metagRoot

F438280

General Info

Members	Datasets	Scaffolds	Average Seq Length
414	268	414	59

Family's Representative Sequence

Representative Sequence	3300005616\|Ga0068852_102645416\|Ga0068852_1026454162
Length	69
Sequence	VGRASSRDSLDPVYFTDRGIEELAARRGEEEVSIEWLAEQLRTFVDLNPEFEVPVERLATWLARLDDED

Samples

	Sample ID	Description	Type	Environment
1	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
2	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
3	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
4	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
7	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
8	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
9	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
10	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
11	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
12	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
13	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
14	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
15	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
16	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
17	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
18	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
19	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
20	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
21	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
22	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
23	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
24	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
25	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
26	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
27	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
28	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
29	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
30	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
31	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
32	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
33	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
34	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
35	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
36	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
37	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
38	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
39	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
40	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
41	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
42	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
43	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
44	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
45	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
46	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
47	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
48	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
49	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
50	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
51	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
52	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
53	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
54	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
55	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
56	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
57	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
58	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
59	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
60	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
61	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
62	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
63	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
64	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
65	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
66	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
67	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
68	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
69	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
70	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
71	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
72	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
97	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
101	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
102	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
103	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
104	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
105	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
106	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
107	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
108	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
109	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
110	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
111	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
112	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
113	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
114	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
115	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
116	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
117	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
118	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
119	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
120	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
121	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
122	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
123	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
124	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
125	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
126	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
127	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
128	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
129	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
130	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
131	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
132	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
133	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
134	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
135	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
136	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
137	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
138	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
139	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
140	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
141	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
142	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
143	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
144	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
145	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
146	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
147	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
148	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
149	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
150	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
151	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
152	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
153	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
154	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
155	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
156	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
157	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
158	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
159	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
160	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
161	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
162	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
163	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
164	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
165	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
166	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
167	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
168	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
169	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
170	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
171	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
172	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
173	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
174	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
175	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
176	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
177	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
178	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
179	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
180	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
181	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
182	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
183	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
184	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
185	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
186	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
187	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
188	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
189	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
190	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
191	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
192	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
193	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
194	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
195	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
196	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
197	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
198	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
199	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
200	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
201	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
202	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
203	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
204	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
205	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
206	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
207	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
208	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
209	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
210	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
211	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
212	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
213	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
214	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
215	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
216	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
217	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
221	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
226	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
227	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
228	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
232	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
233	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
235	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
239	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
240	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
241	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
242	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
243	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
244	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
245	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
246	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
247	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
248	3300053100	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere	Metagenome	Endosphere
249	3300053101	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere	Metagenome	Endosphere
250	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
251	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
252	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
253	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
254	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
255	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
256	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
257	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
258	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
259	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
260	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
261	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
262	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
263	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
264	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
265	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
266	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
267	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
268	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.07
Metatranscriptomes	1.93
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.52
Nodule	0
Rhizoplane	8.45
Rhizosphere	79.47
Stem	0
Stem Tuber	0
Unclassified	5.56

