F438237

General Info

Members Datasets Scaffolds Average Seq Length
414 188 828 171

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100438017|Ga0068869_1004380172
Length 177
Sequence MNFAFMKLEYKHIIPEDFHSASKVWIYQSSRLFSLSEALQIEDMLNDFVQRWNSHGVPVKGHANLLFGQFVVMMADESASGGVGGCSTDSSVRVIKQIEQQFGVNMFDRQTLAFVVKDKVQLLPLAQLNYAAANGFVNPDTIYFNNLVATKEELLNNWMIPVKQSWLSSRIKFSQTV

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
147 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
148 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
151 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
152 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
153 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
154 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
186 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 0.97
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100438017 3300005334 Bacteria 1081
2 rootL2_10078915 3300003322 Bacteria 1947
3 rootH1_10104364 3300003323 Bacteria 6398
4 Ga0065712_10022575 3300005290 Bacteria 1457
5 Ga0065712_10170613 3300005290 Bacteria 1236
6 Ga0065712_10348231 3300005290 Unclassified 791
7 Ga0065715_10106837 3300005293 Bacteria 2789
8 Ga0070658_10079688 3300005327 Bacteria 2689
9 Ga0070658_11209341 3300005327 Bacteria 657
10 Ga0070676_10052580 3300005328 Bacteria 2396
11 Ga0070676_10053787 3300005328 Bacteria 2372
12 Ga0070683_100782062 3300005329 Bacteria 915
13 Ga0070690_100014268 3300005330 Bacteria 4712
14 Ga0070690_100015088 3300005330 Bacteria 4601
15 Ga0070690_100311100 3300005330 Bacteria 1132
16 Ga0070670_100535385 3300005331 Bacteria 1044
17 Ga0070670_100566331 3300005331 Bacteria 1014
18 Ga0070670_101070188 3300005331 Bacteria 735
19 Ga0068869_100119586 3300005334 Bacteria 2013
20 Ga0068869_100231359 3300005334 Bacteria 1469
21 Ga0068869_100284723 3300005334 Bacteria 1330
22 Ga0070666_10007048 3300005335 Bacteria 6929
23 Ga0070666_10018002 3300005335 Bacteria 4534
24 Ga0070666_10114691 3300005335 Bacteria 1865
25 Ga0070666_10305848 3300005335 Bacteria 1133
26 Ga0070680_100006419 3300005336 Bacteria 8934
27 Ga0070682_100000839 3300005337 Bacteria 17934
28 Ga0070682_100002417 3300005337 Bacteria 10339
29 Ga0070682_100014031 3300005337 Bacteria 4623
30 Ga0068868_100041817 3300005338 Bacteria 3572
31 Ga0068868_100090234 3300005338 Bacteria 2468
32 Ga0068868_100149156 3300005338 Bacteria 1925
33 Ga0068868_100233219 3300005338 Bacteria 1544
34 Ga0068868_100533796 3300005338 Bacteria 1032
35 Ga0070660_100025573 3300005339 Bacteria 4389
36 Ga0070660_100269310 3300005339 Unclassified 1392
37 Ga0070689_100054539 3300005340 Bacteria 3095
38 Ga0070691_10009060 3300005341 Bacteria 4552
39 Ga0070687_100458824 3300005343 Unclassified 849
40 Ga0070687_100519216 3300005343 Bacteria 805
41 Ga0070661_100123091 3300005344 Bacteria 1944
42 Ga0070661_100195994 3300005344 Bacteria 1542
43 Ga0070692_10896773 3300005345 Unclassified 613
44 Ga0070668_100058702 3300005347 Bacteria 2977
45 Ga0070668_100716722 3300005347 Bacteria 883
46 Ga0070668_100728538 3300005347 Bacteria 876
47 Ga0070669_100084745 3300005353 Bacteria 2366
48 Ga0070669_100130220 3300005353 Bacteria 1929
49 Ga0070669_100188096 3300005353 Bacteria 1618
50 Ga0070669_100942690 3300005353 Bacteria 739
51 Ga0070675_100059235 3300005354 Bacteria 3159
52 Ga0070675_100169313 3300005354 Bacteria 1883
53 Ga0070675_100185965 3300005354 Bacteria 1798
54 Ga0070675_100477398 3300005354 Bacteria 1121
55 Ga0070675_100572560 3300005354 Bacteria 1023
56 Ga0070675_100629287 3300005354 Bacteria 974
57 Ga0070671_100010922 3300005355 Bacteria 7293
58 Ga0070671_100174637 3300005355 Bacteria 1817
59 Ga0070671_100683840 3300005355 Bacteria 889
60 Ga0070674_100056548 3300005356 Bacteria 2721
61 Ga0070674_100067041 3300005356 Bacteria 2524
62 Ga0070674_100169844 3300005356 Bacteria 1661
63 Ga0070674_100201808 3300005356 Bacteria 1536
64 Ga0070674_100381244 3300005356 Bacteria 1147
65 Ga0070673_100014508 3300005364 Bacteria 5492
