001159 3300009176 Bacteria 20774
96 Ga0105242_10004096 3300009176 Bacteria 11332
97 Ga0105242_10111031 3300009176 Bacteria 2337
98 Ga0105242_10451268 3300009176 Bacteria 1212
99 Ga0105248_10738912 3300009177 Bacteria 1110
100 Ga0105237_10557050 3300009545 Bacteria 1153
101 Ga0105238_10000016 3300009551 Bacteria 236218
102 Ga0105238_10000042 3300009551 Bacteria 154892
103 Ga0105238_10113184 3300009551 Bacteria 2693
104 Ga0105249_10304391 3300009553 Bacteria 1600
105 Ga0105249_10331299 3300009553 Bacteria 1536
106 Ga0105249_10393357 3300009553 Bacteria 1415
107 Ga0105249_10473246 3300009553 Bacteria 1294
108 Ga0105239_10046940 3300010375 Bacteria 4732
109 Ga0105239_10056461 3300010375 Bacteria 4307
110 Ga0105239_10633691 3300010375 Bacteria 1220
111 Ga0105239_10854217 3300010375 Bacteria 1044
112 Ga0105246_10007179 3300011119 Bacteria 6824
113 Ga0105246_10194546 3300011119 Bacteria 1572
114 Ga0157370_10015334 3300013104 Bacteria 7794
115 Ga0157370_10145645 3300013104 Bacteria 2206
116 Ga0157374_10002416 3300013296 Bacteria 15758
117 Ga0157378_10001452 3300013297 Bacteria 21356
118 Ga0157378_10949005 3300013297 Unclassified 893
119 Ga0157372_10000407 3300013307 Bacteria 47331
120 Ga0157375_10001744 3300013308 Bacteria 18673
121 Ga0157375_10264812 3300013308 Bacteria 1880
122 Ga0157375_11330234 3300013308 Bacteria 845
123 Ga0163163_10110669 3300014325 Bacteria 2775
124 Ga0163163_11195709 3300014325 Bacteria 823
125 Ga0157376_10008390 3300014969 Bacteria 7453
126 Ga0157376_10078500 3300014969 Bacteria 2827
127 Ga0157376_10079603 3300014969 Bacteria 2809
128 Ga0157376_10181784 3300014969 Bacteria 1923
129 Ga0163161_10000103 3300017792 Bacteria 81496
130 Ga0163161_10029462 3300017792 Bacteria 3903
131 Ga0163161_10218689 3300017792 Bacteria 1474
132 Ga0206352_10198084 3300020078 Bacteria 1556
133 Ga0207656_10001236 3300025321 Bacteria 8446
134 Ga0207692_10176486 3300025898 Bacteria 1242
135 Ga0207642_10000066 3300025899 Bacteria 28858
136 Ga0207680_10042076 3300025903 Bacteria 2670
137 Ga0207680_10051824 3300025903 Bacteria 2456
138 Ga0207643_10103282 3300025908 Bacteria 1673
139 Ga0207693_10008063 3300025915 Bacteria 8639
140 Ga0207663_10353044 3300025916 Bacteria 1114
141 Ga0207649_10000015 3300025920 Bacteria 245662
142 Ga0207681_10008854 3300025923 Bacteria 6149
143 Ga0207694_10000012 3300025924 Bacteria 411218
144 Ga0207694_10004692 3300025924 Bacteria 10637
145 Ga0207659_10000268 3300025926 Bacteria 31760
146 Ga0207687_10000029 3300025927 Bacteria 156754
147 Ga0207687_10001665 3300025927 Bacteria 15338
148 Ga0207687_10002421 3300025927 Bacteria 12660
149 Ga0207687_10151100 3300025927 Bacteria 1772
150 Ga0207700_10111067 3300025928 Bacteria 2206
151 Ga0207686_10000035 3300025934 Bacteria 130483
152 Ga0207686_10002926 3300025934 Bacteria 9198
153 Ga0207709_10015199 3300025935 Bacteria 4267
154 Ga0207670_10215111 3300025936 Bacteria 1468
155 Ga0207669_10000002 3300025937 Bacteria 377651
156 Ga0207669_10148526 3300025937 Bacteria 1638
157 Ga0207691_10000286 3300025940 Bacteria 49918
158 Ga0207711_10186410 3300025941 Bacteria 1889
159 Ga0207661_10000446 3300025944 Bacteria 26544
160 Ga0207661_10000545 3300025944 Bacteria 24110
161 Ga0207661_10001203 3300025944 Bacteria 17323
162 Ga0207661_10361664 3300025944 Bacteria 1311
163 Ga0207661_10370135 3300025944 Bacteria 1295
164 Ga0207679_10056029 3300025945 Bacteria 2909
165 Ga0207712_10382511 3300025961 Bacteria 1178
166 Ga0207668_10210411 3300025972 Bacteria 1555
167 Ga0207640_10000669 3300025981 Bacteria 19997
168 Ga0207658_10020919 3300025986 Bacteria 4534
169 Ga0207658_10246055 3300025986 Bacteria 1517
170 Ga0207677_10006059 3300026023 Bacteria 6594
171 Ga0207703_10000030 3300026035 Bacteria 199014
172 Ga0207703_10001272 3300026035 Bacteria 23450
173 Ga0207639_10001685 3300026041 Bacteria 14908
174 Ga0207678_10105227 3300026067 Bacteria 2408
175 Ga0207702_10000349 3300026078 Bacteria 52941
176 Ga0207702_10018183 3300026078 Bacteria 5815
177 Ga0207641_10000295 3300026088 Bacteria 62363
178 Ga0207641_10002521 3300026088 Bacteria 16875
179 Ga0207648_10253185 3300026089 Bacteria 1570
180 Ga0207675_100161198 3300026118 Bacteria 2139
181 Ga0207675_100898783 3300026118 Bacteria 902
182 Ga0207683_10462296 3300026121 Bacteria 1170
183 Ga0207698_10092093 3300026142 Bacteria 2484
184 Ga0268266_10000029 3300028379 Bacteria 424015
185 Ga0268266_10012516 3300028379 Bacteria 7332
186 Ga0268266_10040485 3300028379 Bacteria 3971
187 Ga0268266_10048164 3300028379 Bacteria 3652
188 Ga0268266_10074850 3300028379 Bacteria 2941
189 Ga0268266_10196294 3300028379 Bacteria 1845
190 Ga0265337_1002592 3300028556 Bacteria 8185
191 Ga0265326_10000004 3300028558 Bacteria 283947
192 Ga0265326_10000056 3300028558 Bacteria 64840
193 Ga0265319_1000519 3300028563 Bacteria 26557
194 Ga0265319_1064995 3300028563 Unclassified 1177
195 Ga0265334_10000282 3300028573 Bacteria 28726
196 Ga0265334_10007239 3300028573 Bacteria 4759
197 Ga0265334_10036564 3300028573 Bacteria 1939
198 Ga0265322_10000017 3300028654 Bacteria 114833
199 Ga0265322_10068171 3300028654 Bacteria 1009
200 Ga0265336_10005846 3300028666 Bacteria 4496
201 Ga0265336_10012401 3300028666 Bacteria 2869
202 Ga0265338_10010436 3300028800 Bacteria 10890
203 Ga0265338_10057089 3300028800 Bacteria 3456
204 Ga0265338_10175400 3300028800 Bacteria 1639
