F438268

General Info

Members Datasets Scaffolds Average Seq Length
414 213 828 312

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100000933|Ga0070699_10000093310
Length 345
Sequence MLNGLNCTSRQKCTSVHQRVQRCHNLSANRYAILSAMKRIFVIAIAVFALLATVRAQELAKSVAERLGYPRDAKLLIVHADDLGMAHSVNVATMKALGTGLVNSGSIMVPCPWLSEIATYARANPQADLGLHLTLTSEWTNFRWGPVSSRDRVSSLLDKDGYFYLTETDAAAHADPKQVELEIMAQIEKARALGIQPTHLDSHMGTLYQNKALFEVLLRVARSQKLPVRVARTWFTQADFLPETLRQDDVYIDRVLDINPGVAPQDWARFYSDALKKLEPGVTEVVIHLAYDDAEMQGATFNHPNWGAAWRQRDLEFFTSDAFRKVLQENQIKLITWRELGKLIK

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
175 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
176 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
177 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
178 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
179 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
180 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
184 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
185 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
186 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
187 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
188 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
189 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
190 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
191 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
192 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
193 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
194 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
195 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
196 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
201 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
202 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
203 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
204 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
205 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 1.69
Rhizosphere 97.34
Stem 0
Stem Tuber 0
Unclassified 22.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100000933 3300005518 Bacteria 27278
2 SwRhRL2b_contig_2871396 2162886007 Unclassified 994
3 JGI25406J46586_10016555 3300003203 Unclassified 3070
4 rootL2_10208228 3300003322 Bacteria 5984
5 Ga0065714_10064440 3300005288 Bacteria 109986
6 Ga0065712_10000120 3300005290 Bacteria 105792
7 Ga0065712_10071783 3300005290 Bacteria 5065
8 Ga0065715_10005735 3300005293 Unclassified 4035
9 Ga0065715_10088971 3300005293 Bacteria 18989
10 Ga0065715_10089320 3300005293 Bacteria 11246
11 Ga0065707_10015998 3300005295 Bacteria 2459
12 Ga0065707_10207095 3300005295 Unclassified 1283
13 Ga0070670_100155547 3300005331 Unclassified 1980
14 Ga0070670_100160107 3300005331 Unclassified 1951
15 Ga0068869_100035828 3300005334 Unclassified 3520
16 Ga0068869_100048792 3300005334 Bacteria 3063
17 Ga0068869_100168883 3300005334 Unclassified 1708
18 Ga0070666_10018076 3300005335 Bacteria 4527
19 Ga0070680_100027302 3300005336 Bacteria 4571
20 Ga0070680_100178609 3300005336 Bacteria 1788
21 Ga0070682_100006457 3300005337 Bacteria 6593
22 Ga0070682_100009724 3300005337 Bacteria 5445
23 Ga0068868_100065815 3300005338 Unclassified 2880
24 Ga0068868_100105134 3300005338 Bacteria 2289
25 Ga0070689_100018199 3300005340 Bacteria 5172
26 Ga0070689_100031767 3300005340 Bacteria 4013
27 Ga0070687_100039788 3300005343 Bacteria 2365
28 Ga0070687_100062807 3300005343 Bacteria 1967
29 Ga0070692_10025032 3300005345 Bacteria 2939
30 Ga0070692_10028990 3300005345 Unclassified 2756
31 Ga0070669_100167199 3300005353 Unclassified 1713
32 Ga0070675_100084381 3300005354 Unclassified 2653
33 Ga0070675_100139185 3300005354 Unclassified 2074
34 Ga0070671_100015411 3300005355 Bacteria 6175
35 Ga0070671_100029235 3300005355 Bacteria 4543
36 Ga0070674_100093014 3300005356 Bacteria 2181
37 Ga0070674_100242538 3300005356 Unclassified 1412
38 Ga0070673_100014422 3300005364 Bacteria 5504
39 Ga0070673_100155626 3300005364 Bacteria 1940
40 Ga0070673_100269512 3300005364 Unclassified 1490
41 Ga0070673_100321478 3300005364 Unclassified 1367
42 Ga0070667_100012623 3300005367 Bacteria 6987
43 Ga0070703_10001763 3300005406 Bacteria 6411