66 Ga0070673_100027495 3300005364 Bacteria 4218
67 Ga0070673_100047178 3300005364 Bacteria 3350
68 Ga0070673_100149733 3300005364 Bacteria 1976
69 Ga0070673_100162275 3300005364 Bacteria 1901
70 Ga0070688_100128419 3300005365 Bacteria 1707
71 Ga0070688_100239313 3300005365 Bacteria 1287
72 Ga0070659_100027186 3300005366 Bacteria 4406
73 Ga0070659_100921532 3300005366 Unclassified 764
74 Ga0070667_100137420 3300005367 Bacteria 2137
75 Ga0070667_100407869 3300005367 Bacteria 1238
76 Ga0070667_100574096 3300005367 Bacteria 1038
77 Ga0070667_100623010 3300005367 Bacteria 995
78 Ga0070667_100876772 3300005367 Bacteria 835
79 Ga0070678_100429981 3300005456 Bacteria 1153
80 Ga0070662_100037593 3300005457 Bacteria 3433
81 Ga0070662_100135511 3300005457 Bacteria 1903
82 Ga0070681_10042587 3300005458 Bacteria 4549
83 Ga0068867_100012907 3300005459 Bacteria 5911
84 Ga0068867_100061553 3300005459 Bacteria 2787
85 Ga0068867_101143095 3300005459 Bacteria 713
86 Ga0070685_10091416 3300005466 Bacteria 1843
87 Ga0070685_10203384 3300005466 Bacteria 1288
88 Ga0070685_10388421 3300005466 Bacteria 963
89 Ga0070698_100002098 3300005471 Bacteria 22130
90 Ga0070698_100008869 3300005471 Bacteria 10814
91 Ga0070698_100197681 3300005471 Bacteria 1947
92 Ga0070679_100191582 3300005530 Bacteria 2013
93 Ga0070679_100353394 3300005530 Bacteria 1417
94 Ga0068853_100175001 3300005539 Bacteria 1943
95 Ga0068853_100826863 3300005539 Bacteria 888
96 Ga0070672_100021588 3300005543 Bacteria 4715
97 Ga0070672_100744804 3300005543 Bacteria 860
98 Ga0070672_100922145 3300005543 Bacteria 772
99 Ga0070686_100004365 3300005544 Bacteria 7794
100 Ga0070686_100168186 3300005544 Bacteria 1549
101 Ga0070686_100438330 3300005544 Bacteria 1002
102 Ga0070693_100068470 3300005547 Unclassified 2083
103 Ga0070693_100476087 3300005547 Bacteria 881
104 Ga0070665_100382764 3300005548 Bacteria 1414
105 Ga0070665_100468404 3300005548 Unclassified 1270
106 Ga0068855_100074492 3300005563 Bacteria 3942
107 Ga0068855_100455796 3300005563 Bacteria 1395
108 Ga0068855_100659740 3300005563 Bacteria 1123
109 Ga0068855_100667451 3300005563 Bacteria 1115
110 Ga0068855_101612703 3300005563 Bacteria 664
111 Ga0070664_100046301 3300005564 Bacteria 3673
112 Ga0070664_100258114 3300005564 Bacteria 1568
113 Ga0068857_100222137 3300005577 Bacteria 1726
114 Ga0068857_100247957 3300005577 Bacteria 1632
115 Ga0068857_101397910 3300005577 Bacteria 681
116 Ga0068854_100077215 3300005578 Bacteria 2450
117 Ga0068854_100193686 3300005578 Bacteria 1594
118 Ga0068854_100555261 3300005578 Bacteria 975
119 Ga0068854_101380376 3300005578 Unclassified 636
120 Ga0068856_100101482 3300005614 Bacteria 2870
121 Ga0070702_100018678 3300005615 Bacteria 3601
122 Ga0070702_100851439 3300005615 Bacteria 710
123 Ga0068852_100288436 3300005616 Bacteria 1585
124 Ga0068852_101652309 3300005616 Bacteria 663
125 Ga0068852_101961850 3300005616 Unclassified 608
126 Ga0068859_100104576 3300005617 Bacteria 2890
127 Ga0068859_100278049 3300005617 Bacteria 1767
128 Ga0068859_100310550 3300005617 Bacteria 1670
129 Ga0068859_100467001 3300005617 Bacteria 1358
130 Ga0068864_100145972 3300005618 Bacteria 2139
131 Ga0068866_10179388 3300005718 Bacteria 1250
132 Ga0068866_10333210 3300005718 Bacteria 958
133 Ga0068861_100003838 3300005719 Bacteria 10031
134 Ga0068861_100015284 3300005719 Bacteria 5406
135 Ga0068861_100019855 3300005719 Bacteria 4803
136 Ga0068861_100234750 3300005719 Bacteria 1557
137 Ga0068861_100744920 3300005719 Bacteria 915
138 Ga0068870_10027656 3300005840 Bacteria 2839
139 Ga0068870_10127874 3300005840 Bacteria 1472
140 Ga0068863_100115355 3300005841 Bacteria 2559
141 Ga0068863_100358354 3300005841 Bacteria 1421
142 Ga0068858_100055774 3300005842 Bacteria 3653
143 Ga0068858_101412604 3300005842 Bacteria 686
144 Ga0068860_100023114 3300005843 Bacteria 6012
145 Ga0068860_101029751 3300005843 Bacteria 842
146 Ga0068862_100064862 3300005844 Bacteria 3145
147 Ga0068862_100209977 3300005844 Bacteria 1759
148 Ga0068862_100566056 3300005844 Bacteria 1087