205 Ga0265324_10001576 3300029957 Bacteria 12700
206 Ga0265324_10001639 3300029957 Bacteria 12385
207 Ga0307511_10033723 3300030521 Bacteria 4512
208 Ga0265328_10000258 3300031239 Bacteria 24453
209 Ga0265320_10000068 3300031240 Bacteria 91884
210 Ga0265329_10022632 3300031242 Bacteria 2100
211 Ga0265340_10024974 3300031247 Bacteria 3031
212 Ga0265339_10023454 3300031249 Bacteria 3566
213 Ga0265331_10005995 3300031250 Bacteria 7252
214 Ga0265327_10000317 3300031251 Bacteria 92215
215 Ga0265316_10127295 3300031344 Unclassified 1920
216 Ga0265314_10000973 3300031711 Bacteria 33669
217 Ga0307409_100621473 3300031995 Bacteria 1070
218 Ga0307416_100334954 3300032002 Bacteria 1523
219 Ga0307414_10103935 3300032004 Bacteria 2145
220 Ga0316583_10091366 3300032133 Unclassified 1062
221 Ga0316583_10190719 3300032133 Bacteria 712
222 Ga0373941_0200505 3300035115 Bacteria 758
223 Ga0373937_0108186 3300036401 Bacteria 2585
224 Ga0451807_1812949 3300041486 Bacteria 1190
225 Ga0451849_0524938 3300041505 Bacteria 884
226 Ga0451853_1791680 3300041512 Bacteria 1214
227 Ga0451853_1849497 3300041512 Unclassified 1188
228 Ga0466963_0000051 3300044694 Bacteria 39254
229 Ga0466963_0038439 3300044694 Bacteria 3129
230 Ga0466964_0063212 3300044706 Bacteria 1545
231 Ga0466957_0021230 3300044842 Bacteria 3825
232 Ga0466957_0496862 3300044842 Bacteria 845
233 Ga0466958_0046114 3300045836 Bacteria 2630
234 Ga0466958_0054524 3300045836 Bacteria 2425
235 Ga0466967_0000013 3300045976 Bacteria 103249
236 Ga0466967_0013883 3300045976 Bacteria 6247
237 Ga0495592_0000608 3300046454 Bacteria 25303
238 Ga0495592_0104771 3300046454 Bacteria 2010
239 Ga0495592_0239674 3300046454 Bacteria 1204
240 Ga0495603_0002488 3300046455 Bacteria 10843
241 Ga0495629_0000201 3300046459 Bacteria 53022
242 Ga0495629_0003016 3300046459 Bacteria 12813
243 Ga0495629_0021272 3300046459 Bacteria 4629
244 Ga0495629_0162696 3300046459 Bacteria 1550
245 Ga0495629_0165119 3300046459 Bacteria 1537
246 Ga0495638_0032677 3300046460 Bacteria 3333
247 Ga0495641_0000010 3300046461 Bacteria 158798
248 Ga0495641_0017705 3300046461 Bacteria 3702
249 Ga0495641_0140678 3300046461 Unclassified 1078
250 Ga0495651_0323948 3300046462 Bacteria 1026
251 Ga0495653_0116448 3300046463 Bacteria 1911
252 Ga0495653_0138272 3300046463 Bacteria 1716
253 Ga0495639_0218482 3300046475 Bacteria 936
254 Ga0495662_0000162 3300046476 Bacteria 26288
255 Ga0495662_0059704 3300046476 Bacteria 1842
256 Ga0495664_0215842 3300046477 Unclassified 1162
257 Ga0495594_0000001 3300046499 Bacteria 293051
258 Ga0495606_0000886 3300046507 Bacteria 44754
259 Ga0495608_0000042 3300046511 Bacteria 115906
260 Ga0495608_0002177 3300046511 Bacteria 14130
261 Ga0495608_0009896 3300046511 Bacteria 6655
262 Ga0495608_0180253 3300046511 Bacteria 1336
263 Ga0495610_0022450 3300046512 Bacteria 3452
264 Ga0495618_0000051 3300046514 Bacteria 87668
265 Ga0495620_0000154 3300046515 Bacteria 55875
266 Ga0495628_0007286 3300046516 Bacteria 9588
267 Ga0495628_0315567 3300046516 Bacteria 1154
268 Ga0495628_0357981 3300046516 Bacteria 1072
269 Ga0495628_0464451 3300046516 Bacteria 918
270 Ga0495630_0000027 3300046517 Bacteria 146589
271 Ga0495630_0002919 3300046517 Bacteria 11886
272 Ga0495630_0283729 3300046517 Bacteria 1265
273 Ga0495630_0341856 3300046517 Bacteria 1145
274 Ga0495652_0000009 3300046529 Bacteria 311000
275 Ga0495652_0057369 3300046529 Bacteria 3302
276 Ga0495640_0004849 3300046533 Bacteria 10709
277 Ga0495640_0229327 3300046533 Bacteria 1168
278 Ga0495586_0001516 3300046535 Bacteria 12833
279 Ga0495587_0030082 3300046536 Bacteria 3294
280 Ga0495645_0044617 3300046543 Bacteria 3233
281 Ga0495645_0125939 3300046543 Bacteria 1800
282 Ga0495667_0000019 3300046559 Bacteria 181645
283 Ga0495667_0098767 3300046559 Bacteria 1890
284 Ga0495634_0009818 3300046642 Bacteria 7042
285 Ga0495634_0320034 3300046642 Bacteria 934
286 Ga0495625_0000552 3300046660 Bacteria 54805
287 Ga0495635_0000017 3300046663 Bacteria 195506
288 Ga0495635_0090637 3300046663 Bacteria 2091
289 Ga0495588_0000204 3300046674 Bacteria 58892
290 Ga0495657_0000040 3300046675 Bacteria 115899
291 Ga0495657_0160450 3300046675 Bacteria 1391
292 Ga0495599_0047678 3300046678 Bacteria 2685
293 Ga0495623_0101793 3300046679 Bacteria 1750
294 Ga0495647_0000002 3300046681 Bacteria 174959
295 Ga0495647_0001521 3300046681 Bacteria 7160
296 Ga0495647_0002156 3300046681 Bacteria 6153
297 Ga0495647_0008668 3300046681 Bacteria 3423
298 Ga0495658_0020343 3300046683 Bacteria 3481
299 Ga0495669_0020208 3300046684 Bacteria 2880
300 Ga0495613_0000067 3300046689 Bacteria 101960
301 Ga0495613_0435408 3300046689 Bacteria 890
302 Ga0495624_0000005 3300046690 Bacteria 158127
303 Ga0495624_0000200 3300046690 Bacteria 45997
304 Ga0495624_0042888 3300046690 Bacteria 2889
305 Ga0495624_0437445 3300046690 Bacteria 784
306 Ga0495649_0002389 3300046694 Bacteria 13275
307 Ga0495600_0000376 3300046809 Bacteria 23258
308 Ga0495600_0102444 3300046809 Bacteria 1866
309 Ga0495604_0000252 3300047317 Bacteria 47517
310 Ga0495604_0007756 3300047317 Bacteria 8500
311 Ga0495674_0000024 3300047319 Bacteria 141746
312 Ga0495672_0054120 3300047320 Bacteria 2348
313 Ga0495672_0301401 3300047320 Unclassified 759
314 Ga0495676_0002393 3300047321 Bacteria 16657
315 Ga0495680_0001106 3300047322 Bacteria 29781
