F438225

General Info

Members Datasets Scaffolds Average Seq Length
414 149 828 208

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10200865|Ga0065707_102008652
Length 253
Sequence VSHAAAAEHVGVEPAESPLTPESWGKLGMWIFLAADAMSFGGLLAAYGALRYGDPTWPNPAHELGIQLTALMTFLLICSSVTMVEALAAIREGNHTGLRKFLLLTICGGGIFLGLQAYEWHHLIHEGQSITKNNFGATFFILTGFHGCHVFGGVVYLSAILGRAVGGRAGALLLGLTAAIGTVLAIYVTYNSAMLPVGLLAPIAMAAVVFLVSGTLKGGVYSAHENNEVEIGALYWHFVDLIWILVFTFVYLI

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
77 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
78 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
81 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
82 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
85 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
101 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.69
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10200865 3300005295 Bacteria 1311
2 Ga0058859_11764633 3300004798 Bacteria 7762
3 Ga0070690_100100186 3300005330 Bacteria 1920
4 Ga0070680_100673154 3300005336 Bacteria 890
5 Ga0070680_100862416 3300005336 Bacteria 781
6 Ga0070669_100122964 3300005353 Bacteria 1982
7 Ga0070669_100299187 3300005353 Bacteria 1293
8 Ga0070674_100097826 3300005356 Bacteria 2132
9 Ga0070703_10173446 3300005406 Bacteria 828
10 Ga0070705_100004205 3300005440 Bacteria 7030
11 Ga0070700_100531984 3300005441 Bacteria 910
12 Ga0070694_100043046 3300005444 Bacteria 3018
13 Ga0070694_100138163 3300005444 Bacteria 1767
14 Ga0070708_100002976 3300005445 Bacteria 13170
15 Ga0070708_100040407 3300005445 Bacteria 4084
16 Ga0070708_100171999 3300005445 Bacteria 2023
17 Ga0070708_100514539 3300005445 Bacteria 1129
18 Ga0070708_101122929 3300005445 Bacteria 736
19 Ga0070662_100134667 3300005457 Bacteria 1909
20 Ga0070706_100045504 3300005467 Bacteria 4054
21 Ga0070706_100060761 3300005467 Bacteria 3488
22 Ga0070706_100185856 3300005467 Bacteria 1942
23 Ga0070706_100382534 3300005467 Bacteria 1311
24 Ga0070706_100967259 3300005467 Bacteria 785
25 Ga0070707_100036972 3300005468 Bacteria 4659
26 Ga0070707_100348004 3300005468 Bacteria 1439
27 Ga0070707_100565094 3300005468 Bacteria 1099
28 Ga0070707_100593030 3300005468 Bacteria 1070
29 Ga0070699_100021790 3300005518 Bacteria 5523
30 Ga0070699_100693018 3300005518 Bacteria 931
31 Ga0070699_100936754 3300005518 Bacteria 794
32 Ga0070697_100006237 3300005536 Bacteria 9231
33 Ga0070697_100011351 3300005536 Bacteria 6961
34 Ga0070697_100021047 3300005536 Bacteria 5165
35 Ga0070697_100166933 3300005536 Bacteria 1861
36 Ga0070697_100214193 3300005536 Bacteria 1641
37 Ga0070697_100576537 3300005536 Bacteria 988
38 Ga0070672_100045547 3300005543 Bacteria 3394
39 Ga0070695_100072011 3300005545 Bacteria 2265
40 Ga0070695_100240573 3300005545 Bacteria 1313
41 Ga0070696_100005759 3300005546 Bacteria 8271
42 Ga0070696_100098764 3300005546 Bacteria 2089
43 Ga0070696_100148844 3300005546 Bacteria 1717
44 Ga0070696_100313586 3300005546 Bacteria 1205
45 Ga0070696_100333828 3300005546 Bacteria 1170
46 Ga0070704_100070853 3300005549 Bacteria 2531