149 Ga0081539_10001436 3300005985 Bacteria 40812
150 Ga0070715_10334596 3300006163 Bacteria 822
151 Ga0075366_10206440 3300006195 Bacteria 1195
152 Ga0097621_100016613 3300006237 Bacteria 5568
153 Ga0097621_100035111 3300006237 Bacteria 4004
154 Ga0097621_100094494 3300006237 Bacteria 2507
155 Ga0097621_100129996 3300006237 Bacteria 2143
156 Ga0097621_100175657 3300006237 Bacteria 1848
157 Ga0068871_100009239 3300006358 Bacteria 7131
158 Ga0068871_100020662 3300006358 Bacteria 5048
159 Ga0068871_100475828 3300006358 Bacteria 1123
160 Ga0068871_100588644 3300006358 Bacteria 1011
161 Ga0068871_101100932 3300006358 Bacteria 743
162 Ga0075428_100002349 3300006844 Bacteria 20539
163 Ga0075430_100069014 3300006846 Bacteria 2966
164 Ga0075431_100162372 3300006847 Bacteria 2297
165 Ga0075429_100004013 3300006880 Bacteria 12599
166 Ga0068865_100108366 3300006881 Bacteria 2044
167 Ga0068865_100613881 3300006881 Bacteria 920
168 Ga0068865_100763121 3300006881 Bacteria 832
169 Ga0097620_100104574 3300006931 Bacteria 2890
170 Ga0097620_100278044 3300006931 Bacteria 1767
171 Ga0097620_100310544 3300006931 Bacteria 1670
172 Ga0097620_100466988 3300006931 Bacteria 1358
173 Ga0105240_10002244 3300009093 Bacteria 31388
174 Ga0111539_10555488 3300009094 Bacteria 1337
175 Ga0111539_11145557 3300009094 Bacteria 904
176 Ga0111539_12159057 3300009094 Unclassified 646
177 Ga0105247_10003642 3300009101 Bacteria 10008
178 Ga0105247_10231949 3300009101 Bacteria 1254
179 Ga0105243_10118455 3300009148 Bacteria 2228
180 Ga0105241_10033483 3300009174 Bacteria 3857
181 Ga0105241_10211468 3300009174 Bacteria 1625
182 Ga0105241_10542708 3300009174 Unclassified 1043
183 Ga0105241_11264055 3300009174 Bacteria 702
184 Ga0105241_11765899 3300009174 Unclassified 603
185 Ga0105242_10011567 3300009176 Bacteria 6786
186 Ga0105242_10016017 3300009176 Bacteria 5824
187 Ga0105242_10094466 3300009176 Bacteria 2522
188 Ga0105242_10462697 3300009176 Unclassified 1198
189 Ga0105248_10253457 3300009177 Bacteria 1981
190 Ga0105249_10004716 3300009553 Bacteria 11769
191 Ga0105249_10011525 3300009553 Bacteria 7770
192 Ga0105249_10047552 3300009553 Bacteria 3910
193 Ga0105249_10423606 3300009553 Bacteria 1365
194 Ga0105249_10810971 3300009553 Bacteria 1000
195 Ga0105239_10074626 3300010375 Bacteria 3729
196 Ga0105239_11842826 3300010375 Bacteria 701
197 Ga0105246_10347753 3300011119 Bacteria 1214
198 Ga0157373_10051215 3300013100 Bacteria 2941
199 Ga0157373_10212498 3300013100 Bacteria 1364
200 Ga0157371_10030133 3300013102 Bacteria 3915
201 Ga0157371_10112565 3300013102 Bacteria 1932
202 Ga0157371_10385064 3300013102 Bacteria 1024
203 Ga0157370_10000795 3300013104 Bacteria 39727
204 Ga0157370_10005767 3300013104 Bacteria 13837
205 Ga0157370_10306143 3300013104 Bacteria 1466
206 Ga0157369_10059506 3300013105 Bacteria 4119
207 Ga0157369_10332349 3300013105 Bacteria 1579
208 Ga0157374_10171911 3300013296 Bacteria 2114
209 Ga0157374_10184502 3300013296 Bacteria 2039
210 Ga0157374_10502861 3300013296 Bacteria 1217
211 Ga0157378_10036858 3300013297 Bacteria 4328
212 Ga0157378_10039680 3300013297 Bacteria 4176
213 Ga0157378_10053382 3300013297 Bacteria 3598
214 Ga0157378_10589319 3300013297 Bacteria 1122
215 Ga0163162_10032060 3300013306 Bacteria 5216
216 Ga0163162_10611105 3300013306 Bacteria 1216
217 Ga0163162_10793032 3300013306 Bacteria 1065
218 Ga0157372_10218517 3300013307 Bacteria 2209
219 Ga0157372_10476942 3300013307 Unclassified 1454
220 Ga0157372_10538641 3300013307 Bacteria 1361
221 Ga0157372_11679144 3300013307 Bacteria 731
222 Ga0157375_10087696 3300013308 Bacteria 3164
223 Ga0157375_10890274 3300013308 Bacteria 1035
224 Ga0157375_11011536 3300013308 Bacteria 970
225 Ga0163163_10477810 3300014325 Bacteria 1307
226 Ga0163163_11836493 3300014325 Bacteria 666
227 Ga0157380_10070322 3300014326 Bacteria 2828
228 Ga0157380_10074118 3300014326 Bacteria 2762
229 Ga0157380_10269572 3300014326 Bacteria 1551
230 Ga0157380_10824281 3300014326 Bacteria 947