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10017149	3300003203	Bacteria	3000
2	rootH1_10101434	3300003316	Bacteria	1567
3	rootH2_10087668	3300003320	Bacteria	3019
4	Ga0006562J51391_1011583	3300003578	Bacteria	1694
5	Ga0070658_11314081	3300005327	Bacteria	628
6	Ga0070683_100444820	3300005329	Bacteria	1236
7	Ga0070683_101811936	3300005329	Bacteria	587
8	Ga0070680_100277458	3300005336	Bacteria	1420
9	Ga0068868_100324794	3300005338	Bacteria	1312
10	Ga0070689_102104958	3300005340	Bacteria	517
11	Ga0070692_10061468	3300005345	Bacteria	1980
12	Ga0070668_100628376	3300005347	Unclassified	942
13	Ga0070674_100865303	3300005356	Bacteria	785
14	Ga0070674_101668383	3300005356	Bacteria	576
15	Ga0070688_101580315	3300005365	Bacteria	535
16	Ga0070659_101105266	3300005366	Bacteria	699
17	Ga0070700_101780486	3300005441	Bacteria	530
18	Ga0070681_11155240	3300005458	Bacteria	696
19	Ga0070681_12037760	3300005458	Bacteria	502
20	Ga0070706_100921258	3300005467	Bacteria	807
21	Ga0070679_100273060	3300005530	Bacteria	1644
22	Ga0070679_100492359	3300005530	Bacteria	1170
23	Ga0070679_101739572	3300005530	Bacteria	572
24	Ga0070684_100361566	3300005535	Bacteria	1336
25	Ga0070695_100313160	3300005545	Unclassified	1164
26	Ga0070693_100653147	3300005547	Bacteria	765
27	Ga0070665_100182630	3300005548	Bacteria	2098
28	Ga0070665_100655049	3300005548	Bacteria	1063
29	Ga0068854_100578929	3300005578	Bacteria	956
30	Ga0068852_100468318	3300005616	Bacteria	1250
31	Ga0068852_102645416	3300005616	Bacteria	521
32	Ga0068866_10496311	3300005718	Unclassified	807
33	Ga0068861_100082438	3300005719	Bacteria	2520
34	Ga0068860_100434108	3300005843	Bacteria	1304
35	Ga0068862_101011193	3300005844	Unclassified	823
36	Ga0081455_10046585	3300005937	Bacteria	3760
37	Ga0081539_10000270	3300005985	Bacteria	118964
38	Ga0081539_10034115	3300005985	Bacteria	3086
39	Ga0075368_10494945	3300006042	Bacteria	545
40	Ga0075364_10784688	3300006051	Bacteria	650
41	Ga0075432_10003973	3300006058	Bacteria	5041
42	Ga0075427_10030475	3300006194	Archaea	884
43	Ga0075428_100043884	3300006844	Bacteria	4915
44	Ga0075428_101045021	3300006844	Bacteria	864
45	Ga0075428_102205526	3300006844	Bacteria	568
46	Ga0075430_100362499	3300006846	Bacteria	1197
47	Ga0075431_100244939	3300006847	Bacteria	1822
48	Ga0075433_10013825	3300006852	Bacteria	6580
49	Ga0075434_100004274	3300006871	Bacteria	12816
50	Ga0075429_100014004	3300006880	Bacteria	6951
51	Ga0068865_100467778	3300006881	Bacteria	1045
52	Ga0075435_100170147	3300007076	Bacteria	1838
53	Ga0075435_101865774	3300007076	Bacteria	528
54	Ga0105240_10607771	3300009093	Bacteria	1203
55	Ga0111539_10032233	3300009094	Bacteria	6365
56	Ga0111539_10389180	3300009094	Bacteria	1624
57	Ga0105245_10084151	3300009098	Bacteria	2913
58	Ga0114129_10995471	3300009147	Bacteria	1056
59	Ga0105243_10082288	3300009148	Bacteria	2631
60	Ga0105243_10959135	3300009148	Bacteria	855
61	Ga0105242_11052254	3300009176	Bacteria	825
62	Ga0105242_12159903	3300009176	Bacteria	601
63	Ga0105242_13238748	3300009176	Bacteria	506
64	Ga0105242_13273142	3300009176	Unclassified	503
65	Ga0105237_11972546	3300009545	Bacteria	592
66	Ga0105238_11112786	3300009551	Bacteria	813
67	Ga0105249_10008669	3300009553	Bacteria	8857
68	Ga0105249_10338241	3300009553	Bacteria	1521
69	Ga0105249_12101206	3300009553	Bacteria	638
70	Ga0105249_13411542	3300009553	Bacteria	511
71	Ga0105239_10404720	3300010375	Bacteria	1545
72	Ga0105246_10493893	3300011119	Bacteria	1038
73	Ga0105246_11858505	3300011119	Bacteria	577
74	Ga0157370_10184719	3300013104	Bacteria	1936
75	Ga0157369_10451971	3300013105	Bacteria	1330
76	Ga0157369_11058291	3300013105	Bacteria	830
77	Ga0157369_11584610	3300013105	Bacteria	666
78	Ga0157369_11882204	3300013105	Bacteria	607
79	Ga0157374_11195821	3300013296	Bacteria	781
80	Ga0163162_10059188	3300013306	Bacteria	3862
81	Ga0157372_10211710	3300013307	Bacteria	2246
82	Ga0157372_11999231	3300013307	Bacteria	666
83	Ga0157372_12146819	3300013307	Bacteria	642
84	Ga0157372_12261274	3300013307	Bacteria	625
85	Ga0157375_10520263	3300013308	Bacteria	1353
86	Ga0163163_12644432	3300014325	Bacteria	559
87	Ga0163161_10161153	3300017792	Bacteria	1711
88	Ga0206354_11097840	3300020081	Bacteria	577
89	Ga0206353_10022693	3300020082	Bacteria	2119
90	Ga0206353_10376169	3300020082	Bacteria	1249
91	Ga0206353_11532621	3300020082	Bacteria	1507
92	Ga0206353_11559225	3300020082	Bacteria	1683
93	Ga0206353_11677328	3300020082	Bacteria	1373
94	Ga0213874_10270494	3300021377	Bacteria	632
95	Ga0213876_10004576	3300021384	Bacteria	7713
96	Ga0213875_10042673	3300021388	Bacteria	2130
97	Ga0224712_10083796	3300022467	Bacteria	1322
98	Ga0207688_10039400	3300025901	Bacteria	2624
99	Ga0207647_10445979	3300025904	Archaea	726
100	Ga0207645_10660725	3300025907	Unclassified	710
101	Ga0207660_10696942	3300025917	Bacteria	828
102	Ga0207662_10750945	3300025918	Bacteria	686
103	Ga0207657_11069567	3300025919	Archaea	617
104	Ga0207652_10173825	3300025921	Bacteria	1933
105	Ga0207652_10178964	3300025921	Bacteria	1905
106	Ga0207694_11337193	3300025924	Bacteria	606
107	Ga0207694_11871274	3300025924	Bacteria	504
108	Ga0207687_10407611	3300025927	Bacteria	1119
109	Ga0207690_11299955	3300025932	Bacteria	608
110	Ga0207690_11366227	3300025932	Bacteria	592
111	Ga0207706_10341710	3300025933	Bacteria	1302
112	Ga0207686_11421510	3300025934	Bacteria	571
113	Ga0207709_10626412	3300025935	Bacteria	854
114	Ga0207709_10694495	3300025935	Unclassified	814
115	Ga0207709_11837063	3300025935	Bacteria	504
116	Ga0207704_10034946	3300025938	Bacteria	2874
117	Ga0207691_10384965	3300025940	Bacteria	1197
118	Ga0207661_10558831	3300025944	Bacteria	1049
119	Ga0207661_10641819	3300025944	Bacteria	976
120	Ga0207661_11929354	3300025944	Bacteria	536
121	Ga0207712_11819910	3300025961	Unclassified	546
122	Ga0207668_10241465	3300025972	Bacteria	1462
123	Ga0207668_11620885	3300025972	Unclassified	584
124	Ga0207640_11846156	3300025981	Unclassified	547
125	Ga0207640_11936873	3300025981	Archaea	534
126	Ga0207677_10189491	3300026023	Bacteria	1625
127	Ga0207639_10199667	3300026041	Bacteria	1714
128	Ga0207702_10414895	3300026078	Bacteria	1301
129	Ga0207702_11848786	3300026078	Bacteria	595
130	Ga0207641_10113610	3300026088	Bacteria	2405
131	Ga0207676_10930296	3300026095	Bacteria	854
132	Ga0207675_100015584	3300026118	Bacteria	7090
133	Ga0207683_11472215	3300026121	Bacteria	629
134	Ga0207698_10720422	3300026142	Bacteria	994
135	Ga0207698_11260135	3300026142	Bacteria	754
136	Ga0209983_1094000	3300027665	Bacteria	677
137	Ga0207428_10002017	3300027907	Bacteria	20514
138	Ga0268266_10331560	3300028379	Bacteria	1426
139	Ga0268266_10666009	3300028379	Bacteria	1002
140	Ga0268265_10205217	3300028380	Bacteria	1713
141	Ga0268264_10744128	3300028381	Bacteria	976
142	Ga0265334_10043060	3300028573	Bacteria	1758
143	Ga0307517_10010328	3300028786	Bacteria	13080
144	Ga0265338_10014388	3300028800	Bacteria	8807
145	Ga0307511_10086649	3300030521	Bacteria	2156
146	Ga0316181_1103335	3300030744	Bacteria	603
147	Ga0316182_1036434	3300030745	Bacteria	8673
148	Ga0265320_10254692	3300031240	Bacteria	778
149	Ga0265325_10009200	3300031241	Bacteria	5783
150	Ga0265329_10351499	3300031242	Bacteria	505
151	Ga0265340_10005497	3300031247	Bacteria	7027
152	Ga0265339_10041985	3300031249	Bacteria	2534
153	Ga0307509_10214599	3300031507	Bacteria	1745
154	Ga0265313_10016431	3300031595	Bacteria	4255
155	Ga0307508_10027614	3300031616	Bacteria	5135
156	Ga0307514_10068839	3300031649	Bacteria	2666