47 Ga0070704_100114986 3300005549 Bacteria 2055
48 Ga0070704_100147736 3300005549 Bacteria 1844
49 Ga0070704_100207371 3300005549 Bacteria 1586
50 Ga0068854_100642692 3300005578 Bacteria 910
51 Ga0068859_100226417 3300005617 Bacteria 1958
52 Ga0068860_100089264 3300005843 Bacteria 2935
53 Ga0068862_100354723 3300005844 Bacteria 1362
54 Ga0068862_100447858 3300005844 Bacteria 1217
55 Ga0081538_10027036 3300005981 Unclassified 3989
56 Ga0081539_10000702 3300005985 Bacteria 67205
57 Ga0081539_10168701 3300005985 Unclassified 1037
58 Ga0075432_10127267 3300006058 Bacteria 962
59 Ga0075428_100000123 3300006844 Bacteria 66826
60 Ga0075428_100001197 3300006844 Bacteria 27767
61 Ga0075428_100002086 3300006844 Bacteria 21561
62 Ga0075428_100020650 3300006844 Bacteria 7292
63 Ga0075428_100043187 3300006844 Bacteria 4956
64 Ga0075428_100120715 3300006844 Bacteria 2854
65 Ga0075428_100133355 3300006844 Bacteria 2701
66 Ga0075428_100288736 3300006844 Bacteria 1765
67 Ga0075428_100380433 3300006844 Bacteria 1513
68 Ga0075428_100384975 3300006844 Bacteria 1503
69 Ga0075428_100800274 3300006844 Bacteria 1002
70 Ga0075430_100001228 3300006846 Bacteria 20620
71 Ga0075430_100011291 3300006846 Bacteria 7575
72 Ga0075430_100039501 3300006846 Bacteria 3995
73 Ga0075430_100048590 3300006846 Bacteria 3583
74 Ga0075430_100170248 3300006846 Bacteria 1812
75 Ga0075431_100001438 3300006847 Bacteria 21928
76 Ga0075431_100006732 3300006847 Bacteria 11413
77 Ga0075431_100012038 3300006847 Bacteria 8729
78 Ga0075431_100062344 3300006847 Bacteria 3847
79 Ga0075431_100074511 3300006847 Bacteria 3502
80 Ga0075431_100247071 3300006847 Bacteria 1814
81 Ga0075431_100430368 3300006847 Bacteria 1318
82 Ga0075431_100432514 3300006847 Bacteria 1314
83 Ga0075433_10001044 3300006852 Bacteria 19805
84 Ga0075433_10008044 3300006852 Bacteria 8395
85 Ga0075433_10018887 3300006852 Bacteria 5737
86 Ga0075433_10102905 3300006852 Bacteria 2529
87 Ga0075433_10158418 3300006852 Bacteria 2015
88 Ga0075433_10183145 3300006852 Bacteria 1864
89 Ga0075433_10187062 3300006852 Bacteria 1842
90 Ga0075433_10332007 3300006852 Bacteria 1344
91 Ga0075433_10639757 3300006852 Bacteria 933
92 Ga0075433_10832283 3300006852 Bacteria 806
93 Ga0075434_100005031 3300006871 Bacteria 12002
94 Ga0075434_100006853 3300006871 Bacteria 10492
95 Ga0075434_100042962 3300006871 Bacteria 4482
96 Ga0075434_100045555 3300006871 Bacteria 4351
97 Ga0075434_100054548 3300006871 Bacteria 3970
98 Ga0075434_100205281 3300006871 Bacteria 1991
99 Ga0075434_100327324 3300006871 Unclassified 1553
100 Ga0075434_100627755 3300006871 Bacteria 1093
101 Ga0075429_100000222 3300006880 Bacteria 38478
102 Ga0075429_100002747 3300006880 Bacteria 14866
103 Ga0075429_100008516 3300006880 Bacteria 8924
104 Ga0075429_100015970 3300006880 Bacteria 6504
105 Ga0075429_100018851 3300006880 Bacteria 5977
106 Ga0075429_100019188 3300006880 Bacteria 5924
107 Ga0075429_100035682 3300006880 Bacteria 4326
108 Ga0075429_100038532 3300006880 Bacteria 4161
109 Ga0075429_100051170 3300006880 Bacteria 3594