231 Ga0157377_10045986 3300014745 Bacteria 2440
232 Ga0157377_10373024 3300014745 Bacteria 964
233 Ga0157377_10681156 3300014745 Bacteria 744
234 Ga0157379_10149734 3300014968 Bacteria 2105
235 Ga0157379_10329638 3300014968 Bacteria 1395
236 Ga0157379_10716746 3300014968 Bacteria 940
237 Ga0157379_11221141 3300014968 Bacteria 724
238 Ga0157376_10285695 3300014969 Bacteria 1556
239 Ga0157376_10564988 3300014969 Bacteria 1128
240 Ga0157376_10637974 3300014969 Unclassified 1064
241 Ga0163161_10010065 3300017792 Bacteria 6545
242 Ga0163161_10153297 3300017792 Bacteria 1752
243 Ga0163161_10435737 3300017792 Bacteria 1057
244 Ga0207682_10067056 3300025893 Bacteria 1513
245 Ga0207710_10007094 3300025900 Bacteria 4754
246 Ga0207688_10018274 3300025901 Bacteria 3817
247 Ga0207688_10175214 3300025901 Bacteria 1277
248 Ga0207680_10117968 3300025903 Bacteria 1732
249 Ga0207680_10183293 3300025903 Unclassified 1417
250 Ga0207680_10324920 3300025903 Bacteria 1076
251 Ga0207680_10714553 3300025903 Bacteria 718
252 Ga0207645_10008320 3300025907 Bacteria 7246
253 Ga0207645_10073351 3300025907 Bacteria 2191
254 Ga0207645_10151136 3300025907 Bacteria 1516
255 Ga0207643_10004789 3300025908 Bacteria 7250
256 Ga0207705_10205051 3300025909 Bacteria 1494
257 Ga0207654_10015241 3300025911 Bacteria 3985
258 Ga0207707_10005877 3300025912 Bacteria 10729
259 Ga0207707_10565096 3300025912 Bacteria 965
260 Ga0207695_10026777 3300025913 Bacteria 6430
261 Ga0207660_10182784 3300025917 Bacteria 1629
262 Ga0207662_10009899 3300025918 Bacteria 5259
263 Ga0207662_10099673 3300025918 Bacteria 1799
264 Ga0207662_10484963 3300025918 Unclassified 849
265 Ga0207657_10012205 3300025919 Bacteria 8489
266 Ga0207657_10129510 3300025919 Bacteria 2069
267 Ga0207649_10151559 3300025920 Bacteria 1597
268 Ga0207652_10001659 3300025921 Bacteria 19533
269 Ga0207652_10594340 3300025921 Bacteria 993
270 Ga0207681_10920686 3300025923 Bacteria 732
271 Ga0207681_11307270 3300025923 Unclassified 609
272 Ga0207650_10086617 3300025925 Bacteria 2385
273 Ga0207650_10252802 3300025925 Bacteria 1427
274 Ga0207659_10041098 3300025926 Bacteria 3238
275 Ga0207659_10093769 3300025926 Bacteria 2248
276 Ga0207659_10113203 3300025926 Bacteria 2066
277 Ga0207659_10158412 3300025926 Bacteria 1775
278 Ga0207659_10666574 3300025926 Bacteria 890
279 Ga0207659_10864987 3300025926 Bacteria 777
280 Ga0207644_10031918 3300025931 Bacteria 3673
281 Ga0207644_10067738 3300025931 Bacteria 2603
282 Ga0207644_10455868 3300025931 Bacteria 1051
283 Ga0207690_10268120 3300025932 Bacteria 1325
284 Ga0207706_10077635 3300025933 Bacteria 2920
285 Ga0207706_10365341 3300025933 Bacteria 1254
286 Ga0207706_10457614 3300025933 Bacteria 1103
287 Ga0207686_10001727 3300025934 Bacteria 12163
288 Ga0207686_10317032 3300025934 Unclassified 1163
289 Ga0207669_10056097 3300025937 Bacteria 2390
290 Ga0207669_10267062 3300025937 Bacteria 1283
291 Ga0207691_10007169 3300025940 Bacteria 10754
292 Ga0207691_10042428 3300025940 Bacteria 4194
293 Ga0207691_10143809 3300025940 Bacteria 2100
294 Ga0207711_10335853 3300025941 Bacteria 1398
295 Ga0207689_10047343 3300025942 Bacteria 3551
296 Ga0207689_10054304 3300025942 Bacteria 3300
297 Ga0207689_10276262 3300025942 Bacteria 1391
298 Ga0207689_10415677 3300025942 Bacteria 1122
299 Ga0207689_10552239 3300025942 Bacteria 967
300 Ga0207661_10082238 3300025944 Bacteria 2662
301 Ga0207661_11142861 3300025944 Bacteria 717
302 Ga0207679_10177143 3300025945 Bacteria 1761
303 Ga0207679_10269510 3300025945 Bacteria 1455
304 Ga0207651_10626022 3300025960 Bacteria 943
305 Ga0207712_10027580 3300025961 Bacteria 3793
306 Ga0207712_10031098 3300025961 Bacteria 3592
307 Ga0207712_10215511 3300025961 Bacteria 1532
308 Ga0207712_10527014 3300025961 Bacteria 1013
309 Ga0207668_10221326 3300025972 Bacteria 1520
310 Ga0207668_10347776 3300025972 Unclassified 1239
311 Ga0207668_11260014 3300025972 Unclassified 665
312 Ga0207668_11306138 3300025972 Bacteria 653
313 Ga0207658_10092394 3300025986 Bacteria 2351