44 Ga0070709_10000031 3300005434 Bacteria 117654
45 Ga0070709_10004567 3300005434 Bacteria 7476
46 Ga0070709_10106042 3300005434 Bacteria 1881
47 Ga0070709_10138571 3300005434 Unclassified 1669
48 Ga0070714_100275111 3300005435 Bacteria 1563
49 Ga0070705_100026242 3300005440 Bacteria 3169
50 Ga0070705_100043779 3300005440 Unclassified 2568
51 Ga0070705_100217527 3300005440 Bacteria 1321
52 Ga0070705_100340466 3300005440 Bacteria 1090
53 Ga0070700_100001070 3300005441 Bacteria 13586
54 Ga0070694_100007768 3300005444 Bacteria 6542
55 Ga0070694_100008477 3300005444 Bacteria 6289
56 Ga0070694_100067081 3300005444 Bacteria 2463
57 Ga0070708_100003029 3300005445 Bacteria 13048
58 Ga0070678_100216389 3300005456 Bacteria 1590
59 Ga0070681_10000628 3300005458 Bacteria 28955
60 Ga0070681_10069801 3300005458 Bacteria 3480
61 Ga0068867_100094666 3300005459 Bacteria 2272
62 Ga0070706_100000023 3300005467 Bacteria 159966
63 Ga0070706_100014157 3300005467 Bacteria 7370
64 Ga0070706_100044499 3300005467 Unclassified 4102
65 Ga0070707_100014897 3300005468 Bacteria 7293
66 Ga0070707_100079510 3300005468 Bacteria 3165
67 Ga0070698_100039743 3300005471 Bacteria 4839
68 Ga0070698_100131195 3300005471 Bacteria 2461
69 Ga0070699_100001588 3300005518 Bacteria 20748
70 Ga0070699_100065803 3300005518 Unclassified 3146
71 Ga0068853_100148653 3300005539 Bacteria 2107
72 Ga0068853_100151391 3300005539 Bacteria 2088
73 Ga0070686_100010767 3300005544 Bacteria 5170
74 Ga0070695_100186308 3300005545 Unclassified 1474
75 Ga0070695_100267730 3300005545 Bacteria 1250
76 Ga0070693_100111431 3300005547 Bacteria 1684
77 Ga0070704_100027149 3300005549 Bacteria 3793
78 Ga0070704_100167242 3300005549 Unclassified 1745
79 Ga0070704_100429291 3300005549 Bacteria 1133
80 Ga0070704_100463143 3300005549 Unclassified 1094
81 Ga0070664_100236709 3300005564 Bacteria 1638
82 Ga0068857_100042251 3300005577 Unclassified 4043
83 Ga0068857_100141562 3300005577 Bacteria 2174
84 Ga0068857_100313950 3300005577 Bacteria 1446
85 Ga0068854_100212980 3300005578 Bacteria 1525
86 Ga0068856_100087877 3300005614 Bacteria 3090
87 Ga0070702_100013219 3300005615 Bacteria 4162
88 Ga0070702_100048746 3300005615 Bacteria 2412
89 Ga0070702_100273974 3300005615 Unclassified 1155
90 Ga0068852_100345660 3300005616 Bacteria 1451
91 Ga0068859_100009210 3300005617 Bacteria 9973
92 Ga0068859_100017853 3300005617 Bacteria 7132
93 Ga0068859_100042594 3300005617 Bacteria 4560
94 Ga0068859_100085770 3300005617 Bacteria 3194
95 Ga0068859_100091596 3300005617 Bacteria 3091
96 Ga0068859_100124460 3300005617 Unclassified 2646
97 Ga0068859_100141958 3300005617 Bacteria 2475
98 Ga0068859_100184201 3300005617 Bacteria 2171
99 Ga0068859_100341917 3300005617 Bacteria 1590
100 Ga0068864_100013801 3300005618 Bacteria 6695
101 Ga0068864_100050662 3300005618 Bacteria 3575
102 Ga0068864_100168716 3300005618 Unclassified 1994
103 Ga0068864_100218579 3300005618 Bacteria 1757
104 Ga0068864_100226114 3300005618 Bacteria 1729
105 Ga0068866_10002100 3300005718 Bacteria 8289
106 Ga0068866_10104124 3300005718 Bacteria 1571
107 Ga0068861_100562313 3300005719 Unclassified 1041
108 Ga0068851_10001843 3300005834 Bacteria 9290
109 Ga0068870_10055986 3300005840 Bacteria 2103
110 Ga0068863_100141283 3300005841 Bacteria 2301
111 Ga0068863_100373976 3300005841 Unclassified 1391
112 Ga0068863_100402648 3300005841 Unclassified 1339
113 Ga0068863_100555544 3300005841 Bacteria 1134
114 Ga0068858_100024162 3300005842 Bacteria 5663
115 Ga0068858_100026930 3300005842 Bacteria 5340
116 Ga0068858_100068695 3300005842 Bacteria 3284
117 Ga0068858_100088248 3300005842 Bacteria 2885
118 Ga0068858_100094182 3300005842 Bacteria 2789
119 Ga0068858_100305465 3300005842 Bacteria 1518
120 Ga0068860_100015305 3300005843 Bacteria 7492
121 Ga0068860_100046546 3300005843 Bacteria 4136
122 Ga0068860_100057452 3300005843 Bacteria 3699
123 Ga0068860_100227670 3300005843 Unclassified 1811
124 Ga0068860_100401302 3300005843 Bacteria 1356
125 Ga0068860_100419379 3300005843 Bacteria 1326
126 Ga0068862_100071940 3300005844 Unclassified 2986
127 Ga0068862_100147670 3300005844 Bacteria 2091
128 Ga0081539_10000372 3300005985 Bacteria 98410
129 Ga0081539_10000500 3300005985 Bacteria 82137