110 Ga0075429_100148280 3300006880 Bacteria 2054
111 Ga0068865_100275752 3300006881 Bacteria 1337
112 Ga0068865_100309668 3300006881 Bacteria 1267
113 Ga0075436_100007325 3300006914 Bacteria 7544
114 Ga0075436_100007647 3300006914 Bacteria 7383
115 Ga0075436_100013908 3300006914 Bacteria 5511
116 Ga0097620_100226422 3300006931 Bacteria 1958
117 Ga0075435_100007177 3300007076 Bacteria 7923
118 Ga0075435_100028889 3300007076 Bacteria 4351
119 Ga0075435_100101551 3300007076 Bacteria 2384
120 Ga0075435_100111432 3300007076 Bacteria 2276
121 Ga0075435_100155232 3300007076 Bacteria 1926
122 Ga0099794_10005122 3300007265 Bacteria 5227
123 Ga0099794_10084001 3300007265 Bacteria 1574
124 Ga0099794_10321123 3300007265 Bacteria 803
125 Ga0111539_10003984 3300009094 Bacteria 19400
126 Ga0111539_10014882 3300009094 Bacteria 9699
127 Ga0111539_10018969 3300009094 Bacteria 8503
128 Ga0111539_10068737 3300009094 Bacteria 4182
129 Ga0114129_10000003 3300009147 Bacteria 183186
130 Ga0114129_10002359 3300009147 Bacteria 26209
131 Ga0114129_10002850 3300009147 Bacteria 24174
132 Ga0114129_10003687 3300009147 Bacteria 21565
133 Ga0114129_10017925 3300009147 Bacteria 10080
134 Ga0114129_10036045 3300009147 Bacteria 6986
135 Ga0114129_10042831 3300009147 Bacteria 6371
136 Ga0114129_10055268 3300009147 Bacteria 5565
137 Ga0114129_10078518 3300009147 Bacteria 4591
138 Ga0114129_10175660 3300009147 Bacteria 2917
139 Ga0114129_10203081 3300009147 Bacteria 2683
140 Ga0114129_10970962 3300009147 Bacteria 1072
141 Ga0114129_10979271 3300009147 Bacteria 1066
142 Ga0105242_10318173 3300009176 Bacteria 1426
143 Ga0105242_10711573 3300009176 Bacteria 984
144 Ga0105249_10533824 3300009553 Unclassified 1222
145 Ga0105249_10716174 3300009553 Bacteria 1061
146 Ga0105249_10798966 3300009553 Bacteria 1007
147 Ga0099796_10124137 3300010159 Bacteria 995
148 Ga0157378_10051081 3300013297 Bacteria 3679
149 Ga0157378_10130792 3300013297 Bacteria 2323
150 Ga0157378_11191230 3300013297 Bacteria 801
151 Ga0163162_10183437 3300013306 Bacteria 2219
152 Ga0163162_10336110 3300013306 Bacteria 1643
153 Ga0163162_10431278 3300013306 Bacteria 1450
154 Ga0157380_10232303 3300014326 Bacteria 1657
155 Ga0163161_10178040 3300017792 Bacteria 1629
156 Ga0207642_10085964 3300025899 Bacteria 1540
157 Ga0207645_10205172 3300025907 Bacteria 1297
158 Ga0207684_10000888 3300025910 Bacteria 33994
159 Ga0207684_10058545 3300025910 Bacteria 3270
160 Ga0207684_10073471 3300025910 Bacteria 2904
161 Ga0207684_10135043 3300025910 Bacteria 2118
162 Ga0207684_10439488 3300025910 Bacteria 1120
163 Ga0207652_10318611 3300025921 Bacteria 1404
164 Ga0207646_10022814 3300025922 Bacteria 5756
165 Ga0207646_10035346 3300025922 Bacteria 4513
166 Ga0207646_10180602 3300025922 Bacteria 1906
167 Ga0207646_10524441 3300025922 Bacteria 1066
168 Ga0207646_10592116 3300025922 Bacteria 996
169 Ga0207681_10135557 3300025923 Bacteria 1826
170 Ga0207681_10186749 3300025923 Bacteria 1583
171 Ga0207681_10605817 3300025923 Bacteria 905
172 Ga0207706_10019531 3300025933 Bacteria 6096
173 Ga0207706_10240751 3300025933 Bacteria 1582