316 Ga0495680_0001118 3300047322 Bacteria 29611
317 Ga0495680_0026277 3300047322 Bacteria 4803
318 Ga0495675_0000036 3300047444 Bacteria 91842
319 Ga0495675_0028215 3300047444 Bacteria 3579
320 Ga0495679_050687 3300047446 Bacteria 1247
321 Ga0495685_037363 3300047447 Bacteria 1665
322 Ga0495593_0004902 3300047673 Bacteria 7938
323 Ga0495602_0000268 3300048088 Bacteria 47860
324 Ga0495602_0115346 3300048088 Bacteria 2173
325 Ga0496100_0000019 3300048903 Bacteria 149995
326 Ga0496100_0285326 3300048903 Bacteria 1232
327 Ga0496101_0000005 3300048904 Bacteria 331455
328 Ga0496102_0000021 3300048905 Bacteria 246920
329 Ga0496102_0111300 3300048905 Bacteria 2553
330 Ga0496103_0000001 3300048906 Bacteria 643471
331 Ga0496104_0011058 3300048907 Bacteria 8075
332 Ga0496104_0037124 3300048907 Bacteria 4556
333 Ga0496104_0416280 3300048907 Bacteria 1256
334 Ga0496105_0085221 3300048908 Bacteria 2610
335 Ga0496106_0000033 3300048909 Bacteria 131412
336 Ga0496106_0000107 3300048909 Bacteria 64689
337 Ga0496106_0454762 3300048909 Bacteria 1029
338 Ga0496107_0000004 3300048910 Bacteria 297680
339 Ga0496107_0080499 3300048910 Bacteria 2375
340 Ga0496107_0788754 3300048910 Bacteria 696
341 Ga0496108_0000239 3300048911 Bacteria 49308
342 Ga0496108_0015057 3300048911 Bacteria 6314
343 Ga0496108_0057482 3300048911 Bacteria 3268
344 Ga0496108_0140637 3300048911 Bacteria 2079
345 Ga0496109_0000011 3300048912 Bacteria 234908
346 Ga0496109_0000034 3300048912 Bacteria 160397
347 Ga0496109_0000369 3300048912 Bacteria 41635
348 Ga0496109_0108609 3300048912 Bacteria 2579
349 Ga0496109_0117349 3300048912 Bacteria 2477
350 Ga0496109_0906761 3300048912 Bacteria 819
351 Ga0496110_0000171 3300048913 Bacteria 39922
352 Ga0496110_0007249 3300048913 Bacteria 8839
353 Ga0496111_0000020 3300048914 Bacteria 67992
354 Ga0496111_0029528 3300048914 Bacteria 3895
355 Ga0496112_0000641 3300048915 Bacteria 24272
356 Ga0496112_0185344 3300048915 Bacteria 2045
357 Ga0496113_0000002 3300048916 Bacteria 220193
358 Ga0496113_0001044 3300048916 Bacteria 14929
359 Ga0496113_0008425 3300048916 Bacteria 6718
360 Ga0496114_0000003 3300048917 Bacteria 630981
361 Ga0496114_0041947 3300048917 Bacteria 3792
362 Ga0496114_0145399 3300048917 Bacteria 2055
363 Ga0496114_0486774 3300048917 Bacteria 1091
364 Ga0496114_0791451 3300048917 Bacteria 827
365 Ga0496115_0000022 3300048918 Bacteria 164224
366 Ga0496115_0000027 3300048918 Bacteria 145505
367 Ga0496115_0222187 3300048918 Bacteria 1559
368 Ga0496116_0000138 3300048919 Bacteria 151606
369 Ga0496117_0108013 3300048920 Bacteria 1741
370 Ga0496118_0005655 3300048921 Bacteria 14094
371 Ga0496118_0100237 3300048921 Bacteria 1960
372 Ga0496119_0004108 3300048922 Bacteria 14674
373 Ga0496119_0005578 3300048922 Bacteria 11970
374 Ga0496119_0017543 3300048922 Bacteria 5379
375 Ga0496120_0001479 3300048923 Bacteria 27945
376 Ga0496121_0059734 3300048924 Bacteria 3142
377 Ga0496121_0150338 3300048924 Bacteria 1714
378 Ga0496121_0271988 3300048924 Bacteria 1164
379 Ga0496124_0089112 3300048927 Bacteria 2520
380 Ga0496124_0134362 3300048927 Bacteria 1961
381 Ga0496125_0112497 3300048928 Bacteria 1967
382 Ga0496126_0006956 3300048929 Bacteria 12515
383 Ga0496126_0067671 3300048929 Bacteria 3191
384 Ga0501042_0019694 3300049578 Bacteria 4690
385 Ga0501042_0045762 3300049578 Bacteria 3119
386 Ga0501047_0002300 3300049581 Bacteria 18279
387 Ga0501047_0522238 3300049581 Bacteria 1013
388 Ga0501070_0024812 3300049586 Bacteria 5028
389 Ga0501074_0666780 3300049590 Bacteria 734
390 Ga0501083_0006427 3300049744 Bacteria 8334
391 Ga0501083_0063827 3300049744 Bacteria 2456
392 nmdc:mga0k408_358191_c1 3300050493 Bacteria 869
393 nmdc:mga09592_9040_c1 3300050508 Bacteria 8098
394 nmdc:mga0qj67_543923_c1 3300050509 Bacteria 932
395 nmdc:mga08y16_375625_c1 3300050511 Bacteria 1457
396 nmdc:mga08y16_76258_c1 3300050511 Bacteria 3494
397 nmdc:mga08x19_54363_c1 3300050514 Bacteria 2577
398 Ga0495601_0000231 3300053077 Bacteria 30020
399 Ga0495601_0021535 3300053077 Bacteria 3949
400 Ga0495612_0000279 3300053078 Bacteria 21043
401 Ga0495612_0014712 3300053078 Bacteria 3142
402 Ga0495612_0051813 3300053078 Bacteria 1688
403 Ga0495655_0000008 3300053083 Bacteria 153535
404 Ga0495655_0001411 3300053083 Bacteria 3686
405 Ga0495595_0000009 3300053084 Bacteria 193039
406 Ga0495595_0002276 3300053084 Bacteria 7467
407 Ga0495595_0027605 3300053084 Bacteria 2530
408 Ga0495619_0000022 3300053085 Bacteria 184144
409 Ga0495619_0000057 3300053085 Bacteria 93948
410 Ga0500566_0180756 3300053094 Bacteria 1082
411 Ga0500595_038781 3300053119 Bacteria 1546
412 Ga0500595_048224 3300053119 Unclassified 1331
413 Ga0500614_000060 3300053123 Bacteria 23367
414 Ga0500628_000023 3300053129 Bacteria 77818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028558 Ga0265326_10000004 Ga0265326_1000000429 168
2 3300028573 Ga0265334_10000282 Ga0265334_100002822 168
3 3300028666 Ga0265336_10005846 Ga0265336_100058462 168
4 3300028800 Ga0265338_10010436 Ga0265338_100104368 168
5 3300029957 Ga0265324_10001576 Ga0265324_100015762 168
6 3300031247 Ga0265340_10024974 Ga0265340_100249742 168
7 3300028573 Ga0265334_10036564 Ga0265334_100365642 175
8 3300028800 Ga0265338_10057089 Ga0265338_100570892 175
9 3300005329 Ga0070683_100482347 Ga0070683_1004823472 177