130 Ga0081539_10151397 3300005985 Bacteria 1115
131 Ga0070716_100001248 3300006173 Bacteria 11204
132 Ga0070716_100213067 3300006173 Unclassified 1292
133 Ga0070712_100000985 3300006175 Bacteria 17097
134 Ga0097621_100002090 3300006237 Bacteria 13681
135 Ga0097621_100007896 3300006237 Bacteria 7632
136 Ga0097621_100289629 3300006237 Unclassified 1443
137 Ga0075370_10135946 3300006353 Bacteria 1436
138 Ga0068871_100004446 3300006358 Bacteria 9757
139 Ga0068871_100004768 3300006358 Bacteria 9482
140 Ga0068871_100172008 3300006358 Unclassified 1857
141 Ga0075430_100045977 3300006846 Bacteria 3686
142 Ga0075431_100069122 3300006847 Bacteria 3644
143 Ga0075431_100318653 3300006847 Unclassified 1568
144 Ga0075433_10016251 3300006852 Bacteria 6124
145 Ga0075433_10044609 3300006852 Bacteria 3853
146 Ga0075433_10083461 3300006852 Bacteria 2820
147 Ga0075434_100134140 3300006871 Bacteria 2495
148 Ga0075429_100096402 3300006880 Bacteria 2580
149 Ga0097620_100009208 3300006931 Bacteria 9973
150 Ga0097620_100017853 3300006931 Bacteria 7132
151 Ga0097620_100042593 3300006931 Bacteria 4560
152 Ga0097620_100085770 3300006931 Bacteria 3194
153 Ga0097620_100091584 3300006931 Bacteria 3091
154 Ga0097620_100124463 3300006931 Unclassified 2646
155 Ga0097620_100141954 3300006931 Bacteria 2475
156 Ga0097620_100168072 3300006931 Unclassified 2273
157 Ga0097620_100184198 3300006931 Bacteria 2171
158 Ga0097620_100341925 3300006931 Bacteria 1590
159 Ga0075435_100014224 3300007076 Bacteria 5941
160 Ga0075435_100387640 3300007076 Bacteria 1201
161 Ga0075435_100458673 3300007076 Unclassified 1099
162 Ga0105240_10079616 3300009093 Unclassified 4031
163 Ga0111539_10003822 3300009094 Bacteria 19825
164 Ga0111539_10010137 3300009094 Bacteria 11875
165 Ga0111539_10155674 3300009094 Bacteria 2674
166 Ga0111539_10178798 3300009094 Unclassified 2478
167 Ga0105245_10025534 3300009098 Bacteria 5197
168 Ga0105245_10812151 3300009098 Unclassified 974
169 Ga0105247_10007449 3300009101 Bacteria 6712
170 Ga0105247_10300385 3300009101 Bacteria 1114
171 Ga0114129_10063767 3300009147 Bacteria 5143
172 Ga0114129_10087620 3300009147 Bacteria 4317
173 Ga0114129_10139600 3300009147 Bacteria 3323
174 Ga0114129_10151769 3300009147 Bacteria 3170
175 Ga0114129_10672682 3300009147 Bacteria 1334
176 Ga0114129_10705123 3300009147 Bacteria 1297
177 Ga0105243_10012215 3300009148 Bacteria 6493
178 Ga0105243_10027607 3300009148 Bacteria 4350
179 Ga0105243_10319760 3300009148 Bacteria 1413
180 Ga0105241_10237811 3300009174 Bacteria 1538
181 Ga0105242_10028612 3300009176 Bacteria 4438
182 Ga0105242_10116141 3300009176 Bacteria 2289
183 Ga0105242_10143846 3300009176 Bacteria 2072
184 Ga0105248_10009980 3300009177 Bacteria 10453
185 Ga0105248_10030041 3300009177 Bacteria 6065
186 Ga0105248_10141595 3300009177 Unclassified 2713
187 Ga0105248_10241530 3300009177 Unclassified 2033
188 Ga0105248_10314975 3300009177 Bacteria 1762
189 Ga0105248_10652297 3300009177 Bacteria 1188
190 Ga0105237_10000835 3300009545 Bacteria 42094
191 Ga0105237_10012064 3300009545 Bacteria 9127
192 Ga0105237_10109619 3300009545 Bacteria 2752
193 Ga0105237_10439483 3300009545 Bacteria 1310
194 Ga0105238_10002572 3300009551 Bacteria 18107
195 Ga0105238_10024661 3300009551 Bacteria 6131
196 Ga0105249_10017053 3300009553 Bacteria 6445
197 Ga0105239_10104221 3300010375 Bacteria 3141
198 Ga0105239_10153296 3300010375 Bacteria 2572
199 Ga0105239_10272461 3300010375 Bacteria 1904
200 Ga0105246_10024180 3300011119 Bacteria 3943
201 Ga0105246_10132715 3300011119 Bacteria 1862
202 Ga0157373_10036727 3300013100 Unclassified 3514
203 Ga0157373_10061929 3300013100 Bacteria 2650
204 Ga0157373_10063291 3300013100 Bacteria 2620
205 Ga0157373_10068370 3300013100 Bacteria 2511
206 Ga0157373_10247449 3300013100 Bacteria 1261
207 Ga0157371_10208670 3300013102 Bacteria 1401
208 Ga0157374_10044769 3300013296 Bacteria 4092
209 Ga0157378_10002600 3300013297 Bacteria 16074
210 Ga0163162_10003072 3300013306 Bacteria 15954
211 Ga0163162_10017103 3300013306 Bacteria 7095
212 Ga0163162_10165266 3300013306 Unclassified 2336
213 Ga0157372_10053804 3300013307 Bacteria 4488
214 Ga0157372_10063766 3300013307 Bacteria 4133
215 Ga0157372_10274618 3300013307 Bacteria 1959