157	Ga0265314_10179767	3300031711	Bacteria	1269
158	Ga0265342_10045628	3300031712	Bacteria	2637
159	Ga0316578_10411489	3300031728	Bacteria	801
160	Ga0316578_10644119	3300031728	Bacteria	619
161	Ga0307516_10073459	3300031730	Bacteria	3277
162	Ga0307413_10358466	3300031824	Bacteria	1128
163	Ga0307406_10555153	3300031901	Bacteria	940
164	Ga0307407_10661524	3300031903	Bacteria	783
165	Ga0307409_100237417	3300031995	Bacteria	1657
166	Ga0307409_101299693	3300031995	Bacteria	752
167	Ga0307416_101841840	3300032002	Bacteria	709
168	Ga0307416_102075359	3300032002	Bacteria	671
169	Ga0307416_103074073	3300032002	Bacteria	558
170	Ga0307411_10177827	3300032005	Bacteria	1612
171	Ga0316580_10009703	3300032139	Bacteria	2898
172	Ga0307507_10168244	3300033179	Bacteria	1600
173	Ga0373939_0106136	3300035114	Unclassified	971
174	Ga0316574_0213660	3300035398	Bacteria	1237
175	Ga0316574_0246712	3300035398	Bacteria	1141
176	Ga0373931_1057955	3300035691	Archaea	551
177	Ga0316584_0588403	3300036712	Bacteria	773
178	Ga0395899_0002079	3300037312	Bacteria	16440
179	Ga0395900_0047960	3300037418	Bacteria	4400
180	Ga0395900_0592604	3300037418	Bacteria	1050
181	Ga0395898_0036820	3300037466	Bacteria	4856
182	Ga0436364_1158925	3300037853	Bacteria	2129
183	Ga0395901_0007985	3300038443	Bacteria	10682
184	Ga0395901_0779853	3300038443	Bacteria	946
185	Ga0395901_1132049	3300038443	Bacteria	752
186	Ga0395901_1363815	3300038443	Bacteria	669
187	Ga0436365_1781586	3300039437	Bacteria	55120
188	Ga0436363_0508075	3300039450	Bacteria	629
189	Ga0436363_1025567	3300039450	Bacteria	625
190	Ga0439461_0069671	3300041410	Bacteria	813
191	Ga0439466_0171791	3300041411	Bacteria	662
192	Ga0439465_0087977	3300041413	Bacteria	1060
193	Ga0439465_0269195	3300041413	Bacteria	633
194	Ga0451795_0404559	3300041456	Bacteria	553
195	Ga0451802_0530537	3300041460	Bacteria	842
196	Ga0451839_1121803	3300041496	Bacteria	500
197	Ga0451845_0742789	3300041501	Bacteria	546
198	Ga0451849_0888281	3300041505	Bacteria	844
199	Ga0451851_0476986	3300041507	Bacteria	747
200	Ga0451843_1341546	3300041509	Bacteria	592
201	Ga0451855_0693929	3300041511	Bacteria	770
202	Ga0439445_0017476	3300042004	Bacteria	1773
203	Ga0439448_0240874	3300042005	Unclassified	637
204	Ga0439463_008951	3300042016	Bacteria	2465
205	Ga0439460_0051632	3300042461	Bacteria	1234
206	Ga0466969_0000565	3300044656	Bacteria	20274
207	Ga0466969_0069156	3300044656	Bacteria	1701
208	Ga0466965_0083830	3300044683	Bacteria	1614
209	Ga0466965_0136898	3300044683	Bacteria	1273
210	Ga0466965_0178716	3300044683	Bacteria	1119
211	Ga0466965_0911570	3300044683	Bacteria	513
212	Ga0466966_0000572	3300044684	Bacteria	23438
213	Ga0466961_0008194	3300044693	Bacteria	6657
214	Ga0466961_0370705	3300044693	Bacteria	870
215	Ga0466961_0440950	3300044693	Bacteria	788
216	Ga0466963_0137639	3300044694	Bacteria	1690
217	Ga0466963_0326944	3300044694	Bacteria	1079
218	Ga0466963_0393117	3300044694	Bacteria	978
219	Ga0466963_0627338	3300044694	Bacteria	759
220	Ga0466963_0742327	3300044694	Bacteria	692
221	Ga0466963_1306281	3300044694	Bacteria	509
222	Ga0466964_0031537	3300044706	Bacteria	2103
223	Ga0466964_0126560	3300044706	Bacteria	1158
224	Ga0466964_0613040	3300044706	Bacteria	598
225	Ga0466971_0109120	3300044719	Bacteria	1276
226	Ga0466971_0242503	3300044719	Bacteria	857
227	Ga0466971_0380240	3300044719	Bacteria	686
228	Ga0466968_0091791	3300044735	Bacteria	1347
229	Ga0466957_0003241	3300044842	Bacteria	8905
230	Ga0466957_0019156	3300044842	Bacteria	4024
231	Ga0466957_0047487	3300044842	Bacteria	2609
232	Ga0466957_0048396	3300044842	Bacteria	2584
233	Ga0466960_0086191	3300044901	Bacteria	1592
234	Ga0466960_0170174	3300044901	Bacteria	1175
235	Ga0466959_0010633	3300045049	Bacteria	6590
236	Ga0466959_0193696	3300045049	Bacteria	1417
237	Ga0466959_1189681	3300045049	Bacteria	507
238	Ga0466958_0003446	3300045836	Bacteria	8206
239	Ga0466958_0650203	3300045836	Bacteria	686
240	Ga0466958_1130833	3300045836	Bacteria	511
241	Ga0466967_0008571	3300045976	Bacteria	7512
242	Ga0466967_0194837	3300045976	Bacteria	1917
243	Ga0466967_0240852	3300045976	Bacteria	1726
244	Ga0466967_0467340	3300045976	Bacteria	1234
245	Ga0466967_0673579	3300045976	Bacteria	1024
246	Ga0466967_1613291	3300045976	Bacteria	646
247	Ga0466967_1869177	3300045976	Bacteria	597
248	Ga0466967_2076887	3300045976	Bacteria	565
249	Ga0466967_2558451	3300045976	Bacteria	505
250	Ga0495629_0113624	3300046459	Bacteria	1887
251	Ga0495629_0920904	3300046459	Bacteria	572
252	Ga0495638_0124909	3300046460	Bacteria	1517
253	Ga0495641_0302595	3300046461	Bacteria	721
254	Ga0495585_0022385	3300046492	Bacteria	3628
255	Ga0495585_0212977	3300046492	Bacteria	978
256	Ga0495594_0305486	3300046499	Bacteria	906
257	Ga0495608_0819154	3300046511	Bacteria	549
258	Ga0495631_0185956	3300046518	Bacteria	890
259	Ga0495632_0118326	3300046519	Bacteria	1239
260	Ga0495643_0004602	3300046522	Bacteria	9601
261	Ga0495666_0028380	3300046526	Bacteria	2753
262	Ga0495640_0010301	3300046533	Bacteria	7229
263	Ga0495597_0143520	3300046542	Bacteria	983
264	Ga0495633_0394395	3300046558	Bacteria	626
265	Ga0495656_0656579	3300046615	Bacteria	563
266	Ga0495668_0137956	3300046616	Bacteria	1335
267	Ga0495611_0205137	3300046648	Bacteria	919
268	Ga0495635_0281048	3300046663	Bacteria	1118
269	Ga0495588_0516080	3300046674	Bacteria	626
270	Ga0495647_0565064	3300046681	Bacteria	532
271	Ga0495658_0028335	3300046683	Bacteria	3022
272	Ga0495658_0030509	3300046683	Bacteria	2928
273	Ga0495613_0211107	3300046689	Bacteria	1365
274	Ga0495613_0370948	3300046689	Bacteria	980
275	Ga0495624_0043982	3300046690	Bacteria	2848
276	Ga0495670_0006990	3300046691	Bacteria	5562
277	Ga0495649_0135724	3300046694	Bacteria	1297
278	Ga0495589_0013884	3300046794	Bacteria	4153
279	Ga0495660_0029819	3300046810	Bacteria	3076
280	Ga0495604_0442966	3300047317	Bacteria	850
281	Ga0495680_0148041	3300047322	Bacteria	1714
282	Ga0495683_0232723	3300047323	Bacteria	816
283	Ga0495687_055387	3300047443	Bacteria	1658
284	Ga0495679_112782	3300047446	Bacteria	747
285	Ga0495685_001026	3300047447	Bacteria	8519
286	Ga0495681_0004644	3300047470	Bacteria	9317
287	Ga0495686_0237386	3300047472	Bacteria	1029
288	Ga0495614_0278326	3300048089	Bacteria	770
289	Ga0495626_0313473	3300048091	Bacteria	618
290	Ga0496100_0107062	3300048903	Bacteria	1936
291	Ga0496100_0515980	3300048903	Bacteria	922
292	Ga0496101_0022546	3300048904	Bacteria	4336
293	Ga0496101_1424349	3300048904	Bacteria	540
294	Ga0496102_0163596	3300048905	Bacteria	2093
295	Ga0496102_0399004	3300048905	Bacteria	1293
296	Ga0496102_1380286	3300048905	Bacteria	624
297	Ga0496104_0043132	3300048907	Bacteria	4236
298	Ga0496104_1500723	3300048907	Bacteria	577
299	Ga0496105_0072256	3300048908	Bacteria	2851
300	Ga0496106_1580991	3300048909	Bacteria	503
301	Ga0496107_0519944	3300048910	Bacteria	882
302	Ga0496108_0171511	3300048911	Bacteria	1877
303	Ga0496108_0186539	3300048911	Bacteria	1797
304	Ga0496109_0018348	3300048912	Bacteria	6147
305	Ga0496109_0470970	3300048912	Bacteria	1186
306	Ga0496109_2073122	3300048912	Bacteria	500
307	Ga0496110_0029567	3300048913	Bacteria	4717
308	Ga0496110_0043306	3300048913	Bacteria	3930
309	Ga0496110_0072039	3300048913	Bacteria	3065
310	Ga0496110_0319324	3300048913	Bacteria	1415
311	Ga0496110_0678117	3300048913	Bacteria	931
312	Ga0496111_0049148	3300048914	Bacteria	3041
313	Ga0496111_0240907	3300048914	Bacteria	1343
314	Ga0496111_1116813	3300048914	Bacteria	561
315	Ga0496113_0384280	3300048916	Bacteria	1127