314 Ga0207658_10226135 3300025986 Bacteria 1577
315 Ga0207677_10119245 3300026023 Bacteria 1981
316 Ga0207703_11047385 3300026035 Bacteria 783
317 Ga0207639_10154793 3300026041 Bacteria 1924
318 Ga0207639_10976919 3300026041 Bacteria 793
319 Ga0207702_10456500 3300026078 Bacteria 1240
320 Ga0207641_10032468 3300026088 Bacteria 4333
321 Ga0207641_10064432 3300026088 Bacteria 3132
322 Ga0207641_10197876 3300026088 Bacteria 1851
323 Ga0207648_10002952 3300026089 Bacteria 17989
324 Ga0207648_10070808 3300026089 Bacteria 3040
325 Ga0207648_10300303 3300026089 Bacteria 1440
326 Ga0207676_10106351 3300026095 Bacteria 2338
327 Ga0207676_10672114 3300026095 Bacteria 1001
328 Ga0207674_10227596 3300026116 Bacteria 1813
329 Ga0207674_10269920 3300026116 Bacteria 1648
330 Ga0207674_10284713 3300026116 Bacteria 1601
331 Ga0207674_10545992 3300026116 Bacteria 1119
332 Ga0207675_100008546 3300026118 Bacteria 9630
333 Ga0207675_100077748 3300026118 Bacteria 3109
334 Ga0207675_100118148 3300026118 Bacteria 2507
335 Ga0207683_10001842 3300026121 Bacteria 18744
336 Ga0207683_10077172 3300026121 Bacteria 2950
337 Ga0207683_10108393 3300026121 Bacteria 2485
338 Ga0207683_10216388 3300026121 Bacteria 1745
339 Ga0207683_10335592 3300026121 Bacteria 1386
340 Ga0207698_10503422 3300026142 Bacteria 1179
341 Ga0207698_11011540 3300026142 Bacteria 842
342 Ga0207698_11519712 3300026142 Bacteria 685
343 Ga0207428_10124108 3300027907 Bacteria 1978
344 Ga0268266_10524180 3300028379 Unclassified 1133
345 Ga0268266_11081840 3300028379 Unclassified 776
346 Ga0268266_11266911 3300028379 Bacteria 712
347 Ga0268265_10125773 3300028380 Bacteria 2121
348 Ga0268265_10128484 3300028380 Bacteria 2102
349 Ga0268265_10577795 3300028380 Bacteria 1071
350 Ga0268265_11040178 3300028380 Bacteria 810
351 Ga0268264_10017207 3300028381 Bacteria 5921
352 Ga0268264_10076822 3300028381 Bacteria 2842
353 Ga0268264_10506341 3300028381 Bacteria 1178
354 Ga0268264_10552203 3300028381 Bacteria 1130
355 Ga0307515_10000001 3300028794 Bacteria 4259510
356 Ga0307412_10148959 3300031911 Bacteria 1724
357 Ga0373937_0674393 3300036401 Bacteria 980
358 Ga0395898_0999005 3300037466 Unclassified 773
359 Ga0395901_0680429 3300038443 Bacteria 1029
360 Ga0439438_081328 3300041405 Bacteria 795
361 Ga0451787_727531 3300041441 Bacteria 567
362 Ga0451798_0264186 3300041458 Bacteria 614
363 Ga0451807_2334558 3300041486 Bacteria 1159
364 Ga0451839_0196638 3300041496 Bacteria 565
365 Ga0439441_005343 3300042001 Bacteria 1992
366 Ga0439445_0009386 3300042004 Bacteria 2306
367 Ga0439457_138190 3300042014 Unclassified 582
368 Ga0450898_042803 3300042134 Bacteria 861
369 Ga0451577_0006025 3300042876 Bacteria 12208
370 Ga0453684_0019261 3300044712 Bacteria 10403
371 Ga0453684_0319194 3300044712 Bacteria 1760
372 Ga0453684_0358650 3300044712 Bacteria 1642
373 Ga0495638_0230302 3300046460 Unclassified 1031
374 Ga0495650_0032116 3300046471 Bacteria 2352
375 Ga0495621_0092506 3300046539 Bacteria 1141
376 Ga0495669_0256658 3300046684 Bacteria 840
377 Ga0495670_0028471 3300046691 Bacteria 2770
378 Ga0495686_0017877 3300047472 Bacteria 4767
379 Ga0495686_0455651 3300047472 Unclassified 679
380 Ga0496114_0590513 3300048917 Bacteria 980
381 Ga0501317_101126 3300049533 Unclassified 520
382 Ga0501034_0058164 3300049571 Bacteria 3886
383 Ga0501038_0406824 3300049574 Bacteria 1052
384 Ga0501039_0432308 3300049575 Bacteria 1034
385 Ga0501043_0004526 3300049579 Bacteria 11298
386 Ga0501046_0003983 3300049580 Bacteria 13485
387 Ga0501046_0365277 3300049580 Bacteria 1046
388 Ga0501047_0010015 3300049581 Bacteria 8961
389 Ga0501069_0088164 3300049585 Bacteria 1753
390 Ga0501070_0005701 3300049586 Bacteria 10617
391 Ga0501070_0157069 3300049586 Bacteria 1876
392 Ga0501073_0000371 3300049589 Bacteria 30293
393 Ga0501073_0077528 3300049589 Bacteria 2312
394 Ga0501074_0001823 3300049590 Bacteria 14583
395 Ga0501074_0061304 3300049590 Bacteria 2710
396 Ga0501079_0146863 3300049741 Bacteria 1838
397 Ga0501080_0019099 3300049742 Bacteria 6347