216 Ga0157375_10002498 3300013308 Bacteria 15932
217 Ga0157375_10457438 3300013308 Bacteria 1442
218 Ga0163163_10003845 3300014325 Bacteria 12790
219 Ga0163163_10022423 3300014325 Bacteria 5979
220 Ga0163163_10112714 3300014325 Bacteria 2749
221 Ga0157380_10017093 3300014326 Bacteria 5362
222 Ga0157380_10057502 3300014326 Bacteria 3098
223 Ga0157377_10047805 3300014745 Unclassified 2398
224 Ga0157379_10064303 3300014968 Bacteria 3279
225 Ga0157379_10079109 3300014968 Bacteria 2944
226 Ga0157376_10004539 3300014969 Bacteria 9667
227 Ga0157376_10075807 3300014969 Unclassified 2871
228 Ga0207656_10001211 3300025321 Bacteria 8503
229 Ga0207653_10000857 3300025885 Bacteria 10167
230 Ga0207642_10036971 3300025899 Bacteria 2100
231 Ga0207710_10000880 3300025900 Bacteria 16111
232 Ga0207688_10013990 3300025901 Bacteria 4362
233 Ga0207647_10007953 3300025904 Bacteria 7622
234 Ga0207647_10069082 3300025904 Bacteria 2136
235 Ga0207685_10012574 3300025905 Bacteria 2587
236 Ga0207699_10000012 3300025906 Bacteria 278800
237 Ga0207643_10030351 3300025908 Bacteria 3008
238 Ga0207643_10059336 3300025908 Bacteria 2182
239 Ga0207684_10000329 3300025910 Bacteria 66627
240 Ga0207684_10160345 3300025910 Bacteria 1937
241 Ga0207654_10051767 3300025911 Bacteria 2365
242 Ga0207707_10004425 3300025912 Bacteria 12381
243 Ga0207707_10137149 3300025912 Bacteria 2139
244 Ga0207695_10211390 3300025913 Unclassified 1850
245 Ga0207671_10003597 3300025914 Bacteria 15322
246 Ga0207693_10003007 3300025915 Bacteria 14586
247 Ga0207663_10222785 3300025916 Unclassified 1373
248 Ga0207660_10027657 3300025917 Bacteria 3873
249 Ga0207662_10008147 3300025918 Bacteria 5729
250 Ga0207646_10019072 3300025922 Bacteria 6381
251 Ga0207646_10120627 3300025922 Bacteria 2355
252 Ga0207694_10013434 3300025924 Bacteria 6167
253 Ga0207694_10047338 3300025924 Unclassified 3327
254 Ga0207650_10106710 3300025925 Unclassified 2163
255 Ga0207659_10046124 3300025926 Unclassified 3076
256 Ga0207700_10296749 3300025928 Unclassified 1394
257 Ga0207664_10234365 3300025929 Bacteria 1596
258 Ga0207644_10025901 3300025931 Unclassified 4036
259 Ga0207644_10127807 3300025931 Unclassified 1942
260 Ga0207644_10281400 3300025931 Unclassified 1336
261 Ga0207686_10015579 3300025934 Bacteria 4253
262 Ga0207709_10003290 3300025935 Bacteria 9696
263 Ga0207709_10322562 3300025935 Unclassified 1157
264 Ga0207670_10000558 3300025936 Bacteria 20611
265 Ga0207665_10000189 3300025939 Bacteria 41548
266 Ga0207665_10039154 3300025939 Bacteria 3160
267 Ga0207665_10079623 3300025939 Bacteria 2252
268 Ga0207665_10243770 3300025939 Bacteria 1325
269 Ga0207691_10001225 3300025940 Bacteria 25560
270 Ga0207711_10045142 3300025941 Bacteria 3765
271 Ga0207711_10064331 3300025941 Unclassified 3168
272 Ga0207711_10107066 3300025941 Unclassified 2482
273 Ga0207711_10461423 3300025941 Unclassified 1183
274 Ga0207689_10002643 3300025942 Bacteria 16588
275 Ga0207689_10060985 3300025942 Bacteria 3101
276 Ga0207689_10128858 3300025942 Unclassified 2082
277 Ga0207689_10150468 3300025942 Unclassified 1918
278 Ga0207679_10387370 3300025945 Bacteria 1227
279 Ga0207651_10125474 3300025960 Bacteria 1955
280 Ga0207651_10142804 3300025960 Unclassified 1852
281 Ga0207712_10004016 3300025961 Bacteria 9291
282 Ga0207712_10023520 3300025961 Bacteria 4067
283 Ga0207640_10168965 3300025981 Bacteria 1627
284 Ga0207658_10169101 3300025986 Unclassified 1799
285 Ga0207703_10036951 3300026035 Bacteria 3890
286 Ga0207703_10441364 3300026035 Bacteria 1214
287 Ga0207708_10000069 3300026075 Bacteria 82187
288 Ga0207708_10009105 3300026075 Bacteria 7347
289 Ga0207708_10013726 3300026075 Bacteria 6053
290 Ga0207708_10027332 3300026075 Bacteria 4319
291 Ga0207708_10053663 3300026075 Unclassified 3072
292 Ga0207702_10238955 3300026078 Bacteria 1701
293 Ga0207641_10124268 3300026088 Bacteria 2307
294 Ga0207641_10197938 3300026088 Bacteria 1851
295 Ga0207641_10265561 3300026088 Unclassified 1608
296 Ga0207648_10007659 3300026089 Bacteria 10569
297 Ga0207676_10012800 3300026095 Bacteria 6020
298 Ga0207676_10074542 3300026095 Unclassified 2734
299 Ga0207676_10090025 3300026095 Unclassified 2517
300 Ga0207676_10135609 3300026095 Unclassified 2099