10 3300005367 Ga0070667_100020328 Ga0070667_1000203283 177
11 3300005548 Ga0070665_100056076 Ga0070665_1000560764 177
12 3300005564 Ga0070664_100037281 Ga0070664_1000372815 177
13 3300014325 Ga0163163_10110669 Ga0163163_101106694 177
14 3300025903 Ga0207680_10042076 Ga0207680_100420763 177
15 3300025944 Ga0207661_10370135 Ga0207661_103701352 177
16 3300025986 Ga0207658_10020919 Ga0207658_100209193 177
17 3300028379 Ga0268266_10040485 Ga0268266_100404854 177
18 3300048927 Ga0496124_0089112 Ga0496124_0089112_618_1193 177
19 3300048929 Ga0496126_0067671 Ga0496126_0067671_1918_2493 177
20 3300046454 Ga0495592_0104771 Ga0495592_0104771_934_1491 182
21 3300046516 Ga0495628_0315567 Ga0495628_0315567_303_860 182
22 3300046529 Ga0495652_0057369 Ga0495652_0057369_393_950 182
23 3300046543 Ga0495645_0044617 Ga0495645_0044617_1200_1757 182
24 3300006048 Ga0075363_100279945 Ga0075363_1002799452 184
25 3300031995 Ga0307409_100621473 Ga0307409_1006214732 184
26 3300032002 Ga0307416_100334954 Ga0307416_1003349542 184
27 3300032004 Ga0307414_10103935 Ga0307414_101039351 184
28 3300009551 Ga0105238_10000042 Ga0105238_1000004257 185
29 3300025924 Ga0207694_10004692 Ga0207694_1000469211 185
30 3300005344 Ga0070661_100428572 Ga0070661_1004285722 186
31 3300005356 Ga0070674_100018561 Ga0070674_1000185613 186
32 3300005535 Ga0070684_100286729 Ga0070684_1002867292 186
33 3300006358 Ga0068871_100494950 Ga0068871_1004949501 186
34 3300025937 Ga0207669_10148526 Ga0207669_101485262 186
35 3300046476 Ga0495662_0059704 Ga0495662_0059704_252_821 186
36 3300046642 Ga0495634_0009818 Ga0495634_0009818_3064_3633 186
37 3300046684 Ga0495669_0020208 Ga0495669_0020208_1449_2018 186
38 3300048912 Ga0496109_0906761 Ga0496109_0906761_47_616 186
39 3300048915 Ga0496112_0185344 Ga0496112_0185344_1363_1932 186
40 3300048916 Ga0496113_0001044 Ga0496113_0001044_9242_9811 186
41 3300053078 Ga0495612_0014712 Ga0495612_0014712_1207_1770 187
42 3300006353 Ga0075370_10215331 Ga0075370_102153312 189
43 3300014325 Ga0163163_11195709 Ga0163163_111957092 189
44 3300044706 Ga0466964_0063212 Ga0466964_0063212_218_787 189
45 3300044842 Ga0466957_0021230 Ga0466957_0021230_861_1430 189
46 3300045836 Ga0466958_0054524 Ga0466958_0054524_540_1109 189
47 3300045976 Ga0466967_0013883 Ga0466967_0013883_3781_4350 189
48 3300048907 Ga0496104_0416280 Ga0496104_0416280_505_1119 189
49 3300048917 Ga0496114_0145399 Ga0496114_0145399_329_943 189
50 3300050493 nmdc:mga0k408_358191_c1 nmdc:mga0k408_358191_c1_38_658 189
51 3300050511 nmdc:mga08y16_76258_c1 nmdc:mga08y16_76258_c1_2372_2992 189
52 3300005329 Ga0070683_100007526 Ga0070683_1000075265 190
53 3300005365 Ga0070688_100000747 Ga0070688_1000007475 190
54 3300005435 Ga0070714_100421754 Ga0070714_1004217542 190
55 3300005437 Ga0070710_10210494 Ga0070710_102104942 190
56 3300005466 Ga0070685_10001568 Ga0070685_100015688 190
57 3300005535 Ga0070684_100020700 Ga0070684_1000207003 190
58 3300005834 Ga0068851_10001500 Ga0068851_100015006 190
59 3300005985 Ga0081539_10001515 Ga0081539_100015152 190
60 3300006028 Ga0070717_10000024 Ga0070717_10000024155 190
61 3300009551 Ga0105238_10000016 Ga0105238_1000001696 190
62 3300014969 Ga0157376_10008390 Ga0157376_100083903 190
63 3300025898 Ga0207692_10176486 Ga0207692_101764862 190
64 3300025924 Ga0207694_10000012 Ga0207694_10000012325 190
65 3300025944 Ga0207661_10000545 Ga0207661_1000054512 190
66 3300028556 Ga0265337_1002592 Ga0265337_10025926 190
67 3300028558 Ga0265326_10000056 Ga0265326_100000569 190
68 3300028563 Ga0265319_1000519 Ga0265319_100051923 190
69 3300028563 Ga0265319_1064995 Ga0265319_10649951 190
70 3300028654 Ga0265322_10000017 Ga0265322_1000001755 190
71 3300028666 Ga0265336_10012401 Ga0265336_100124012 190
72 3300028800 Ga0265338_10175400 Ga0265338_101754002 190
73 3300029957 Ga0265324_10001639 Ga0265324_100016396 190
74 3300030521 Ga0307511_10033723 Ga0307511_100337233 190
75 3300031239 Ga0265328_10000258 Ga0265328_1000025817 190
76 3300031240 Ga0265320_10000068 Ga0265320_1000006869 190
77 3300031242 Ga0265329_10022632 Ga0265329_100226322 190
78 3300031249 Ga0265339_10023454 Ga0265339_100234544 190
79 3300031250 Ga0265331_10005995 Ga0265331_100059956 190
80 3300031251 Ga0265327_10000317 Ga0265327_1000031769 190
81 3300031344 Ga0265316_10127295 Ga0265316_101272952 190
82 3300031711 Ga0265314_10000973 Ga0265314_1000097325 190
83 3300041505 Ga0451849_0524938 Ga0451849_0524938_136_708 190
84 3300045976 Ga0466967_0000013 Ga0466967_0000013_41504_42076 190
85 3300046459 Ga0495629_0021272 Ga0495629_0021272_2639_3211 190
86 3300046461 Ga0495641_0140678 Ga0495641_0140678_232_804 190
87 3300046507 Ga0495606_0000886 Ga0495606_0000886_27193_27765 190
88 3300046517 Ga0495630_0283729 Ga0495630_0283729_369_941 190
89 3300046533 Ga0495640_0004849 Ga0495640_0004849_5099_5671 190
90 3300046536 Ga0495587_0030082 Ga0495587_0030082_398_970 190
91 3300046559 Ga0495667_0000019 Ga0495667_0000019_63549_64121 190
92 3300046681 Ga0495647_0001521 Ga0495647_0001521_6521_7093 190
93 3300047317 Ga0495604_0000252 Ga0495604_0000252_10918_11490 190
94 3300047319 Ga0495674_0000024 Ga0495674_0000024_104414_104986 190
95 3300047322 Ga0495680_0001106 Ga0495680_0001106_24249_24821 190
96 3300047322 Ga0495680_0026277 Ga0495680_0026277_3310_3882 190
97 3300048903 Ga0496100_0000019 Ga0496100_0000019_105047_105619 190