316	Ga0496113_0425053	3300048916	Bacteria	1067
317	Ga0496113_0476371	3300048916	Bacteria	1003
318	Ga0496113_0621812	3300048916	Bacteria	864
319	Ga0496114_0137962	3300048917	Bacteria	2109
320	Ga0496114_0453670	3300048917	Bacteria	1135
321	Ga0496114_0729410	3300048917	Bacteria	867
322	Ga0496115_0496978	3300048918	Bacteria	981
323	Ga0501290_106862	3300049513	Unclassified	504
324	Ga0501031_0018982	3300049568	Bacteria	4477
325	Ga0501031_0086181	3300049568	Bacteria	2048
326	Ga0501031_0325023	3300049568	Bacteria	996
327	Ga0501032_0081770	3300049569	Bacteria	2149
328	Ga0501032_0089916	3300049569	Bacteria	2038
329	Ga0501033_0137543	3300049570	Bacteria	1767
330	Ga0501033_0179720	3300049570	Bacteria	1517
331	Ga0501033_0975007	3300049570	Bacteria	567
332	Ga0501034_0045615	3300049571	Bacteria	4429
333	Ga0501034_0213975	3300049571	Bacteria	1882
334	Ga0501034_1378483	3300049571	Bacteria	580
335	Ga0501036_0079894	3300049572	Bacteria	2765
336	Ga0501036_0232327	3300049572	Bacteria	1547
337	Ga0501036_0416768	3300049572	Bacteria	1120
338	Ga0501036_0525933	3300049572	Bacteria	983
339	Ga0501037_0018107	3300049573	Bacteria	5189
340	Ga0501037_0125972	3300049573	Bacteria	1839
341	Ga0501037_0371236	3300049573	Bacteria	984
342	Ga0501038_0177379	3300049574	Bacteria	1721
343	Ga0501038_0202093	3300049574	Bacteria	1594
344	Ga0501038_0817903	3300049574	Bacteria	691
345	Ga0501039_0044503	3300049575	Bacteria	3429
346	Ga0501039_0334390	3300049575	Bacteria	1190
347	Ga0501042_0013015	3300049578	Bacteria	5653
348	Ga0501043_0137172	3300049579	Bacteria	1916
349	Ga0501043_0157613	3300049579	Bacteria	1775
350	Ga0501043_0285793	3300049579	Bacteria	1263
351	Ga0501043_0794455	3300049579	Bacteria	685
352	Ga0501046_0049005	3300049580	Bacteria	3343
353	Ga0501047_0000046	3300049581	Bacteria	170205
354	Ga0501047_0023407	3300049581	Bacteria	5931
355	Ga0501047_0045024	3300049581	Bacteria	4265
356	Ga0501047_0226811	3300049581	Bacteria	1723
357	Ga0501047_0235236	3300049581	Bacteria	1684
358	Ga0501048_1344832	3300049582	Bacteria	513
359	Ga0501068_0441630	3300049584	Bacteria	841
360	Ga0501069_0179946	3300049585	Bacteria	1222
361	Ga0501069_0991670	3300049585	Bacteria	513
362	Ga0501070_0161306	3300049586	Bacteria	1848
363	Ga0501074_0313203	3300049590	Bacteria	1115
364	Ga0501079_1522091	3300049741	Bacteria	526
365	Ga0501035_0013908	3300049822	Bacteria	7425
366	Ga0501035_0067421	3300049822	Bacteria	3175
367	Ga0501035_0133398	3300049822	Bacteria	2163
368	Ga0501035_0165199	3300049822	Bacteria	1914
369	Ga0501035_0251939	3300049822	Bacteria	1499
370	Ga0501035_1362904	3300049822	Bacteria	545
371	Ga0501044_0091594	3300049823	Bacteria	3067
372	Ga0501044_0122213	3300049823	Bacteria	2603
373	Ga0501044_0161810	3300049823	Bacteria	2214
374	Ga0501044_0288016	3300049823	Bacteria	1574
375	Ga0501044_0336310	3300049823	Bacteria	1431
376	Ga0501044_0417769	3300049823	Bacteria	1252
377	Ga0501044_0651791	3300049823	Bacteria	942
378	Ga0501045_0214116	3300049824	Bacteria	1435
379	Ga0501045_0275968	3300049824	Bacteria	1251
380	Ga0501045_0583753	3300049824	Bacteria	828
381	nmdc:mga05p37_9132_c1	3300050507	Bacteria	11720
382	nmdc:mga09592_73904_c1	3300050508	Bacteria	2897
383	nmdc:mga06r32_1761292_c1	3300050510	Archaea	556
384	nmdc:mga08y16_218255_c1	3300050511	Bacteria	1975
385	nmdc:mga0rr50_131289_c1	3300050513	Bacteria	2006
386	nmdc:mga0a205_281730_c1	3300050515	Bacteria	1538
387	Ga0500578_0078063	3300053086	Bacteria	2107
388	Ga0500583_0199436	3300053092	Bacteria	995
389	Ga0500566_0150046	3300053094	Bacteria	1227
390	Ga0500654_025675	3300053099	Bacteria	3666
391	Ga0500660_079735	3300053100	Bacteria	1503
392	Ga0500553_017623	3300053101	Bacteria	3619
393	Ga0500560_001146	3300053107	Bacteria	4371
394	Ga0500560_151141	3300053107	Bacteria	771
395	Ga0500569_011311	3300053109	Bacteria	2127
396	Ga0500594_0108814	3300053118	Bacteria	860
397	Ga0500614_005941	3300053123	Bacteria	2564
398	Ga0500628_001377	3300053129	Bacteria	4180
399	Ga0500652_004720	3300053131	Bacteria	4238
400	Ga0500658_0006015	3300053134	Bacteria	4509
401	Ga0500561_0003415	3300053137	Bacteria	2776
402	Ga0500573_0106427	3300053140	Bacteria	1574
403	Ga0500579_080885	3300053143	Bacteria	1817
404	Ga0500600_0016863	3300053149	Bacteria	4415
405	Ga0500603_237322	3300053150	Bacteria	584
406	Ga0500616_0032406	3300053153	Bacteria	2857
407	Ga0500633_0024754	3300053160	Bacteria	1868
408	Ga0500634_0062339	3300053161	Bacteria	1975
409	Ga0500636_0350231	3300053177	Bacteria	705
410	Ga0500656_009328	3300053732	Bacteria	1054
411	Ga0500587_006837	3300053739	Bacteria	1500
412	Ga0466962_0058463	3300061719	Bacteria	1840
413	Ga0466962_0134700	3300061719	Bacteria	1195
414	Ga0466962_0521424	3300061719	Bacteria	602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005329	Ga0070683_101811936	Ga0070683_1018119361	56
2	3300005365	Ga0070688_101580315	Ga0070688_1015803152	56
3	3300005530	Ga0070679_100492359	Ga0070679_1004923592	56
4	3300005535	Ga0070684_100361566	Ga0070684_1003615662	56
5	3300005547	Ga0070693_100653147	Ga0070693_1006531472	56
6	3300005548	Ga0070665_100182630	Ga0070665_1001826302	56
7	3300005548	Ga0070665_100655049	Ga0070665_1006550492	56
8	3300005616	Ga0068852_102645416	Ga0068852_1026454162	56
9	3300005985	Ga0081539_10034115	Ga0081539_100341151	56
10	3300006042	Ga0075368_10494945	Ga0075368_104949452	56
11	3300006844	Ga0075428_102205526	Ga0075428_1022055262	56
12	3300013105	Ga0157369_11882204	Ga0157369_118822042	56
13	3300013296	Ga0157374_11195821	Ga0157374_111958212	56
14	3300013307	Ga0157372_10211710	Ga0157372_102117102	56
15	3300013307	Ga0157372_11999231	Ga0157372_119992312	56
16	3300013307	Ga0157372_12261274	Ga0157372_122612742	56
17	3300020082	Ga0206353_11532621	Ga0206353_115326212	56
18	3300021377	Ga0213874_10270494	Ga0213874_102704942	56
19	3300025918	Ga0207662_10750945	Ga0207662_107509452	56
20	3300025921	Ga0207652_10178964	Ga0207652_101789642	56
21	3300025944	Ga0207661_10558831	Ga0207661_105588311	56
22	3300025944	Ga0207661_11929354	Ga0207661_119293541	56
23	3300026121	Ga0207683_11472215	Ga0207683_114722151	56
24	3300028379	Ga0268266_10331560	Ga0268266_103315601	56
25	3300028379	Ga0268266_10666009	Ga0268266_106660092	56
26	3300030745	Ga0316182_1036434	Ga0316182_10364342	56
27	3300031728	Ga0316578_10411489	Ga0316578_104114892	56
28	3300031728	Ga0316578_10644119	Ga0316578_106441192	56
29	3300031824	Ga0307413_10358466	Ga0307413_103584662	56
30	3300031901	Ga0307406_10555153	Ga0307406_105551532	56
31	3300031903	Ga0307407_10661524	Ga0307407_106615242	56
32	3300031995	Ga0307409_100237417	Ga0307409_1002374172	56
33	3300032002	Ga0307416_103074073	Ga0307416_1030740732	56
34	3300032005	Ga0307411_10177827	Ga0307411_101778272	56
35	3300032139	Ga0316580_10009703	Ga0316580_100097033	56
36	3300035398	Ga0316574_0213660	Ga0316574_0213660_853_1023	56
37	3300036712	Ga0316584_0588403	Ga0316584_0588403_299_469	56
38	3300039450	Ga0436363_0508075	Ga0436363_0508075_368_550	56
39	3300039450	Ga0436363_1025567	Ga0436363_1025567_383_565	56
40	3300041456	Ga0451795_0404559	Ga0451795_0404559_225_398	56
41	3300041501	Ga0451845_0742789	Ga0451845_0742789_215_388	56
42	3300041505	Ga0451849_0888281	Ga0451849_0888281_14_187	56
43	3300041511	Ga0451855_0693929	Ga0451855_0693929_430_603	56
44	3300044683	Ga0466965_0136898	Ga0466965_0136898_654_827	56
45	3300044694	Ga0466963_0393117	Ga0466963_0393117_552_731	56
46	3300044694	Ga0466963_1306281	Ga0466963_1306281_164_346	56
47	3300048911	Ga0496108_0171511	Ga0496108_0171511_498_671	56