301 Ga0207674_10059660 3300026116 Bacteria 3860
302 Ga0207674_10076925 3300026116 Bacteria 3344
303 Ga0207674_10107131 3300026116 Bacteria 2772
304 Ga0207674_10332797 3300026116 Unclassified 1468
305 Ga0207674_10409976 3300026116 Bacteria 1310
306 Ga0207675_100312516 3300026118 Bacteria 1533
307 Ga0207683_10207242 3300026121 Bacteria 1783
308 Ga0207698_10030580 3300026142 Bacteria 3874
309 Ga0207698_10297083 3300026142 Bacteria 1502
310 Ga0207698_10519548 3300026142 Bacteria 1162
311 Ga0207428_10053916 3300027907 Bacteria 3204
312 Ga0268265_10198664 3300028380 Bacteria 1738
313 Ga0268265_10275796 3300028380 Bacteria 1502
314 Ga0268265_10392937 3300028380 Bacteria 1280
315 Ga0268264_10011906 3300028381 Bacteria 7165
316 Ga0268264_10051243 3300028381 Unclassified 3439
317 Ga0268264_10148754 3300028381 Unclassified 2097
318 Ga0268264_10346845 3300028381 Unclassified 1412
319 Ga0307408_100006797 3300031548 Bacteria 7585
320 Ga0307408_100015681 3300031548 Bacteria 5049
321 Ga0307408_100341763 3300031548 Bacteria 1267
322 Ga0307410_10460854 3300031852 Unclassified 1039
323 Ga0307406_10015555 3300031901 Bacteria 4405
324 Ga0307406_10240720 3300031901 Unclassified 1357
325 Ga0307412_10038125 3300031911 Bacteria 3092
326 Ga0307416_100036872 3300032002 Bacteria 3756
327 Ga0307414_10177962 3300032004 Bacteria 1707
328 Ga0307415_100013218 3300032126 Bacteria 4812
329 Ga0307415_100176326 3300032126 Bacteria 1672
330 Ga0373940_0074676 3300035088 Unclassified 993
331 Ga0373951_0002231 3300035091 Bacteria 4923
332 Ga0373923_0059597 3300035111 Unclassified 1619
333 Ga0373935_0022427 3300035692 Bacteria 3872
334 Ga0395900_0266500 3300037418 Bacteria 1709
335 Ga0395905_0001038 3300037471 Bacteria 35255
336 Ga0395901_0350730 3300038443 Bacteria 1523
337 Ga0242422_00085 3300038699 Unclassified 4281
338 Ga0436365_1270150 3300039437 Bacteria 1331
339 Ga0439458_0044391 3300042157 Unclassified 1085
340 Ga0495603_0113526 3300046455 Bacteria 1580
341 Ga0495580_0002255 3300046472 Bacteria 16836
342 Ga0495580_0004077 3300046472 Bacteria 12317
343 Ga0495580_0012742 3300046472 Bacteria 6445
344 Ga0495582_0045750 3300046473 Unclassified 2411
345 Ga0495594_0025125 3300046499 Bacteria 3202
346 Ga0496102_0050247 3300048905 Bacteria 3796
347 Ga0496104_0305549 3300048907 Bacteria 1503
348 Ga0496107_0278291 3300048910 Unclassified 1246
349 Ga0496110_0120073 3300048913 Bacteria 2368
350 Ga0496112_0468481 3300048915 Bacteria 1197
351 Ga0496113_0067828 3300048916 Bacteria 2706
352 Ga0496113_0139577 3300048916 Bacteria 1906
353 Ga0501291_004743 3300049514 Bacteria 1745
354 Ga0501295_015215 3300049518 Bacteria 1313
355 Ga0501296_012846 3300049519 Unclassified 1014
356 Ga0501297_003192 3300049520 Bacteria 1620
357 Ga0501298_001779 3300049521 Unclassified 3188
358 Ga0501298_003083 3300049521 Bacteria 2568
359 Ga0501299_000248 3300049522 Bacteria 6155
360 Ga0501300_005050 3300049523 Bacteria 1950
361 Ga0501038_0176499 3300049574 Bacteria 1726
362 Ga0501076_0156053 3300049592 Bacteria 1858
363 Ga0501198_007076 3300049649 Bacteria 1608
364 Ga0501202_002699 3300049652 Bacteria 2998
365 Ga0501202_002980 3300049652 Bacteria 2874
366 Ga0501209_006853 3300049656 Bacteria 2152
367 Ga0501216_005816 3300049660 Unclassified 1871
368 Ga0501216_010735 3300049660 Unclassified 1477
369 Ga0501217_000446 3300049661 Bacteria 6706
370 Ga0501217_008370 3300049661 Unclassified 2233
371 Ga0501217_011077 3300049661 Bacteria 1989
372 Ga0501223_005518 3300049663 Bacteria 2655
373 Ga0501223_006493 3300049663 Bacteria 2416
374 Ga0501224_001271 3300049664 Bacteria 3326
375 Ga0501227_000649 3300049665 Bacteria 7560
376 Ga0501230_001146 3300049667 Bacteria 3073
377 Ga0501233_006332 3300049668 Bacteria 2220
378 Ga0501233_009153 3300049668 Bacteria 1927
379 Ga0501233_012465 3300049668 Bacteria 1707
380 Ga0501235_009215 3300049669 Bacteria 2157
381 Ga0501236_001323 3300049670 Bacteria 2809
382 Ga0501250_000743 3300049680 Bacteria 2380
383 Ga0501253_008206 3300049683 Bacteria 1493
384 Ga0501257_000926 3300049686 Bacteria 5956
385 Ga0501257_018421 3300049686 Bacteria 1628
386 Ga0501260_001908 3300049689 Viruses 1759
387 Ga0501225_0011989 3300049705 Bacteria 2437
388 Ga0501225_0014958 3300049705 Bacteria 2165