98 3300048904 Ga0496101_0000005 Ga0496101_0000005_105047_105619 190
99 3300048909 Ga0496106_0000033 Ga0496106_0000033_55036_55608 190
100 3300048910 Ga0496107_0000004 Ga0496107_0000004_105264_105836 190
101 3300048913 Ga0496110_0007249 Ga0496110_0007249_7831_8403 190
102 3300048917 Ga0496114_0000003 Ga0496114_0000003_285271_285930 190
103 3300048917 Ga0496114_0486774 Ga0496114_0486774_25_597 190
104 3300048917 Ga0496114_0791451 Ga0496114_0791451_81_653 190
105 3300048918 Ga0496115_0000027 Ga0496115_0000027_11557_12216 190
106 3300048918 Ga0496115_0222187 Ga0496115_0222187_890_1462 190
107 3300048927 Ga0496124_0134362 Ga0496124_0134362_761_1333 190
108 3300048929 Ga0496126_0006956 Ga0496126_0006956_2949_3521 190
109 3300050514 nmdc:mga08x19_54363_c1 nmdc:mga08x19_54363_c1_64_636 190
110 3300005329 Ga0070683_100002905 Ga0070683_10000290514 191
111 3300005329 Ga0070683_100009855 Ga0070683_1000098556 191
112 3300005335 Ga0070666_10074428 Ga0070666_100744284 191
113 3300005337 Ga0070682_100000009 Ga0070682_100000009126 191
114 3300005343 Ga0070687_100193912 Ga0070687_1001939122 191
115 3300005353 Ga0070669_100027471 Ga0070669_1000274712 191
116 3300005356 Ga0070674_100000001 Ga0070674_100000001283 191
117 3300005367 Ga0070667_100057522 Ga0070667_1000575222 191
118 3300005367 Ga0070667_100269900 Ga0070667_1002699002 191
119 3300005435 Ga0070714_100023861 Ga0070714_1000238613 191
120 3300005455 Ga0070663_100087080 Ga0070663_1000870802 191
121 3300005456 Ga0070678_100087460 Ga0070678_1000874602 191
122 3300005466 Ga0070685_10103752 Ga0070685_101037522 191
123 3300005535 Ga0070684_100005142 Ga0070684_1000051422 191
124 3300005543 Ga0070672_100001124 Ga0070672_1000011244 191
125 3300005548 Ga0070665_100000022 Ga0070665_100000022228 191
126 3300005548 Ga0070665_100018209 Ga0070665_1000182095 191
127 3300005548 Ga0070665_100248110 Ga0070665_1002481102 191
128 3300005548 Ga0070665_100521002 Ga0070665_1005210022 191
129 3300005578 Ga0068854_100000267 Ga0068854_10000026718 191
130 3300005614 Ga0068856_100001040 Ga0068856_10000104022 191
131 3300005614 Ga0068856_100020478 Ga0068856_1000204788 191
132 3300005614 Ga0068856_100442069 Ga0068856_1004420692 191
133 3300005718 Ga0068866_10000140 Ga0068866_100001405 191
134 3300005718 Ga0068866_10002382 Ga0068866_100023825 191
135 3300005719 Ga0068861_100126814 Ga0068861_1001268142 191
136 3300005719 Ga0068861_100836327 Ga0068861_1008363272 191
137 3300005834 Ga0068851_10000258 Ga0068851_1000025815 191
138 3300005841 Ga0068863_100017941 Ga0068863_1000179416 191
139 3300005842 Ga0068858_100000017 Ga0068858_10000001729 191
140 3300005842 Ga0068858_100000264 Ga0068858_10000026414 191
141 3300005842 Ga0068858_100285904 Ga0068858_1002859041 191
142 3300005983 Ga0081540_1000181 Ga0081540_100018136 191
143 3300005983 Ga0081540_1078676 Ga0081540_10786762 191
144 3300006173 Ga0070716_100351870 Ga0070716_1003518703 191
145 3300006175 Ga0070712_100004518 Ga0070712_1000045187 191
146 3300006846 Ga0075430_100260358 Ga0075430_1002603582 191
147 3300006880 Ga0075429_100002516 Ga0075429_1000025166 191
148 3300009093 Ga0105240_11184737 Ga0105240_111847371 191
149 3300009098 Ga0105245_10004280 Ga0105245_100042808 191
150 3300009098 Ga0105245_10004472 Ga0105245_100044726 191
151 3300009101 Ga0105247_10185294 Ga0105247_101852942 191
152 3300009148 Ga0105243_10812774 Ga0105243_108127742 191
153 3300009148 Ga0105243_11071452 Ga0105243_110714522 191
154 3300009174 Ga0105241_10528325 Ga0105241_105283252 191
155 3300009176 Ga0105242_10001159 Ga0105242_100011593 191
156 3300009176 Ga0105242_10111031 Ga0105242_101110313 191
157 3300009545 Ga0105237_10557050 Ga0105237_105570502 191
158 3300009551 Ga0105238_10113184 Ga0105238_101131844 191
159 3300009553 Ga0105249_10331299 Ga0105249_103312992 191
160 3300009553 Ga0105249_10393357 Ga0105249_103933572 191
161 3300009553 Ga0105249_10473246 Ga0105249_104732462 191
162 3300010375 Ga0105239_10046940 Ga0105239_100469406 191
163 3300010375 Ga0105239_10056461 Ga0105239_100564614 191
164 3300010375 Ga0105239_10854217 Ga0105239_108542172 191
165 3300011119 Ga0105246_10007179 Ga0105246_100071796 191
166 3300013104 Ga0157370_10015334 Ga0157370_100153348 191
167 3300013104 Ga0157370_10145645 Ga0157370_101456451 191
168 3300013296 Ga0157374_10002416 Ga0157374_1000241610 191
169 3300013297 Ga0157378_10001452 Ga0157378_100014529 191
170 3300013297 Ga0157378_10949005 Ga0157378_109490051 191
171 3300013307 Ga0157372_10000407 Ga0157372_1000040726 191
172 3300013308 Ga0157375_10001744 Ga0157375_100017446 191
173 3300013308 Ga0157375_10264812 Ga0157375_102648124 191
174 3300013308 Ga0157375_11330234 Ga0157375_113302341 191
175 3300014969 Ga0157376_10079603 Ga0157376_100796032 191
176 3300014969 Ga0157376_10181784 Ga0157376_101817842 191
177 3300017792 Ga0163161_10000103 Ga0163161_1000010337 191
178 3300017792 Ga0163161_10029462 Ga0163161_100294625 191
179 3300020078 Ga0206352_10198084 Ga0206352_101980842 191
180 3300025321 Ga0207656_10001236 Ga0207656_100012368 191
181 3300025899 Ga0207642_10000066 Ga0207642_1000006626 191
182 3300025903 Ga0207680_10051824 Ga0207680_100518242 191
183 3300025915 Ga0207693_10008063 Ga0207693_100080638 191
184 3300025923 Ga0207681_10008854 Ga0207681_100088542 191
185 3300025927 Ga0207687_10001665 Ga0207687_1000166512 191
186 3300025927 Ga0207687_10002421 Ga0207687_100024218 191