48	3300048912	Ga0496109_0470970	Ga0496109_0470970_364_537	56
49	3300003316	rootH1_10101434	rootH1_101014341	57
50	3300003578	Ga0006562J51391_1011583	Ga0006562J51391_10115831	57
51	3300005327	Ga0070658_11314081	Ga0070658_113140812	57
52	3300005329	Ga0070683_100444820	Ga0070683_1004448202	57
53	3300005336	Ga0070680_100277458	Ga0070680_1002774583	57
54	3300005356	Ga0070674_101668383	Ga0070674_1016683832	57
55	3300005366	Ga0070659_101105266	Ga0070659_1011052661	57
56	3300005458	Ga0070681_11155240	Ga0070681_111552402	57
57	3300005458	Ga0070681_12037760	Ga0070681_120377601	57
58	3300005530	Ga0070679_100273060	Ga0070679_1002730602	57
59	3300005530	Ga0070679_101739572	Ga0070679_1017395722	57
60	3300005578	Ga0068854_100578929	Ga0068854_1005789292	57
61	3300005616	Ga0068852_100468318	Ga0068852_1004683182	57
62	3300006051	Ga0075364_10784688	Ga0075364_107846882	57
63	3300009093	Ga0105240_10607771	Ga0105240_106077712	57
64	3300009148	Ga0105243_10959135	Ga0105243_109591352	57
65	3300009176	Ga0105242_13238748	Ga0105242_132387482	57
66	3300009545	Ga0105237_11972546	Ga0105237_119725462	57
67	3300009551	Ga0105238_11112786	Ga0105238_111127862	57
68	3300009553	Ga0105249_13411542	Ga0105249_134115422	57
69	3300011119	Ga0105246_10493893	Ga0105246_104938932	57
70	3300013104	Ga0157370_10184719	Ga0157370_101847192	57
71	3300013105	Ga0157369_11058291	Ga0157369_110582912	57
72	3300013105	Ga0157369_11584610	Ga0157369_115846102	57
73	3300013306	Ga0163162_10059188	Ga0163162_100591882	57
74	3300013307	Ga0157372_12146819	Ga0157372_121468191	57
75	3300013308	Ga0157375_10520263	Ga0157375_105202632	57
76	3300014325	Ga0163163_12644432	Ga0163163_126444322	57
77	3300020081	Ga0206354_11097840	Ga0206354_110978402	57
78	3300020082	Ga0206353_10022693	Ga0206353_100226932	57
79	3300020082	Ga0206353_10376169	Ga0206353_103761692	57
80	3300020082	Ga0206353_11559225	Ga0206353_115592253	57
81	3300020082	Ga0206353_11677328	Ga0206353_116773282	57
82	3300021384	Ga0213876_10004576	Ga0213876_100045765	57
83	3300021388	Ga0213875_10042673	Ga0213875_100426732	57
84	3300022467	Ga0224712_10083796	Ga0224712_100837962	57
85	3300025917	Ga0207660_10696942	Ga0207660_106969422	57
86	3300025921	Ga0207652_10173825	Ga0207652_101738253	57
87	3300025924	Ga0207694_11337193	Ga0207694_113371932	57
88	3300025924	Ga0207694_11871274	Ga0207694_118712742	57
89	3300025932	Ga0207690_11366227	Ga0207690_113662271	57
90	3300025935	Ga0207709_10626412	Ga0207709_106264122	57
91	3300026078	Ga0207702_10414895	Ga0207702_104148951	57
92	3300026078	Ga0207702_11848786	Ga0207702_118487862	57
93	3300026142	Ga0207698_10720422	Ga0207698_107204222	57
94	3300026142	Ga0207698_11260135	Ga0207698_112601352	57
95	3300027665	Ga0209983_1094000	Ga0209983_10940002	57
96	3300028573	Ga0265334_10043060	Ga0265334_100430602	57
97	3300028800	Ga0265338_10014388	Ga0265338_100143888	57
98	3300030744	Ga0316181_1103335	Ga0316181_11033351	57
99	3300031240	Ga0265320_10254692	Ga0265320_102546922	57
100	3300031241	Ga0265325_10009200	Ga0265325_100092004	57
101	3300031242	Ga0265329_10351499	Ga0265329_103514992	57
102	3300031247	Ga0265340_10005497	Ga0265340_100054977	57
103	3300031249	Ga0265339_10041985	Ga0265339_100419852	57
104	3300031595	Ga0265313_10016431	Ga0265313_100164312	57
105	3300031711	Ga0265314_10179767	Ga0265314_101797672	57
106	3300031712	Ga0265342_10045628	Ga0265342_100456282	57
107	3300031995	Ga0307409_101299693	Ga0307409_1012996931	57
108	3300032002	Ga0307416_102075359	Ga0307416_1020753592	57
109	3300035398	Ga0316574_0246712	Ga0316574_0246712_383_559	57
110	3300037312	Ga0395899_0002079	Ga0395899_0002079_11455_11631	57
111	3300037418	Ga0395900_0047960	Ga0395900_0047960_896_1072	57
112	3300037466	Ga0395898_0036820	Ga0395898_0036820_418_594	57
113	3300037853	Ga0436364_1158925	Ga0436364_1158925_1466_1642	57
114	3300038443	Ga0395901_0007985	Ga0395901_0007985_146_328	57
115	3300038443	Ga0395901_0779853	Ga0395901_0779853_291_467	57
116	3300038443	Ga0395901_1132049	Ga0395901_1132049_354_530	57
117	3300038443	Ga0395901_1363815	Ga0395901_1363815_339_521	57
118	3300039437	Ga0436365_1781586	Ga0436365_1781586_48774_48950	57
119	3300041410	Ga0439461_0069671	Ga0439461_0069671_276_452	57
120	3300041411	Ga0439466_0171791	Ga0439466_0171791_248_424	57
121	3300041413	Ga0439465_0087977	Ga0439465_0087977_288_464	57
122	3300041460	Ga0451802_0530537	Ga0451802_0530537_257_433	57
123	3300041496	Ga0451839_1121803	Ga0451839_1121803_53_235	57
124	3300041507	Ga0451851_0476986	Ga0451851_0476986_448_624	57
125	3300041509	Ga0451843_1341546	Ga0451843_1341546_304_480	57
126	3300042004	Ga0439445_0017476	Ga0439445_0017476_454_630	57
127	3300044656	Ga0466969_0069156	Ga0466969_0069156_1444_1626	57
128	3300044683	Ga0466965_0083830	Ga0466965_0083830_106_282	57
129	3300044683	Ga0466965_0178716	Ga0466965_0178716_829_1005	57
130	3300044693	Ga0466961_0370705	Ga0466961_0370705_173_349	57
131	3300044693	Ga0466961_0440950	Ga0466961_0440950_146_328	57
132	3300044694	Ga0466963_0137639	Ga0466963_0137639_817_993	57
133	3300044694	Ga0466963_0326944	Ga0466963_0326944_497_673	57
134	3300044694	Ga0466963_0742327	Ga0466963_0742327_360_542	57
135	3300044706	Ga0466964_0031537	Ga0466964_0031537_1828_2004	57
136	3300044706	Ga0466964_0126560	Ga0466964_0126560_927_1103	57
137	3300044706	Ga0466964_0613040	Ga0466964_0613040_357_533	57
138	3300044719	Ga0466971_0109120	Ga0466971_0109120_517_693	57
139	3300044719	Ga0466971_0242503	Ga0466971_0242503_367_549	57
140	3300044719	Ga0466971_0380240	Ga0466971_0380240_390_572	57
141	3300044842	Ga0466957_0003241	Ga0466957_0003241_5389_5565	57
142	3300044842	Ga0466957_0019156	Ga0466957_0019156_1693_1875	57
143	3300044842	Ga0466957_0047487	Ga0466957_0047487_577_753	57
144	3300044842	Ga0466957_0048396	Ga0466957_0048396_398_574	57
145	3300044901	Ga0466960_0086191	Ga0466960_0086191_402_578	57
146	3300044901	Ga0466960_0170174	Ga0466960_0170174_931_1113	57
147	3300045049	Ga0466959_0193696	Ga0466959_0193696_977_1159	57
148	3300045049	Ga0466959_1189681	Ga0466959_1189681_73_255	57
149	3300045836	Ga0466958_0003446	Ga0466958_0003446_3206_3382	57
150	3300045836	Ga0466958_0650203	Ga0466958_0650203_213_395	57
151	3300045836	Ga0466958_1130833	Ga0466958_1130833_311_493	57
152	3300045976	Ga0466967_0008571	Ga0466967_0008571_4654_4830	57
153	3300045976	Ga0466967_0194837	Ga0466967_0194837_1483_1665	57
154	3300045976	Ga0466967_0240852	Ga0466967_0240852_706_882	57
155	3300045976	Ga0466967_0467340	Ga0466967_0467340_1015_1197	57
156	3300045976	Ga0466967_0673579	Ga0466967_0673579_483_659	57
157	3300045976	Ga0466967_1869177	Ga0466967_1869177_30_212	57
158	3300045976	Ga0466967_2558451	Ga0466967_2558451_212_388	57
159	3300046459	Ga0495629_0920904	Ga0495629_0920904_325_501	57
160	3300046683	Ga0495658_0030509	Ga0495658_0030509_867_1043	57
161	3300048903	Ga0496100_0107062	Ga0496100_0107062_534_710	57
162	3300048903	Ga0496100_0515980	Ga0496100_0515980_29_205	57
163	3300048904	Ga0496101_0022546	Ga0496101_0022546_2446_2622	57
164	3300048904	Ga0496101_1424349	Ga0496101_1424349_10_186	57
165	3300048905	Ga0496102_0163596	Ga0496102_0163596_1227_1403	57
166	3300048905	Ga0496102_0399004	Ga0496102_0399004_343_519	57
167	3300048905	Ga0496102_1380286	Ga0496102_1380286_43_225	57
168	3300048907	Ga0496104_0043132	Ga0496104_0043132_2962_3138	57
169	3300048908	Ga0496105_0072256	Ga0496105_0072256_159_335	57
170	3300048909	Ga0496106_1580991	Ga0496106_1580991_145_321	57
171	3300048910	Ga0496107_0519944	Ga0496107_0519944_575_751	57