389 Ga0501225_0020549 3300049705 Bacteria 1825
390 Ga0501229_009439 3300049706 Bacteria 1225
391 Ga0501234_004509 3300049707 Bacteria 2189
392 Ga0501234_010500 3300049707 Unclassified 1443
393 Ga0501241_003217 3300049758 Bacteria 3099
394 Ga0501265_016898 3300049762 Bacteria 951
395 Ga0501212_016837 3300049851 Bacteria 1101
396 Ga0501226_006366 3300049853 Unclassified 1338
397 nmdc:mga07m45_60770_c1 3300050496 Unclassified 2139
398 nmdc:mga05p37_168111_c1 3300050507 Bacteria 2675
399 nmdc:mga05p37_195217_c1 3300050507 Unclassified 2455
400 nmdc:mga05p37_369766_c1 3300050507 Bacteria 1683
401 nmdc:mga05p37_844659_c1 3300050507 Unclassified 995
402 nmdc:mga05p37_85430_c1 3300050507 Bacteria 3888
403 nmdc:mga09592_78539_c1 3300050508 Bacteria 2809
404 nmdc:mga06r32_340514_c1 3300050510 Bacteria 1484
405 nmdc:mga06r32_73041_c1 3300050510 Bacteria 3322
406 nmdc:mga08y16_128092_c1 3300050511 Bacteria 2640
407 nmdc:mga08y16_24467_c1 3300050511 Bacteria 6373
408 nmdc:mga08y16_88483_c1 3300050511 Bacteria 3228
409 nmdc:mga0n895_58543_c1 3300050512 Bacteria 3799
410 nmdc:mga0rr50_263090_c1 3300050513 Bacteria 1435
411 nmdc:mga0a205_160565_c1 3300050515 Bacteria 2144
412 nmdc:mga0a205_200481_c1 3300050515 Bacteria 1886
413 nmdc:mga0a205_443460_c1 3300050515 Bacteria 1159
414 nmdc:mga0a205_94339_c1 3300050515 Bacteria 2891
415 Ga0070699_100000933
416 SwRhRL2b_contig_2871396
417 JGI25406J46586_10016555
418 rootL2_10208228
419 Ga0065714_10064440
420 Ga0065712_10000120
421 Ga0065712_10071783
422 Ga0065715_10005735
423 Ga0065715_10088971
424 Ga0065715_10089320
425 Ga0065707_10015998
426 Ga0065707_10207095
427 Ga0070670_100155547
428 Ga0070670_100160107
429 Ga0068869_100035828
430 Ga0068869_100048792
431 Ga0068869_100168883
432 Ga0070666_10018076
433 Ga0070680_100027302
434 Ga0070680_100178609
435 Ga0070682_100006457
436 Ga0070682_100009724
437 Ga0068868_100065815
438 Ga0068868_100105134
439 Ga0070689_100018199
440 Ga0070689_100031767
441 Ga0070687_100039788
442 Ga0070687_100062807
443 Ga0070692_10025032
444 Ga0070692_10028990
445 Ga0070669_100167199
446 Ga0070675_100084381
447 Ga0070675_100139185
448 Ga0070671_100015411
449 Ga0070671_100029235
450 Ga0070674_100093014
451 Ga0070674_100242538
452 Ga0070673_100014422
453 Ga0070673_100155626
454 Ga0070673_100269512
455 Ga0070673_100321478
456 Ga0070667_100012623
457 Ga0070703_10001763
458 Ga0070709_10000031
459 Ga0070709_10004567
460 Ga0070709_10106042
461 Ga0070709_10138571
462 Ga0070714_100275111
463 Ga0070705_100026242
464 Ga0070705_100043779
465 Ga0070705_100217527
466 Ga0070705_100340466
467 Ga0070700_100001070
468 Ga0070694_100007768
469 Ga0070694_100008477
470 Ga0070694_100067081
471 Ga0070708_100003029
472 Ga0070678_100216389
473 Ga0070681_10000628
474 Ga0070681_10069801
475 Ga0068867_100094666
476 Ga0070706_100000023
477 Ga0070706_100014157
478 Ga0070706_100044499
479 Ga0070707_100014897
480 Ga0070707_100079510
481 Ga0070698_100039743
482 Ga0070698_100131195
483 Ga0070699_100001588
484 Ga0070699_100065803
485 Ga0068853_100148653
486 Ga0068853_100151391
487 Ga0070686_100010767
488 Ga0070695_100186308
489 Ga0070695_100267730
490 Ga0070693_100111431
491 Ga0070704_100027149
492 Ga0070704_100167242
493 Ga0070704_100429291
494 Ga0070704_100463143
495 Ga0070664_100236709
496 Ga0068857_100042251
497 Ga0068857_100141562
498 Ga0068857_100313950
499 Ga0068854_100212980
500 Ga0068856_100087877
501 Ga0070702_100013219
502 Ga0070702_100048746
503 Ga0070702_100273974
504 Ga0068852_100345660
505 Ga0068859_100009210
506 Ga0068859_100017853
507 Ga0068859_100042594
508 Ga0068859_100085770
509 Ga0068859_100091596
510 Ga0068859_100124460
511 Ga0068859_100141958
512 Ga0068859_100184201
513 Ga0068859_100341917
514 Ga0068864_100013801
515 Ga0068864_100050662
516 Ga0068864_100168716
517 Ga0068864_100218579
518 Ga0068864_100226114
519 Ga0068866_10002100
520 Ga0068866_10104124
521 Ga0068861_100562313
522 Ga0068851_10001843
523 Ga0068870_10055986
524 Ga0068863_100141283
525 Ga0068863_100373976
526 Ga0068863_100402648
527 Ga0068863_100555544
528 Ga0068858_100024162
529 Ga0068858_100026930
530 Ga0068858_100068695
531 Ga0068858_100088248
532 Ga0068858_100094182
533 Ga0068858_100305465
534 Ga0068860_100015305
535 Ga0068860_100046546