187 3300025934 Ga0207686_10000035 Ga0207686_1000003535 191
188 3300025937 Ga0207669_10000002 Ga0207669_1000000267 191
189 3300025940 Ga0207691_10000286 Ga0207691_1000028611 191
190 3300025941 Ga0207711_10186410 Ga0207711_101864103 191
191 3300025944 Ga0207661_10000446 Ga0207661_1000044629 191
192 3300025944 Ga0207661_10001203 Ga0207661_100012035 191
193 3300025961 Ga0207712_10382511 Ga0207712_103825112 191
194 3300025981 Ga0207640_10000669 Ga0207640_100006699 191
195 3300025986 Ga0207658_10246055 Ga0207658_102460552 191
196 3300026035 Ga0207703_10000030 Ga0207703_1000003030 191
197 3300026035 Ga0207703_10001272 Ga0207703_100012729 191
198 3300026041 Ga0207639_10001685 Ga0207639_1000168510 191
199 3300026067 Ga0207678_10105227 Ga0207678_101052274 191
200 3300026078 Ga0207702_10000349 Ga0207702_1000034933 191
201 3300026078 Ga0207702_10018183 Ga0207702_100181837 191
202 3300026088 Ga0207641_10002521 Ga0207641_100025216 191
203 3300026089 Ga0207648_10253185 Ga0207648_102531852 191
204 3300026118 Ga0207675_100161198 Ga0207675_1001611982 191
205 3300026118 Ga0207675_100898783 Ga0207675_1008987832 191
206 3300028379 Ga0268266_10000029 Ga0268266_10000029225 191
207 3300028379 Ga0268266_10012516 Ga0268266_100125165 191
208 3300028379 Ga0268266_10048164 Ga0268266_100481644 191
209 3300028379 Ga0268266_10074850 Ga0268266_100748505 191
210 3300028379 Ga0268266_10196294 Ga0268266_101962942 191
211 3300028573 Ga0265334_10007239 Ga0265334_100072393 191
212 3300028654 Ga0265322_10068171 Ga0265322_100681712 191
213 3300032133 Ga0316583_10091366 Ga0316583_100913661 191
214 3300032133 Ga0316583_10190719 Ga0316583_101907191 191
215 3300036401 Ga0373937_0108186 Ga0373937_0108186_1001_1576 191
216 3300041486 Ga0451807_1812949 Ga0451807_1812949_422_997 191
217 3300041512 Ga0451853_1791680 Ga0451853_1791680_192_767 191
218 3300041512 Ga0451853_1849497 Ga0451853_1849497_454_1029 191
219 3300044694 Ga0466963_0000051 Ga0466963_0000051_22337_22912 191
220 3300044694 Ga0466963_0038439 Ga0466963_0038439_1564_2139 191
221 3300046454 Ga0495592_0000608 Ga0495592_0000608_17252_17827 191
222 3300046454 Ga0495592_0239674 Ga0495592_0239674_432_1007 191
223 3300046455 Ga0495603_0002488 Ga0495603_0002488_2236_2811 191
224 3300046459 Ga0495629_0000201 Ga0495629_0000201_2598_3173 191
225 3300046459 Ga0495629_0003016 Ga0495629_0003016_2872_3468 191
226 3300046459 Ga0495629_0162696 Ga0495629_0162696_944_1519 191
227 3300046459 Ga0495629_0165119 Ga0495629_0165119_219_794 191
228 3300046460 Ga0495638_0032677 Ga0495638_0032677_48_644 191
229 3300046461 Ga0495641_0000010 Ga0495641_0000010_129618_130193 191
230 3300046461 Ga0495641_0017705 Ga0495641_0017705_1374_1949 191
231 3300046462 Ga0495651_0323948 Ga0495651_0323948_423_998 191
232 3300046463 Ga0495653_0116448 Ga0495653_0116448_55_630 191
233 3300046463 Ga0495653_0138272 Ga0495653_0138272_504_1079 191
234 3300046475 Ga0495639_0218482 Ga0495639_0218482_126_701 191
235 3300046476 Ga0495662_0000162 Ga0495662_0000162_17474_18049 191
236 3300046477 Ga0495664_0215842 Ga0495664_0215842_60_635 191
237 3300046499 Ga0495594_0000001 Ga0495594_0000001_170866_171450 191
238 3300046511 Ga0495608_0002177 Ga0495608_0002177_11644_12219 191
239 3300046511 Ga0495608_0009896 Ga0495608_0009896_6026_6601 191
240 3300046511 Ga0495608_0180253 Ga0495608_0180253_564_1139 191
241 3300046512 Ga0495610_0022450 Ga0495610_0022450_2822_3397 191
242 3300046514 Ga0495618_0000051 Ga0495618_0000051_56027_56602 191
243 3300046515 Ga0495620_0000154 Ga0495620_0000154_5921_6496 191
244 3300046516 Ga0495628_0007286 Ga0495628_0007286_6752_7327 191
245 3300046516 Ga0495628_0357981 Ga0495628_0357981_143_718 191
246 3300046516 Ga0495628_0464451 Ga0495628_0464451_301_876 191
247 3300046517 Ga0495630_0000027 Ga0495630_0000027_96668_97243 191
248 3300046517 Ga0495630_0002919 Ga0495630_0002919_5501_6076 191
249 3300046517 Ga0495630_0341856 Ga0495630_0341856_197_772 191
250 3300046529 Ga0495652_0000009 Ga0495652_0000009_89169_89744 191
251 3300046533 Ga0495640_0229327 Ga0495640_0229327_131_706 191
252 3300046535 Ga0495586_0001516 Ga0495586_0001516_1679_2254 191
253 3300046543 Ga0495645_0125939 Ga0495645_0125939_1045_1620 191
254 3300046559 Ga0495667_0098767 Ga0495667_0098767_1075_1650 191
255 3300046642 Ga0495634_0320034 Ga0495634_0320034_43_618 191
256 3300046660 Ga0495625_0000552 Ga0495625_0000552_9607_10182 191
257 3300046663 Ga0495635_0000017 Ga0495635_0000017_53227_53802 191
258 3300046674 Ga0495588_0000204 Ga0495588_0000204_42538_43116 191
259 3300046675 Ga0495657_0160450 Ga0495657_0160450_691_1266 191
260 3300046678 Ga0495599_0047678 Ga0495599_0047678_88_663 191
261 3300046679 Ga0495623_0101793 Ga0495623_0101793_678_1253 191
262 3300046681 Ga0495647_0000002 Ga0495647_0000002_141891_142466 191
263 3300046681 Ga0495647_0002156 Ga0495647_0002156_4020_4595 191
264 3300046681 Ga0495647_0008668 Ga0495647_0008668_1744_2319 191
265 3300046683 Ga0495658_0020343 Ga0495658_0020343_2711_3286 191
266 3300046689 Ga0495613_0000067 Ga0495613_0000067_47252_47827 191
267 3300046689 Ga0495613_0435408 Ga0495613_0435408_23_598 191
268 3300046690 Ga0495624_0000005 Ga0495624_0000005_141937_142512 191
269 3300046690 Ga0495624_0000200 Ga0495624_0000200_42382_42960 191
270 3300046690 Ga0495624_0042888 Ga0495624_0042888_467_1042 191