398 Ga0501080_0216384 3300049742 Bacteria 1754
399 Ga0501083_0059579 3300049744 Bacteria 2553
400 Ga0501035_0207361 3300049822 Bacteria 1678
401 Ga0501044_0131619 3300049823 Bacteria 2495
402 Ga0501044_0198889 3300049823 Bacteria 1963
403 nmdc:mga09592_7585_c1 3300050508 Bacteria 8823
404 nmdc:mga0qj67_337190_c1 3300050509 Bacteria 1220
405 nmdc:mga06r32_467475_c1 3300050510 Bacteria 1240
406 nmdc:mga08y16_144765_c1 3300050511 Bacteria 2470
407 nmdc:mga08y16_1675721_c1 3300050511 Bacteria 592
408 nmdc:mga08y16_1746226_c1 3300050511 Unclassified 576
409 nmdc:mga08y16_637461_c1 3300050511 Bacteria 1071
410 Ga0500644_0149884 3300053088 Bacteria 934
411 Ga0500646_0125166 3300053090 Bacteria 830
412 Ga0500611_000092 3300053727 Bacteria 25966
413 Ga0501084_0008192 3300054114 Bacteria 8620
414 Ga0501082_0057755 3300060353 Bacteria 3342
415 Ga0068869_100438017
416 rootL2_10078915
417 rootH1_10104364
418 Ga0065712_10022575
419 Ga0065712_10170613
420 Ga0065712_10348231
421 Ga0065715_10106837
422 Ga0070658_10079688
423 Ga0070658_11209341
424 Ga0070676_10052580
425 Ga0070676_10053787
426 Ga0070683_100782062
427 Ga0070690_100014268
428 Ga0070690_100015088
429 Ga0070690_100311100
430 Ga0070670_100535385
431 Ga0070670_100566331
432 Ga0070670_101070188
433 Ga0068869_100119586
434 Ga0068869_100231359
435 Ga0068869_100284723
436 Ga0070666_10007048
437 Ga0070666_10018002
438 Ga0070666_10114691
439 Ga0070666_10305848
440 Ga0070680_100006419
441 Ga0070682_100000839
442 Ga0070682_100002417
443 Ga0070682_100014031
444 Ga0068868_100041817
445 Ga0068868_100090234
446 Ga0068868_100149156
447 Ga0068868_100233219
448 Ga0068868_100533796
449 Ga0070660_100025573
450 Ga0070660_100269310
451 Ga0070689_100054539
452 Ga0070691_10009060
453 Ga0070687_100458824
454 Ga0070687_100519216
455 Ga0070661_100123091
456 Ga0070661_100195994
457 Ga0070692_10896773
458 Ga0070668_100058702
459 Ga0070668_100716722
460 Ga0070668_100728538
461 Ga0070669_100084745
462 Ga0070669_100130220
463 Ga0070669_100188096
464 Ga0070669_100942690
465 Ga0070675_100059235
466 Ga0070675_100169313
467 Ga0070675_100185965
468 Ga0070675_100477398
469 Ga0070675_100572560
470 Ga0070675_100629287
471 Ga0070671_100010922
472 Ga0070671_100174637
473 Ga0070671_100683840
474 Ga0070674_100056548
475 Ga0070674_100067041
476 Ga0070674_100169844
477 Ga0070674_100201808
478 Ga0070674_100381244
479 Ga0070673_100014508
480 Ga0070673_100027495
481 Ga0070673_100047178
482 Ga0070673_100149733
483 Ga0070673_100162275
484 Ga0070688_100128419
485 Ga0070688_100239313
486 Ga0070659_100027186
487 Ga0070659_100921532
488 Ga0070667_100137420
489 Ga0070667_100407869
490 Ga0070667_100574096
491 Ga0070667_100623010
492 Ga0070667_100876772
493 Ga0070678_100429981
494 Ga0070662_100037593
495 Ga0070662_100135511
496 Ga0070681_10042587
497 Ga0068867_100012907
498 Ga0068867_100061553
499 Ga0068867_101143095
500 Ga0070685_10091416
501 Ga0070685_10203384
502 Ga0070685_10388421
503 Ga0070698_100002098
504 Ga0070698_100008869
505 Ga0070698_100197681
506 Ga0070679_100191582
507 Ga0070679_100353394
508 Ga0068853_100175001
509 Ga0068853_100826863
510 Ga0070672_100021588
511 Ga0070672_100744804
512 Ga0070672_100922145
513 Ga0070686_100004365
514 Ga0070686_100168186
515 Ga0070686_100438330
516 Ga0070693_100068470
517 Ga0070693_100476087
518 Ga0070665_100382764
519 Ga0070665_100468404
520 Ga0068855_100074492
521 Ga0068855_100455796
522 Ga0068855_100659740
523 Ga0068855_100667451
524 Ga0068855_101612703
525 Ga0070664_100046301
526 Ga0070664_100258114
527 Ga0068857_100222137
528 Ga0068857_100247957
529 Ga0068857_101397910
530 Ga0068854_100077215
531 Ga0068854_100193686
532 Ga0068854_100555261
533 Ga0068854_101380376
534 Ga0068856_100101482
535 Ga0070702_100018678
536 Ga0070702_100851439
537 Ga0068852_100288436
538 Ga0068852_101652309
539 Ga0068852_101961850
540 Ga0068859_100104576
541 Ga0068859_100278049
542 Ga0068859_100310550
543 Ga0068859_100467001
544 Ga0068864_100145972
545 Ga0068866_10179388
546 Ga0068866_10333210