536 Ga0068860_100057452
537 Ga0068860_100227670
538 Ga0068860_100401302
539 Ga0068860_100419379
540 Ga0068862_100071940
541 Ga0068862_100147670
542 Ga0081539_10000372
543 Ga0081539_10000500
544 Ga0081539_10151397
545 Ga0070716_100001248
546 Ga0070716_100213067
547 Ga0070712_100000985
548 Ga0097621_100002090
549 Ga0097621_100007896
550 Ga0097621_100289629
551 Ga0075370_10135946
552 Ga0068871_100004446
553 Ga0068871_100004768
554 Ga0068871_100172008
555 Ga0075430_100045977
556 Ga0075431_100069122
557 Ga0075431_100318653
558 Ga0075433_10016251
559 Ga0075433_10044609
560 Ga0075433_10083461
561 Ga0075434_100134140
562 Ga0075429_100096402
563 Ga0097620_100009208
564 Ga0097620_100017853
565 Ga0097620_100042593
566 Ga0097620_100085770
567 Ga0097620_100091584
568 Ga0097620_100124463
569 Ga0097620_100141954
570 Ga0097620_100168072
571 Ga0097620_100184198
572 Ga0097620_100341925
573 Ga0075435_100014224
574 Ga0075435_100387640
575 Ga0075435_100458673
576 Ga0105240_10079616
577 Ga0111539_10003822
578 Ga0111539_10010137
579 Ga0111539_10155674
580 Ga0111539_10178798
581 Ga0105245_10025534
582 Ga0105245_10812151
583 Ga0105247_10007449
584 Ga0105247_10300385
585 Ga0114129_10063767
586 Ga0114129_10087620
587 Ga0114129_10139600
588 Ga0114129_10151769
589 Ga0114129_10672682
590 Ga0114129_10705123
591 Ga0105243_10012215
592 Ga0105243_10027607
593 Ga0105243_10319760
594 Ga0105241_10237811
595 Ga0105242_10028612
596 Ga0105242_10116141
597 Ga0105242_10143846
598 Ga0105248_10009980
599 Ga0105248_10030041
600 Ga0105248_10141595
601 Ga0105248_10241530
602 Ga0105248_10314975
603 Ga0105248_10652297
604 Ga0105237_10000835
605 Ga0105237_10012064
606 Ga0105237_10109619
607 Ga0105237_10439483
608 Ga0105238_10002572
609 Ga0105238_10024661
610 Ga0105249_10017053
611 Ga0105239_10104221
612 Ga0105239_10153296
613 Ga0105239_10272461
614 Ga0105246_10024180
615 Ga0105246_10132715
616 Ga0157373_10036727
617 Ga0157373_10061929
618 Ga0157373_10063291
619 Ga0157373_10068370
620 Ga0157373_10247449
621 Ga0157371_10208670
622 Ga0157374_10044769
623 Ga0157378_10002600
624 Ga0163162_10003072
625 Ga0163162_10017103
626 Ga0163162_10165266
627 Ga0157372_10053804
628 Ga0157372_10063766
629 Ga0157372_10274618
630 Ga0157375_10002498
631 Ga0157375_10457438
632 Ga0163163_10003845
633 Ga0163163_10022423
634 Ga0163163_10112714
635 Ga0157380_10017093
636 Ga0157380_10057502
637 Ga0157377_10047805
638 Ga0157379_10064303
639 Ga0157379_10079109
640 Ga0157376_10004539
641 Ga0157376_10075807
642 Ga0207656_10001211
643 Ga0207653_10000857
644 Ga0207642_10036971
645 Ga0207710_10000880
646 Ga0207688_10013990
647 Ga0207647_10007953
648 Ga0207647_10069082
649 Ga0207685_10012574
650 Ga0207699_10000012
651 Ga0207643_10030351
652 Ga0207643_10059336
653 Ga0207684_10000329
654 Ga0207684_10160345
655 Ga0207654_10051767
656 Ga0207707_10004425
657 Ga0207707_10137149
658 Ga0207695_10211390
659 Ga0207671_10003597
660 Ga0207693_10003007
661 Ga0207663_10222785
662 Ga0207660_10027657
663 Ga0207662_10008147
664 Ga0207646_10019072
665 Ga0207646_10120627
666 Ga0207694_10013434
667 Ga0207694_10047338
668 Ga0207650_10106710
669 Ga0207659_10046124
670 Ga0207700_10296749
671 Ga0207664_10234365
672 Ga0207644_10025901
673 Ga0207644_10127807
674 Ga0207644_10281400
675 Ga0207686_10015579
676 Ga0207709_10003290
677 Ga0207709_10322562
678 Ga0207670_10000558
679 Ga0207665_10000189
680 Ga0207665_10039154
681 Ga0207665_10079623
682 Ga0207665_10243770
683 Ga0207691_10001225
684 Ga0207711_10045142
685 Ga0207711_10064331
686 Ga0207711_10107066
687 Ga0207711_10461423
688 Ga0207689_10002643
689 Ga0207689_10060985
690 Ga0207689_10128858
691 Ga0207689_10150468
692 Ga0207679_10387370
693 Ga0207651_10125474
694 Ga0207651_10142804
695 Ga0207712_10004016
696 Ga0207712_10023520
697 Ga0207640_10168965
698 Ga0207658_10169101
699 Ga0207703_10036951
700 Ga0207703_10441364
701 Ga0207708_10000069
702 Ga0207708_10009105
703 Ga0207708_10013726
704 Ga0207708_10027332
705 Ga0207708_10053663
706 Ga0207702_10238955
707 Ga0207641_10124268
708 Ga0207641_10197938
709 Ga0207641_10265561
710 Ga0207648_10007659
711 Ga0207676_10012800
712 Ga0207676_10074542
713 Ga0207676_10090025
714 Ga0207676_10135609
715 Ga0207674_10059660
716 Ga0207674_10076925
717 Ga0207674_10107131