271 3300046690 Ga0495624_0437445 Ga0495624_0437445_114_689 191
272 3300046694 Ga0495649_0002389 Ga0495649_0002389_12336_12911 191
273 3300046809 Ga0495600_0000376 Ga0495600_0000376_9409_9984 191
274 3300046809 Ga0495600_0102444 Ga0495600_0102444_841_1416 191
275 3300047320 Ga0495672_0054120 Ga0495672_0054120_1158_1736 191
276 3300047320 Ga0495672_0301401 Ga0495672_0301401_87_683 191
277 3300047321 Ga0495676_0002393 Ga0495676_0002393_11015_11590 191
278 3300047322 Ga0495680_0001118 Ga0495680_0001118_19269_19844 191
279 3300047444 Ga0495675_0028215 Ga0495675_0028215_1038_1613 191
280 3300047446 Ga0495679_050687 Ga0495679_050687_622_1197 191
281 3300047447 Ga0495685_037363 Ga0495685_037363_507_1082 191
282 3300047673 Ga0495593_0004902 Ga0495593_0004902_4219_4794 191
283 3300048088 Ga0495602_0115346 Ga0495602_0115346_676_1257 191
284 3300048903 Ga0496100_0285326 Ga0496100_0285326_172_747 191
285 3300048905 Ga0496102_0000021 Ga0496102_0000021_39295_39870 191
286 3300048905 Ga0496102_0111300 Ga0496102_0111300_734_1309 191
287 3300048906 Ga0496103_0000001 Ga0496103_0000001_556037_556612 191
288 3300048907 Ga0496104_0011058 Ga0496104_0011058_2964_3539 191
289 3300048907 Ga0496104_0037124 Ga0496104_0037124_3033_3608 191
290 3300048908 Ga0496105_0085221 Ga0496105_0085221_1085_1660 191
291 3300048909 Ga0496106_0000107 Ga0496106_0000107_56231_56806 191
292 3300048910 Ga0496107_0080499 Ga0496107_0080499_709_1284 191
293 3300048911 Ga0496108_0000239 Ga0496108_0000239_20227_20802 191
294 3300048911 Ga0496108_0015057 Ga0496108_0015057_1120_1695 191
295 3300048911 Ga0496108_0057482 Ga0496108_0057482_2658_3233 191
296 3300048911 Ga0496108_0140637 Ga0496108_0140637_874_1452 191
297 3300048912 Ga0496109_0000011 Ga0496109_0000011_161867_162442 191
298 3300048912 Ga0496109_0000034 Ga0496109_0000034_2734_3309 191
299 3300048912 Ga0496109_0000369 Ga0496109_0000369_32451_33026 191
300 3300048912 Ga0496109_0108609 Ga0496109_0108609_1184_1759 191
301 3300048912 Ga0496109_0117349 Ga0496109_0117349_991_1569 191
302 3300048913 Ga0496110_0000171 Ga0496110_0000171_19537_20115 191
303 3300048914 Ga0496111_0000020 Ga0496111_0000020_19868_20446 191
304 3300048914 Ga0496111_0029528 Ga0496111_0029528_1333_1908 191
305 3300048915 Ga0496112_0000641 Ga0496112_0000641_13830_14405 191
306 3300048916 Ga0496113_0000002 Ga0496113_0000002_197377_197952 191
307 3300048916 Ga0496113_0008425 Ga0496113_0008425_2570_3148 191
308 3300048917 Ga0496114_0041947 Ga0496114_0041947_1061_1636 191
309 3300048918 Ga0496115_0000022 Ga0496115_0000022_10438_11013 191
310 3300048919 Ga0496116_0000138 Ga0496116_0000138_15140_15715 191
311 3300048920 Ga0496117_0108013 Ga0496117_0108013_113_697 191
312 3300048921 Ga0496118_0005655 Ga0496118_0005655_103_687 191
313 3300048921 Ga0496118_0100237 Ga0496118_0100237_1349_1924 191
314 3300048922 Ga0496119_0004108 Ga0496119_0004108_160_735 191
315 3300048922 Ga0496119_0005578 Ga0496119_0005578_4291_4866 191
316 3300048922 Ga0496119_0017543 Ga0496119_0017543_990_1574 191
317 3300048923 Ga0496120_0001479 Ga0496120_0001479_10997_11581 191
318 3300048924 Ga0496121_0059734 Ga0496121_0059734_2471_3055 191
319 3300048924 Ga0496121_0150338 Ga0496121_0150338_60_644 191
320 3300048924 Ga0496121_0271988 Ga0496121_0271988_171_746 191
321 3300048928 Ga0496125_0112497 Ga0496125_0112497_697_1272 191
322 3300049578 Ga0501042_0019694 Ga0501042_0019694_2714_3289 191
323 3300049578 Ga0501042_0045762 Ga0501042_0045762_622_1197 191
324 3300049581 Ga0501047_0002300 Ga0501047_0002300_14166_14741 191
325 3300049581 Ga0501047_0522238 Ga0501047_0522238_408_1001 191
326 3300049586 Ga0501070_0024812 Ga0501070_0024812_2538_3113 191
327 3300049590 Ga0501074_0666780 Ga0501074_0666780_131_706 191
328 3300049744 Ga0501083_0006427 Ga0501083_0006427_4172_4747 191
329 3300050508 nmdc:mga09592_9040_c1 nmdc:mga09592_9040_c1_2453_3028 191
330 3300050509 nmdc:mga0qj67_543923_c1 nmdc:mga0qj67_543923_c1_195_770 191
331 3300053077 Ga0495601_0000231 Ga0495601_0000231_14959_15534 191
332 3300053077 Ga0495601_0021535 Ga0495601_0021535_779_1354 191
333 3300053078 Ga0495612_0000279 Ga0495612_0000279_4589_5164 191
334 3300053078 Ga0495612_0051813 Ga0495612_0051813_193_768 191
335 3300053083 Ga0495655_0000008 Ga0495655_0000008_104154_104729 191
336 3300053083 Ga0495655_0001411 Ga0495655_0001411_952_1527 191
337 3300053084 Ga0495595_0027605 Ga0495595_0027605_1594_2169 191
338 3300053085 Ga0495619_0000022 Ga0495619_0000022_47982_48560 191
339 3300053094 Ga0500566_0180756 Ga0500566_0180756_217_792 191
340 3300053119 Ga0500595_038781 Ga0500595_038781_652_1227 191
341 3300053119 Ga0500595_048224 Ga0500595_048224_618_1193 191
342 3300053123 Ga0500614_000060 Ga0500614_000060_16350_16925 191
343 3300053129 Ga0500628_000023 Ga0500628_000023_59068_59643 191
344 3300005338 Ga0068868_100004415 Ga0068868_10000441511 192
345 3300005340 Ga0070689_100270259 Ga0070689_1002702593 192
346 3300005365 Ga0070688_100000732 Ga0070688_10000073211 192
347 3300005436 Ga0070713_100073917 Ga0070713_1000739174 192
348 3300005466 Ga0070685_10000191 Ga0070685_1000019140 192
349 3300005466 Ga0070685_10050754 Ga0070685_100507543 192
350 3300005841 Ga0068863_100000050 Ga0068863_10000005098 192
351 3300025916 Ga0207663_10353044 Ga0207663_103530442 192
352 3300025928 Ga0207700_10111067 Ga0207700_101110672 192