172	3300048911	Ga0496108_0186539	Ga0496108_0186539_715_891	57
173	3300048912	Ga0496109_0018348	Ga0496109_0018348_3400_3576	57
174	3300048912	Ga0496109_2073122	Ga0496109_2073122_193_369	57
175	3300048913	Ga0496110_0029567	Ga0496110_0029567_592_768	57
176	3300048913	Ga0496110_0043306	Ga0496110_0043306_89_265	57
177	3300048913	Ga0496110_0072039	Ga0496110_0072039_1097_1273	57
178	3300048914	Ga0496111_0049148	Ga0496111_0049148_1795_1971	57
179	3300048914	Ga0496111_0240907	Ga0496111_0240907_1050_1226	57
180	3300048916	Ga0496113_0384280	Ga0496113_0384280_116_292	57
181	3300048916	Ga0496113_0425053	Ga0496113_0425053_42_218	57
182	3300048916	Ga0496113_0476371	Ga0496113_0476371_750_926	57
183	3300048916	Ga0496113_0621812	Ga0496113_0621812_633_809	57
184	3300048917	Ga0496114_0137962	Ga0496114_0137962_1734_1910	57
185	3300048917	Ga0496114_0453670	Ga0496114_0453670_38_214	57
186	3300048917	Ga0496114_0729410	Ga0496114_0729410_632_808	57
187	3300048918	Ga0496115_0496978	Ga0496115_0496978_15_191	57
188	3300049573	Ga0501037_0125972	Ga0501037_0125972_1585_1761	57
189	3300049579	Ga0501043_0794455	Ga0501043_0794455_223_399	57
190	3300049582	Ga0501048_1344832	Ga0501048_1344832_111_287	57
191	3300049585	Ga0501069_0991670	Ga0501069_0991670_318_494	57
192	3300061719	Ga0466962_0058463	Ga0466962_0058463_1517_1693	57
193	3300061719	Ga0466962_0134700	Ga0466962_0134700_556_738	57
194	3300061719	Ga0466962_0521424	Ga0466962_0521424_148_324	57
195	3300003320	rootH2_10087668	rootH2_100876685	58
196	3300005338	Ga0068868_100324794	Ga0068868_1003247942	58
197	3300005340	Ga0070689_102104958	Ga0070689_1021049581	58
198	3300005345	Ga0070692_10061468	Ga0070692_100614682	58
199	3300005347	Ga0070668_100628376	Ga0070668_1006283762	58
200	3300005356	Ga0070674_100865303	Ga0070674_1008653031	58
201	3300005441	Ga0070700_101780486	Ga0070700_1017804862	58
202	3300005467	Ga0070706_100921258	Ga0070706_1009212582	58
203	3300005545	Ga0070695_100313160	Ga0070695_1003131602	58
204	3300005718	Ga0068866_10496311	Ga0068866_104963112	58
205	3300005719	Ga0068861_100082438	Ga0068861_1000824382	58
206	3300005843	Ga0068860_100434108	Ga0068860_1004341082	58
207	3300005844	Ga0068862_101011193	Ga0068862_1010111932	58
208	3300005937	Ga0081455_10046585	Ga0081455_100465852	58
209	3300006058	Ga0075432_10003973	Ga0075432_100039733	58
210	3300006194	Ga0075427_10030475	Ga0075427_100304752	58
211	3300006844	Ga0075428_100043884	Ga0075428_1000438842	58
212	3300006844	Ga0075428_101045021	Ga0075428_1010450212	58
213	3300006846	Ga0075430_100362499	Ga0075430_1003624992	58
214	3300006847	Ga0075431_100244939	Ga0075431_1002449392	58
215	3300006852	Ga0075433_10013825	Ga0075433_100138252	58
216	3300006871	Ga0075434_100004274	Ga0075434_1000042743	58
217	3300006880	Ga0075429_100014004	Ga0075429_1000140043	58
218	3300006881	Ga0068865_100467778	Ga0068865_1004677782	58
219	3300007076	Ga0075435_100170147	Ga0075435_1001701471	58
220	3300007076	Ga0075435_101865774	Ga0075435_1018657741	58
221	3300009094	Ga0111539_10032233	Ga0111539_100322332	58
222	3300009094	Ga0111539_10389180	Ga0111539_103891802	58
223	3300009098	Ga0105245_10084151	Ga0105245_100841512	58
224	3300009147	Ga0114129_10995471	Ga0114129_109954712	58
225	3300009148	Ga0105243_10082288	Ga0105243_100822882	58
226	3300009176	Ga0105242_11052254	Ga0105242_110522542	58
227	3300009176	Ga0105242_12159903	Ga0105242_121599032	58
228	3300009176	Ga0105242_13273142	Ga0105242_132731422	58
229	3300009553	Ga0105249_10008669	Ga0105249_100086694	58
230	3300009553	Ga0105249_10338241	Ga0105249_103382411	58
231	3300009553	Ga0105249_12101206	Ga0105249_121012062	58
232	3300010375	Ga0105239_10404720	Ga0105239_104047202	58
233	3300013105	Ga0157369_10451971	Ga0157369_104519712	58
234	3300017792	Ga0163161_10161153	Ga0163161_101611532	58
235	3300025901	Ga0207688_10039400	Ga0207688_100394002	58
236	3300025904	Ga0207647_10445979	Ga0207647_104459791	58
237	3300025907	Ga0207645_10660725	Ga0207645_106607252	58
238	3300025919	Ga0207657_11069567	Ga0207657_110695672	58
239	3300025927	Ga0207687_10407611	Ga0207687_104076112	58
240	3300025932	Ga0207690_11299955	Ga0207690_112999551	58
241	3300025933	Ga0207706_10341710	Ga0207706_103417102	58
242	3300025934	Ga0207686_11421510	Ga0207686_114215102	58
243	3300025935	Ga0207709_10694495	Ga0207709_106944952	58
244	3300025935	Ga0207709_11837063	Ga0207709_118370631	58
245	3300025938	Ga0207704_10034946	Ga0207704_100349462	58
246	3300025940	Ga0207691_10384965	Ga0207691_103849652	58
247	3300025944	Ga0207661_10641819	Ga0207661_106418191	58
248	3300025961	Ga0207712_11819910	Ga0207712_118199102	58
249	3300025972	Ga0207668_10241465	Ga0207668_102414652	58
250	3300025972	Ga0207668_11620885	Ga0207668_116208852	58
251	3300025981	Ga0207640_11936873	Ga0207640_119368732	58
252	3300026023	Ga0207677_10189491	Ga0207677_101894912	58
253	3300026041	Ga0207639_10199667	Ga0207639_101996673	58
254	3300026118	Ga0207675_100015584	Ga0207675_1000155843	58
255	3300027907	Ga0207428_10002017	Ga0207428_1000201711	58
256	3300028380	Ga0268265_10205217	Ga0268265_102052172	58
257	3300028381	Ga0268264_10744128	Ga0268264_107441281	58
258	3300035114	Ga0373939_0106136	Ga0373939_0106136_34_213	58
259	3300035691	Ga0373931_1057955	Ga0373931_1057955_274_453	58
260	3300037418	Ga0395900_0592604	Ga0395900_0592604_600_785	58
261	3300041413	Ga0439465_0269195	Ga0439465_0269195_395_574	58
262	3300042005	Ga0439448_0240874	Ga0439448_0240874_389_568	58
263	3300042016	Ga0439463_008951	Ga0439463_008951_1581_1760	58
264	3300042461	Ga0439460_0051632	Ga0439460_0051632_148_327	58
265	3300044656	Ga0466969_0000565	Ga0466969_0000565_18364_18543	58
266	3300044684	Ga0466966_0000572	Ga0466966_0000572_17815_17994	58
267	3300044693	Ga0466961_0008194	Ga0466961_0008194_6449_6628	58
268	3300044694	Ga0466963_0627338	Ga0466963_0627338_464_643	58
269	3300045049	Ga0466959_0010633	Ga0466959_0010633_6395_6574	58
270	3300045976	Ga0466967_1613291	Ga0466967_1613291_296_481	58
271	3300045976	Ga0466967_2076887	Ga0466967_2076887_23_202	58
272	3300048907	Ga0496104_1500723	Ga0496104_1500723_360_539	58
273	3300048913	Ga0496110_0319324	Ga0496110_0319324_771_950	58
274	3300048913	Ga0496110_0678117	Ga0496110_0678117_699_878	58
275	3300048914	Ga0496111_1116813	Ga0496111_1116813_48_227	58
276	3300049513	Ga0501290_106862	Ga0501290_106862_32_211	58
277	3300049568	Ga0501031_0086181	Ga0501031_0086181_167_346	58
278	3300049569	Ga0501032_0089916	Ga0501032_0089916_683_862	58
279	3300049570	Ga0501033_0137543	Ga0501033_0137543_960_1139	58
280	3300049571	Ga0501034_0213975	Ga0501034_0213975_313_492	58
281	3300049572	Ga0501036_0416768	Ga0501036_0416768_198_377	58
282	3300049572	Ga0501036_0525933	Ga0501036_0525933_286_465	58
283	3300049574	Ga0501038_0177379	Ga0501038_0177379_66_245	58
284	3300049575	Ga0501039_0334390	Ga0501039_0334390_963_1142	58
285	3300049579	Ga0501043_0137172	Ga0501043_0137172_371_550	58
286	3300049581	Ga0501047_0235236	Ga0501047_0235236_1401_1580	58
287	3300049590	Ga0501074_0313203	Ga0501074_0313203_861_1040	58
288	3300049741	Ga0501079_1522091	Ga0501079_1522091_306_485	58
289	3300049822	Ga0501035_0133398	Ga0501035_0133398_640_819	58
290	3300049822	Ga0501035_1362904	Ga0501035_1362904_259_438	58
291	3300049823	Ga0501044_0336310	Ga0501044_0336310_1155_1334	58
292	3300049824	Ga0501045_0214116	Ga0501045_0214116_1187_1366	58
293	3300050507	nmdc:mga05p37_9132_c1	nmdc:mga05p37_9132_c1_5456_5635	58
294	3300050508	nmdc:mga09592_73904_c1	nmdc:mga09592_73904_c1_1215_1394	58
295	3300050510	nmdc:mga06r32_1761292_c1	nmdc:mga06r32_1761292_c1_178_357	58