547 Ga0068861_100003838
548 Ga0068861_100015284
549 Ga0068861_100019855
550 Ga0068861_100234750
551 Ga0068861_100744920
552 Ga0068870_10027656
553 Ga0068870_10127874
554 Ga0068863_100115355
555 Ga0068863_100358354
556 Ga0068858_100055774
557 Ga0068858_101412604
558 Ga0068860_100023114
559 Ga0068860_101029751
560 Ga0068862_100064862
561 Ga0068862_100209977
562 Ga0068862_100566056
563 Ga0081539_10001436
564 Ga0070715_10334596
565 Ga0075366_10206440
566 Ga0097621_100016613
567 Ga0097621_100035111
568 Ga0097621_100094494
569 Ga0097621_100129996
570 Ga0097621_100175657
571 Ga0068871_100009239
572 Ga0068871_100020662
573 Ga0068871_100475828
574 Ga0068871_100588644
575 Ga0068871_101100932
576 Ga0075428_100002349
577 Ga0075430_100069014
578 Ga0075431_100162372
579 Ga0075429_100004013
580 Ga0068865_100108366
581 Ga0068865_100613881
582 Ga0068865_100763121
583 Ga0097620_100104574
584 Ga0097620_100278044
585 Ga0097620_100310544
586 Ga0097620_100466988
587 Ga0105240_10002244
588 Ga0111539_10555488
589 Ga0111539_11145557
590 Ga0111539_12159057
591 Ga0105247_10003642
592 Ga0105247_10231949
593 Ga0105243_10118455
594 Ga0105241_10033483
595 Ga0105241_10211468
596 Ga0105241_10542708
597 Ga0105241_11264055
598 Ga0105241_11765899
599 Ga0105242_10011567
600 Ga0105242_10016017
601 Ga0105242_10094466
602 Ga0105242_10462697
603 Ga0105248_10253457
604 Ga0105249_10004716
605 Ga0105249_10011525
606 Ga0105249_10047552
607 Ga0105249_10423606
608 Ga0105249_10810971
609 Ga0105239_10074626
610 Ga0105239_11842826
611 Ga0105246_10347753
612 Ga0157373_10051215
613 Ga0157373_10212498
614 Ga0157371_10030133
615 Ga0157371_10112565
616 Ga0157371_10385064
617 Ga0157370_10000795
618 Ga0157370_10005767
619 Ga0157370_10306143
620 Ga0157369_10059506
621 Ga0157369_10332349
622 Ga0157374_10171911
623 Ga0157374_10184502
624 Ga0157374_10502861
625 Ga0157378_10036858
626 Ga0157378_10039680
627 Ga0157378_10053382
628 Ga0157378_10589319
629 Ga0163162_10032060
630 Ga0163162_10611105
631 Ga0163162_10793032
632 Ga0157372_10218517
633 Ga0157372_10476942
634 Ga0157372_10538641
635 Ga0157372_11679144
636 Ga0157375_10087696
637 Ga0157375_10890274
638 Ga0157375_11011536
639 Ga0163163_10477810
640 Ga0163163_11836493
641 Ga0157380_10070322
642 Ga0157380_10074118
643 Ga0157380_10269572
644 Ga0157380_10824281
645 Ga0157377_10045986
646 Ga0157377_10373024
647 Ga0157377_10681156
648 Ga0157379_10149734
649 Ga0157379_10329638
650 Ga0157379_10716746
651 Ga0157379_11221141
652 Ga0157376_10285695
653 Ga0157376_10564988
654 Ga0157376_10637974
655 Ga0163161_10010065
656 Ga0163161_10153297
657 Ga0163161_10435737
658 Ga0207682_10067056
659 Ga0207710_10007094
660 Ga0207688_10018274
661 Ga0207688_10175214
662 Ga0207680_10117968
663 Ga0207680_10183293
664 Ga0207680_10324920
665 Ga0207680_10714553
666 Ga0207645_10008320
667 Ga0207645_10073351
668 Ga0207645_10151136
669 Ga0207643_10004789
670 Ga0207705_10205051
671 Ga0207654_10015241
672 Ga0207707_10005877
673 Ga0207707_10565096
674 Ga0207695_10026777
675 Ga0207660_10182784
676 Ga0207662_10009899
677 Ga0207662_10099673
678 Ga0207662_10484963
679 Ga0207657_10012205
680 Ga0207657_10129510
681 Ga0207649_10151559
682 Ga0207652_10001659
683 Ga0207652_10594340
684 Ga0207681_10920686
685 Ga0207681_11307270
686 Ga0207650_10086617
687 Ga0207650_10252802
688 Ga0207659_10041098
689 Ga0207659_10093769
690 Ga0207659_10113203
691 Ga0207659_10158412
692 Ga0207659_10666574
693 Ga0207659_10864987
694 Ga0207644_10031918
695 Ga0207644_10067738
696 Ga0207644_10455868
697 Ga0207690_10268120
698 Ga0207706_10077635
699 Ga0207706_10365341
700 Ga0207706_10457614
701 Ga0207686_10001727
702 Ga0207686_10317032
703 Ga0207669_10056097
704 Ga0207669_10267062
705 Ga0207691_10007169
706 Ga0207691_10042428
707 Ga0207691_10143809
708 Ga0207711_10335853
709 Ga0207689_10047343
710 Ga0207689_10054304
711 Ga0207689_10276262
712 Ga0207689_10415677
713 Ga0207689_10552239
714 Ga0207661_10082238
715 Ga0207661_11142861
716 Ga0207679_10177143
717 Ga0207679_10269510
718 Ga0207651_10626022