718 Ga0207674_10332797
719 Ga0207674_10409976
720 Ga0207675_100312516
721 Ga0207683_10207242
722 Ga0207698_10030580
723 Ga0207698_10297083
724 Ga0207698_10519548
725 Ga0207428_10053916
726 Ga0268265_10198664
727 Ga0268265_10275796
728 Ga0268265_10392937
729 Ga0268264_10011906
730 Ga0268264_10051243
731 Ga0268264_10148754
732 Ga0268264_10346845
733 Ga0307408_100006797
734 Ga0307408_100015681
735 Ga0307408_100341763
736 Ga0307410_10460854
737 Ga0307406_10015555
738 Ga0307406_10240720
739 Ga0307412_10038125
740 Ga0307416_100036872
741 Ga0307414_10177962
742 Ga0307415_100013218
743 Ga0307415_100176326
744 Ga0373940_0074676
745 Ga0373951_0002231
746 Ga0373923_0059597
747 Ga0373935_0022427
748 Ga0395900_0266500
749 Ga0395905_0001038
750 Ga0395901_0350730
751 Ga0242422_00085
752 Ga0436365_1270150
753 Ga0439458_0044391
754 Ga0495603_0113526
755 Ga0495580_0002255
756 Ga0495580_0004077
757 Ga0495580_0012742
758 Ga0495582_0045750
759 Ga0495594_0025125
760 Ga0496102_0050247
761 Ga0496104_0305549
762 Ga0496107_0278291
763 Ga0496110_0120073
764 Ga0496112_0468481
765 Ga0496113_0067828
766 Ga0496113_0139577
767 Ga0501291_004743
768 Ga0501295_015215
769 Ga0501296_012846
770 Ga0501297_003192
771 Ga0501298_001779
772 Ga0501298_003083
773 Ga0501299_000248
774 Ga0501300_005050
775 Ga0501038_0176499
776 Ga0501076_0156053
777 Ga0501198_007076
778 Ga0501202_002699
779 Ga0501202_002980
780 Ga0501209_006853
781 Ga0501216_005816
782 Ga0501216_010735
783 Ga0501217_000446
784 Ga0501217_008370
785 Ga0501217_011077
786 Ga0501223_005518
787 Ga0501223_006493
788 Ga0501224_001271
789 Ga0501227_000649
790 Ga0501230_001146
791 Ga0501233_006332
792 Ga0501233_009153
793 Ga0501233_012465
794 Ga0501235_009215
795 Ga0501236_001323
796 Ga0501250_000743
797 Ga0501253_008206
798 Ga0501257_000926
799 Ga0501257_018421
800 Ga0501260_001908
801 Ga0501225_0011989
802 Ga0501225_0014958
803 Ga0501225_0020549
804 Ga0501229_009439
805 Ga0501234_004509
806 Ga0501234_010500
807 Ga0501241_003217
808 Ga0501265_016898
809 Ga0501212_016837
810 Ga0501226_006366
811 nmdc:mga07m45_60770_c1
812 nmdc:mga05p37_168111_c1
813 nmdc:mga05p37_195217_c1
814 nmdc:mga05p37_369766_c1
815 nmdc:mga05p37_844659_c1
816 nmdc:mga05p37_85430_c1
817 nmdc:mga09592_78539_c1
818 nmdc:mga06r32_340514_c1
819 nmdc:mga06r32_73041_c1
820 nmdc:mga08y16_128092_c1
821 nmdc:mga08y16_24467_c1
822 nmdc:mga08y16_88483_c1
823 nmdc:mga0n895_58543_c1
824 nmdc:mga0rr50_263090_c1
825 nmdc:mga0a205_160565_c1
826 nmdc:mga0a205_200481_c1
827 nmdc:mga0a205_443460_c1
828 nmdc:mga0a205_94339_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04794

YdjC

YdjC-like protein

75

329

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e67-assembly3.cif.gz_F crystal structure of the hypothetical protein tthb029 from thermus thermophilus hb8 0.8887 22 303
2e67-assembly3.cif.gz_F crystal structure of the hypothetical protein tthb029 from thermus thermophilus hb8 0.879 22 303
7vi8-assembly1.cif.gz_A crystal structure of chbg 0.8375 31 297
7vi8-assembly1.cif.gz_A crystal structure of chbg 0.8314 31 297
2i5i-assembly1.cif.gz_A crystal structure of a putative cellobiose-phosphate cleavage protein (ef3048) from enterococcus faecalis v583 at 1.70 a resolution 0.8283 31 298
ID Description Score Start End Superfamily
2e67D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.877 22 303 3.20.20.370
2e67D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8675 22 303 3.20.20.370
2i5iB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8472 31 298 3.20.20.370
af_P37794_1_249_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8469 31 297 3.20.20.370
2i5iB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.838 31 298 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A2V9ET21-F1-model_v4 ChbG/HpnK family deacetylase 0.9832 15 302 GO:0005975
GO:0019213
GO:0046872
AF-A0A3A1NNB6-F1-model_v4 ChbG/HpnK family deacetylase 0.9805 19 122 GO:0005975
GO:0046872
AF-A0A1Q6YRP6-F1-model_v4 ChbG/HpnK family deacetylase 0.9797 16 190 GO:0005975
GO:0019213
GO:0046872
AF-A0A2V8RYU0-F1-model_v4 Uncharacterized protein 0.9764 212 303 GO:0005975
GO:0046872
AF-A0A2V8SLL3-F1-model_v4 ChbG/HpnK family deacetylase 0.9753 80 305 GO:0005975
GO:0019213
GO:0046872

Map