296	3300050511	nmdc:mga08y16_218255_c1	nmdc:mga08y16_218255_c1_738_917	58
297	3300050513	nmdc:mga0rr50_131289_c1	nmdc:mga0rr50_131289_c1_490_669	58
298	3300050515	nmdc:mga0a205_281730_c1	nmdc:mga0a205_281730_c1_1340_1519	58
299	3300003203	JGI25406J46586_10017149	JGI25406J46586_100171492	59
300	3300005985	Ga0081539_10000270	Ga0081539_1000027018	59
301	3300011119	Ga0105246_11858505	Ga0105246_118585052	59
302	3300025981	Ga0207640_11846156	Ga0207640_118461562	59
303	3300026088	Ga0207641_10113610	Ga0207641_101136103	59
304	3300026095	Ga0207676_10930296	Ga0207676_109302962	59
305	3300028786	Ga0307517_10010328	Ga0307517_100103289	59
306	3300030521	Ga0307511_10086649	Ga0307511_100866492	59
307	3300031507	Ga0307509_10214599	Ga0307509_102145992	59
308	3300031616	Ga0307508_10027614	Ga0307508_100276142	59
309	3300031649	Ga0307514_10068839	Ga0307514_100688392	59
310	3300031730	Ga0307516_10073459	Ga0307516_100734592	59
311	3300032002	Ga0307416_101841840	Ga0307416_1018418402	59
312	3300033179	Ga0307507_10168244	Ga0307507_101682442	59
313	3300044683	Ga0466965_0911570	Ga0466965_0911570_57_248	59
314	3300044735	Ga0466968_0091791	Ga0466968_0091791_714_905	59
315	3300046459	Ga0495629_0113624	Ga0495629_0113624_831_1013	59
316	3300046460	Ga0495638_0124909	Ga0495638_0124909_447_629	59
317	3300046461	Ga0495641_0302595	Ga0495641_0302595_405_587	59
318	3300046492	Ga0495585_0022385	Ga0495585_0022385_2476_2658	59
319	3300046492	Ga0495585_0212977	Ga0495585_0212977_80_262	59
320	3300046499	Ga0495594_0305486	Ga0495594_0305486_627_809	59
321	3300046511	Ga0495608_0819154	Ga0495608_0819154_81_260	59
322	3300046518	Ga0495631_0185956	Ga0495631_0185956_681_863	59
323	3300046519	Ga0495632_0118326	Ga0495632_0118326_673_855	59
324	3300046522	Ga0495643_0004602	Ga0495643_0004602_3664_3846	59
325	3300046526	Ga0495666_0028380	Ga0495666_0028380_1247_1429	59
326	3300046533	Ga0495640_0010301	Ga0495640_0010301_1800_1982	59
327	3300046542	Ga0495597_0143520	Ga0495597_0143520_220_402	59
328	3300046558	Ga0495633_0394395	Ga0495633_0394395_179_361	59
329	3300046615	Ga0495656_0656579	Ga0495656_0656579_19_201	59
330	3300046616	Ga0495668_0137956	Ga0495668_0137956_689_871	59
331	3300046648	Ga0495611_0205137	Ga0495611_0205137_126_308	59
332	3300046663	Ga0495635_0281048	Ga0495635_0281048_169_351	59
333	3300046674	Ga0495588_0516080	Ga0495588_0516080_413_595	59
334	3300046681	Ga0495647_0565064	Ga0495647_0565064_155_343	59
335	3300046683	Ga0495658_0028335	Ga0495658_0028335_2005_2187	59
336	3300046689	Ga0495613_0211107	Ga0495613_0211107_744_926	59
337	3300046689	Ga0495613_0370948	Ga0495613_0370948_621_806	59
338	3300046690	Ga0495624_0043982	Ga0495624_0043982_779_961	59
339	3300046691	Ga0495670_0006990	Ga0495670_0006990_1603_1785	59
340	3300046694	Ga0495649_0135724	Ga0495649_0135724_855_1037	59
341	3300046794	Ga0495589_0013884	Ga0495589_0013884_1812_1994	59
342	3300046810	Ga0495660_0029819	Ga0495660_0029819_1893_2075	59
343	3300047317	Ga0495604_0442966	Ga0495604_0442966_594_776	59
344	3300047322	Ga0495680_0148041	Ga0495680_0148041_883_1062	59
345	3300047323	Ga0495683_0232723	Ga0495683_0232723_616_798	59
346	3300047443	Ga0495687_055387	Ga0495687_055387_1074_1256	59
347	3300047446	Ga0495679_112782	Ga0495679_112782_508_690	59
348	3300047447	Ga0495685_001026	Ga0495685_001026_4262_4444	59
349	3300047470	Ga0495681_0004644	Ga0495681_0004644_3950_4132	59
350	3300047472	Ga0495686_0237386	Ga0495686_0237386_29_211	59
351	3300048089	Ga0495614_0278326	Ga0495614_0278326_216_398	59
352	3300048091	Ga0495626_0313473	Ga0495626_0313473_118_300	59
353	3300049568	Ga0501031_0018982	Ga0501031_0018982_328_510	59
354	3300049568	Ga0501031_0325023	Ga0501031_0325023_48_230	59
355	3300049569	Ga0501032_0081770	Ga0501032_0081770_452_637	59
356	3300049570	Ga0501033_0179720	Ga0501033_0179720_561_743	59
357	3300049570	Ga0501033_0975007	Ga0501033_0975007_311_496	59
358	3300049571	Ga0501034_0045615	Ga0501034_0045615_1565_1747	59
359	3300049571	Ga0501034_1378483	Ga0501034_1378483_167_352	59
360	3300049572	Ga0501036_0079894	Ga0501036_0079894_2529_2714	59
361	3300049572	Ga0501036_0232327	Ga0501036_0232327_739_921	59
362	3300049573	Ga0501037_0018107	Ga0501037_0018107_1197_1394	59
363	3300049573	Ga0501037_0371236	Ga0501037_0371236_760_942	59
364	3300049574	Ga0501038_0202093	Ga0501038_0202093_16_198	59
365	3300049574	Ga0501038_0817903	Ga0501038_0817903_141_326	59
366	3300049575	Ga0501039_0044503	Ga0501039_0044503_184_369	59
367	3300049578	Ga0501042_0013015	Ga0501042_0013015_572_769	59
368	3300049579	Ga0501043_0157613	Ga0501043_0157613_941_1123	59
369	3300049579	Ga0501043_0285793	Ga0501043_0285793_163_348	59
370	3300049580	Ga0501046_0049005	Ga0501046_0049005_1360_1542	59
371	3300049581	Ga0501047_0000046	Ga0501047_0000046_127495_127692	59
372	3300049581	Ga0501047_0023407	Ga0501047_0023407_1733_1915	59
373	3300049581	Ga0501047_0045024	Ga0501047_0045024_1727_1912	59
374	3300049581	Ga0501047_0226811	Ga0501047_0226811_1055_1237	59
375	3300049584	Ga0501068_0441630	Ga0501068_0441630_586_771	59
376	3300049585	Ga0501069_0179946	Ga0501069_0179946_88_270	59
377	3300049586	Ga0501070_0161306	Ga0501070_0161306_1251_1436	59
378	3300049822	Ga0501035_0013908	Ga0501035_0013908_18_203	59
379	3300049822	Ga0501035_0067421	Ga0501035_0067421_858_1040	59
380	3300049822	Ga0501035_0165199	Ga0501035_0165199_18_203	59
381	3300049822	Ga0501035_0251939	Ga0501035_0251939_664_861	59
382	3300049823	Ga0501044_0091594	Ga0501044_0091594_1102_1299	59
383	3300049823	Ga0501044_0122213	Ga0501044_0122213_1111_1293	59
384	3300049823	Ga0501044_0161810	Ga0501044_0161810_1263_1448	59
385	3300049823	Ga0501044_0288016	Ga0501044_0288016_880_1065	59
386	3300049823	Ga0501044_0417769	Ga0501044_0417769_960_1142	59
387	3300049823	Ga0501044_0651791	Ga0501044_0651791_144_329	59
388	3300049824	Ga0501045_0275968	Ga0501045_0275968_170_355	59
389	3300049824	Ga0501045_0583753	Ga0501045_0583753_183_365	59
390	3300053086	Ga0500578_0078063	Ga0500578_0078063_635_817	59
391	3300053092	Ga0500583_0199436	Ga0500583_0199436_768_950	59
392	3300053094	Ga0500566_0150046	Ga0500566_0150046_819_1001	59
393	3300053099	Ga0500654_025675	Ga0500654_025675_2741_2923	59
394	3300053100	Ga0500660_079735	Ga0500660_079735_1050_1232	59
395	3300053101	Ga0500553_017623	Ga0500553_017623_2507_2689	59
396	3300053107	Ga0500560_001146	Ga0500560_001146_1732_1914	59
397	3300053107	Ga0500560_151141	Ga0500560_151141_147_329	59
398	3300053109	Ga0500569_011311	Ga0500569_011311_1138_1320	59
399	3300053118	Ga0500594_0108814	Ga0500594_0108814_212_394	59
400	3300053123	Ga0500614_005941	Ga0500614_005941_261_443	59
401	3300053129	Ga0500628_001377	Ga0500628_001377_3534_3716	59
402	3300053131	Ga0500652_004720	Ga0500652_004720_961_1143	59
403	3300053134	Ga0500658_0006015	Ga0500658_0006015_963_1145	59
404	3300053137	Ga0500561_0003415	Ga0500561_0003415_1604_1786	59
405	3300053140	Ga0500573_0106427	Ga0500573_0106427_137_319	59
406	3300053143	Ga0500579_080885	Ga0500579_080885_874_1056	59
407	3300053149	Ga0500600_0016863	Ga0500600_0016863_3103_3285	59
408	3300053150	Ga0500603_237322	Ga0500603_237322_175_357	59
409	3300053153	Ga0500616_0032406	Ga0500616_0032406_1820_2002	59
410	3300053160	Ga0500633_0024754	Ga0500633_0024754_676_858	59
411	3300053161	Ga0500634_0062339	Ga0500634_0062339_1131_1313	59
412	3300053177	Ga0500636_0350231	Ga0500636_0350231_72_254	59
413	3300053732	Ga0500656_009328	Ga0500656_009328_46_228	59
414	3300053739	Ga0500587_006837	Ga0500587_006837_321_503	59