719 Ga0207712_10027580
720 Ga0207712_10031098
721 Ga0207712_10215511
722 Ga0207712_10527014
723 Ga0207668_10221326
724 Ga0207668_10347776
725 Ga0207668_11260014
726 Ga0207668_11306138
727 Ga0207658_10092394
728 Ga0207658_10226135
729 Ga0207677_10119245
730 Ga0207703_11047385
731 Ga0207639_10154793
732 Ga0207639_10976919
733 Ga0207702_10456500
734 Ga0207641_10032468
735 Ga0207641_10064432
736 Ga0207641_10197876
737 Ga0207648_10002952
738 Ga0207648_10070808
739 Ga0207648_10300303
740 Ga0207676_10106351
741 Ga0207676_10672114
742 Ga0207674_10227596
743 Ga0207674_10269920
744 Ga0207674_10284713
745 Ga0207674_10545992
746 Ga0207675_100008546
747 Ga0207675_100077748
748 Ga0207675_100118148
749 Ga0207683_10001842
750 Ga0207683_10077172
751 Ga0207683_10108393
752 Ga0207683_10216388
753 Ga0207683_10335592
754 Ga0207698_10503422
755 Ga0207698_11011540
756 Ga0207698_11519712
757 Ga0207428_10124108
758 Ga0268266_10524180
759 Ga0268266_11081840
760 Ga0268266_11266911
761 Ga0268265_10125773
762 Ga0268265_10128484
763 Ga0268265_10577795
764 Ga0268265_11040178
765 Ga0268264_10017207
766 Ga0268264_10076822
767 Ga0268264_10506341
768 Ga0268264_10552203
769 Ga0307515_10000001
770 Ga0307412_10148959
771 Ga0373937_0674393
772 Ga0395898_0999005
773 Ga0395901_0680429
774 Ga0439438_081328
775 Ga0451787_727531
776 Ga0451798_0264186
777 Ga0451807_2334558
778 Ga0451839_0196638
779 Ga0439441_005343
780 Ga0439445_0009386
781 Ga0439457_138190
782 Ga0450898_042803
783 Ga0451577_0006025
784 Ga0453684_0019261
785 Ga0453684_0319194
786 Ga0453684_0358650
787 Ga0495638_0230302
788 Ga0495650_0032116
789 Ga0495621_0092506
790 Ga0495669_0256658
791 Ga0495670_0028471
792 Ga0495686_0017877
793 Ga0495686_0455651
794 Ga0496114_0590513
795 Ga0501317_101126
796 Ga0501034_0058164
797 Ga0501038_0406824
798 Ga0501039_0432308
799 Ga0501043_0004526
800 Ga0501046_0003983
801 Ga0501046_0365277
802 Ga0501047_0010015
803 Ga0501069_0088164
804 Ga0501070_0005701
805 Ga0501070_0157069
806 Ga0501073_0000371
807 Ga0501073_0077528
808 Ga0501074_0001823
809 Ga0501074_0061304
810 Ga0501079_0146863
811 Ga0501080_0019099
812 Ga0501080_0216384
813 Ga0501083_0059579
814 Ga0501035_0207361
815 Ga0501044_0131619
816 Ga0501044_0198889
817 nmdc:mga09592_7585_c1
818 nmdc:mga0qj67_337190_c1
819 nmdc:mga06r32_467475_c1
820 nmdc:mga08y16_144765_c1
821 nmdc:mga08y16_1675721_c1
822 nmdc:mga08y16_1746226_c1
823 nmdc:mga08y16_637461_c1
824 Ga0500644_0149884
825 Ga0500646_0125166
826 Ga0500611_000092
827 Ga0501084_0008192
828 Ga0501082_0057755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rup-assembly1.cif.gz_A structure of the human gigyf2-tnrc6a complex 0.7212 77 130
7z3c-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6388 73 131
3fma-assembly4.cif.gz_D crystal structure of the gyf domain of smy2 in complex with a proline-rich peptide from bbp/scsf1 0.6179 77 129
6p9b-assembly1.cif.gz_B hiv-1 protease multiple drug resistant mutant prs5b with amprenavir 0.6113 70 90
4e29-assembly1.cif.gz_A periplasmic domain of the chimeric wzzb chain length regulator protein 0.6081 2 68
ID Description Score Start End Superfamily
af_P32909_191_290_3.30.1490.40 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;GYF domain 0.631 77 129 3.30.1490.40
4ewtD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6047 2 71 3.30.70.360
af_Q54NC1_44_145_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.5992 70 90 2.40.30.10
af_Q0D8Q3_473_556_3.30.1490.40 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;GYF domain 0.5913 70 136 3.30.1490.40
af_A0A1D8PMM2_187_263_3.30.1490.40 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;GYF domain 0.589 70 121 3.30.1490.40
ID Description Score Start End GO Terms
AF-A0A3C1R3I0-F1-model_v4 deleted 0.9875 72 137
AF-A0A7Y2BCL2-F1-model_v4 ABC transporter ATPase 0.9673 3 135
AF-A0A4P5T180-F1-model_v4 ABC transporter ATPase 0.9666 1 136
AF-A0A6I6GSJ2-F1-model_v4 ABC transporter ATPase 0.963 1 136
AF-A0A3C0IBC4-F1-model_v4 ABC transporter ATPase 0.961 3 135

Map