353 3300025936 Ga0207670_10215111 Ga0207670_102151113 192
354 3300026023 Ga0207677_10006059 Ga0207677_100060596 192
355 3300026088 Ga0207641_10000295 Ga0207641_1000029511 192
356 3300044842 Ga0466957_0496862 Ga0466957_0496862_203_781 192
357 3300045836 Ga0466958_0046114 Ga0466958_0046114_1083_1661 192
358 3300046511 Ga0495608_0000042 Ga0495608_0000042_115269_115847 192
359 3300046663 Ga0495635_0090637 Ga0495635_0090637_42_620 192
360 3300046675 Ga0495657_0000040 Ga0495657_0000040_115269_115847 192
361 3300047317 Ga0495604_0007756 Ga0495604_0007756_4252_4833 192
362 3300047444 Ga0495675_0000036 Ga0495675_0000036_34855_35433 192
363 3300048088 Ga0495602_0000268 Ga0495602_0000268_42321_42902 192
364 3300049744 Ga0501083_0063827 Ga0501083_0063827_1830_2420 192
365 3300053084 Ga0495595_0000009 Ga0495595_0000009_77193_77771 192
366 3300053084 Ga0495595_0002276 Ga0495595_0002276_903_1484 192
367 3300053085 Ga0495619_0000057 Ga0495619_0000057_52_630 192
368 3300005344 Ga0070661_100000255 Ga0070661_10000025532 193
369 3300005347 Ga0070668_100454064 Ga0070668_1004540642 193
370 3300005354 Ga0070675_100000196 Ga0070675_10000019611 193
371 3300005365 Ga0070688_100590190 Ga0070688_1005901901 193
372 3300005530 Ga0070679_100027963 Ga0070679_1000279632 193
373 3300005535 Ga0070684_100604092 Ga0070684_1006040922 193
374 3300005549 Ga0070704_100576497 Ga0070704_1005764971 193
375 3300005614 Ga0068856_100305108 Ga0068856_1003051082 193
376 3300005615 Ga0070702_100092698 Ga0070702_1000926982 193
377 3300005618 Ga0068864_100673429 Ga0068864_1006734292 193
378 3300005718 Ga0068866_10243572 Ga0068866_102435721 193
379 3300006237 Ga0097621_100337548 Ga0097621_1003375481 193
380 3300009098 Ga0105245_10002119 Ga0105245_1000211914 193
381 3300009098 Ga0105245_10203875 Ga0105245_102038752 193
382 3300009148 Ga0105243_10679184 Ga0105243_106791841 193
383 3300009176 Ga0105242_10451268 Ga0105242_104512682 193
384 3300009177 Ga0105248_10738912 Ga0105248_107389122 193
385 3300009553 Ga0105249_10304391 Ga0105249_103043912 193
386 3300010375 Ga0105239_10633691 Ga0105239_106336912 193
387 3300011119 Ga0105246_10194546 Ga0105246_101945462 193
388 3300014969 Ga0157376_10078500 Ga0157376_100785002 193
389 3300025920 Ga0207649_10000015 Ga0207649_1000001595 193
390 3300025926 Ga0207659_10000268 Ga0207659_1000026822 193
391 3300025927 Ga0207687_10000029 Ga0207687_10000029131 193
392 3300025927 Ga0207687_10151100 Ga0207687_101511002 193
393 3300025944 Ga0207661_10361664 Ga0207661_103616642 193
394 3300025972 Ga0207668_10210411 Ga0207668_102104112 193
395 3300026142 Ga0207698_10092093 Ga0207698_100920933 193
396 3300035115 Ga0373941_0200505 Ga0373941_0200505_67_669 193
397 3300048909 Ga0496106_0454762 Ga0496106_0454762_256_885 193
398 3300048910 Ga0496107_0788754 Ga0496107_0788754_12_593 193
399 3300001979 JGI24740J21852_10003221 JGI24740J21852_100032213 194
400 3300005329 Ga0070683_100651088 Ga0070683_1006510882 194
401 3300005456 Ga0070678_100346534 Ga0070678_1003465342 194
402 3300005564 Ga0070664_100022844 Ga0070664_1000228448 194
403 3300005615 Ga0070702_100381127 Ga0070702_1003811271 194
404 3300005840 Ga0068870_10111610 Ga0068870_101116102 194
405 3300006237 Ga0097621_100125702 Ga0097621_1001257022 194
406 3300009148 Ga0105243_10324238 Ga0105243_103242382 194
407 3300009176 Ga0105242_10004096 Ga0105242_100040966 194
408 3300017792 Ga0163161_10218689 Ga0163161_102186892 194
409 3300025908 Ga0207643_10103282 Ga0207643_101032822 194
410 3300025934 Ga0207686_10002926 Ga0207686_100029266 194
411 3300025935 Ga0207709_10015199 Ga0207709_100151994 194
412 3300025945 Ga0207679_10056029 Ga0207679_100560294 194
413 3300026121 Ga0207683_10462296 Ga0207683_104622962 194
414 3300050511 nmdc:mga08y16_375625_c1 nmdc:mga08y16_375625_c1_780_1421 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

168

226

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8big-assembly1.cif.gz_A o-methyltransferase plu4895 in complex with sah 0.7491 7 81
8bii-assembly3.cif.gz_G-2 o-methyltransferase plu4895 (mutant h229n) in complex with sah 0.7345 16 81
8bie-assembly1.cif.gz_B o-methyltransferase plu4894 in complex with sah 0.7326 15 81
8big-assembly4.cif.gz_G o-methyltransferase plu4895 in complex with sah 0.7301 8 81
8bii-assembly4.cif.gz_E o-methyltransferase plu4895 (mutant h229n) in complex with sah 0.7252 7 81
ID Description Score Start End Superfamily
af_A0A0B4JCY2_46_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7166 13 79 3.40.50.150
af_P9WLG9_29_152_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7064 16 82 3.40.50.150
6c5bB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6991 8 81 3.40.50.150
af_P38278_162_312_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.693 17 81 3.40.50.150
3dp7B03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6834 16 81 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Q4WUU7-F1-model_v4 OmdA domain containing protein 0.9814 10 111
AF-A0A7X0MFB9-F1-model_v4 Uncharacterized protein YdeI (YjbR/CyaY-like superfamily) 0.9812 10 121
AF-A0A0N9ID98-F1-model_v4 Bacteriocin-protection protein 0.9805 10 121
AF-A0A7Y6I4J9-F1-model_v4 YdeI/OmpD-associated family protein 0.9801 11 194
AF-A0A0B0HP10-F1-model_v4 deleted 0.979 10 127

Feature Viewer

pLDDT pTM Quality
94.68 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map