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19599

DUF6104

Family of unknown function (DUF6104)

13

69

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6t90-assembly1.cif.gz_F	oct4-sox2-bound nucleosome - shl-6	0.3364	4	47
8eu2-assembly1.cif.gz_L	class3 of the ino80-hexasome complex	0.3186	6	52
7xyf-assembly1.cif.gz_B	cryo-em structure of fft3-nucleosome complex with fft3 bound to shl+2 position of the nucleosome	0.3184	4	48
7a08-assembly1.cif.gz_i	cryoem structure of cgas nucleosome complex	0.3052	4	52
6t90-assembly1.cif.gz_B	oct4-sox2-bound nucleosome - shl-6	0.2932	4	51

ID	Description	Score	Start	End	Superfamily
af_Q2G2V2_5_286_3.20.20.120	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain	0.45	5	37	3.20.20.120
2rkhA02	Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain	0.3574	5	52	1.20.1280.20
af_P96855_573_711_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.3332	1	51	1.20.140.10
3lelB00	Mainly Alpha;Orthogonal Bundle;Histone, subunit A;Histone, subunit A	0.3043	4	52	1.10.20.10
af_Q2G2V2_5_286_3.20.20.120	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain	0.303	5	37	3.20.20.120

ID	Description	Score	Start	End
AF-A0A1Y2MZE3-F1-model_v4	Uncharacterized protein	0.8408	1	58
AF-A0A7V9LXE8-F1-model_v4	Uncharacterized protein	0.8392	1	51
AF-A0A4V6MG83-F1-model_v4	deleted	0.839	1	57
AF-A0A239WRH2-F1-model_v4	Uncharacterized protein	0.8356	1	57
AF-A0A1J5PNQ8-F1-model_v4	Uncharacterized protein	0.8344	1	57

Feature Viewer

pLDDT	pTM	Quality
83.76	0.63	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F438280

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF19599

DUF6104

Family of unknown function (DUF6104)

13

69

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map