174 Ga0207691_10033083 3300025940 Bacteria 4816
175 Ga0207712_10169738 3300025961 Bacteria 1704
176 Ga0207712_10832297 3300025961 Bacteria 813
177 Ga0207668_10974791 3300025972 Bacteria 757
178 Ga0207640_10342086 3300025981 Bacteria 1199
179 Ga0207658_10966211 3300025986 Bacteria 777
180 Ga0207677_10752136 3300026023 Bacteria 869
181 Ga0207678_10381893 3300026067 Bacteria 1218
182 Ga0207708_10448693 3300026075 Bacteria 1074
183 Ga0207708_10512941 3300026075 Bacteria 1006
184 Ga0207648_10029579 3300026089 Bacteria 4858
185 Ga0207675_100056240 3300026118 Bacteria 3669
186 Ga0209588_1011857 3300027671 Bacteria 2640
187 Ga0209588_1049888 3300027671 Bacteria 1354
188 Ga0209588_1101646 3300027671 Bacteria 925
189 Ga0207428_10000035 3300027907 Bacteria 229100
190 Ga0207428_10009951 3300027907 Bacteria 8514
191 Ga0207428_10064190 3300027907 Bacteria 2900
192 Ga0268265_10022902 3300028380 Bacteria 4397
193 Ga0268265_10240356 3300028380 Bacteria 1598
194 Ga0268265_10341678 3300028380 Bacteria 1363
195 Ga0268264_10057639 3300028381 Bacteria 3249
196 Ga0265765_1009149 3300030879 Bacteria 1087
197 Ga0265760_10010235 3300031090 Bacteria 2676
198 Ga0307405_10052706 3300031731 Bacteria 2531
199 Ga0307410_10137268 3300031852 Bacteria 1804
200 Ga0307409_100247997 3300031995 Bacteria 1626
201 Ga0307416_100424898 3300032002 Bacteria 1374
202 Ga0307411_10024043 3300032005 Bacteria 3624
203 Ga0373958_0029671 3300034819 Bacteria 1066
204 Ga0373958_0075890 3300034819 Bacteria 754
205 Ga0373940_0105723 3300035088 Bacteria 859
206 Ga0373951_0008216 3300035091 Bacteria 2363
207 Ga0373923_0037037 3300035111 Bacteria 1994
208 Ga0373932_0013176 3300035112 Bacteria 2051
209 Ga0373939_0071161 3300035114 Bacteria 1133
210 Ga0373946_0349266 3300035171 Bacteria 739
211 Ga0373955_0012215 3300035172 Bacteria 4123
212 Ga0373961_0035133 3300035241 Bacteria 1421
213 Ga0373962_0007057 3300035242 Bacteria 2744
214 Ga0373931_0003145 3300035691 Bacteria 7369
215 Ga0373931_0051807 3300035691 Bacteria 2187
216 Ga0373937_0015873 3300036401 Bacteria 6677
217 Ga0395899_0200215 3300037312 Bacteria 1393
218 Ga0395900_0081510 3300037418 Bacteria 3324
219 Ga0395900_0111549 3300037418 Bacteria 2809
220 Ga0395898_0120534 3300037466 Bacteria 2513
221 Ga0395898_0271355 3300037466 Bacteria 1618
222 Ga0395905_0337000 3300037471 Bacteria 1399
223 Ga0395901_0013258 3300038443 Bacteria 8370
224 Ga0439441_018858 3300042001 Bacteria 1251
225 Ga0451577_0051580 3300042876 Bacteria 3673
226 Ga0451577_0508624 3300042876 Bacteria 1094
227 Ga0453683_0281107 3300044673 Bacteria 1063
228 Ga0453683_0451241 3300044673 Bacteria 832
229 Ga0453683_0631056 3300044673 Bacteria 700
230 Ga0451576_1012618 3300045051 Bacteria 870
231 Ga0495580_0012689 3300046472 Bacteria 6459
232 Ga0495639_0326771 3300046475 Bacteria 767
233 Ga0495594_0074706 3300046499 Bacteria 1889
234 Ga0495642_0141058 3300046528 Bacteria 1040
235 Ga0495659_0231266 3300046664 Bacteria 766
236 Ga0495669_0377170 3300046684 Bacteria 686
237 Ga0495604_0087593 3300047317 Bacteria 2319
238 Ga0495675_0264716 3300047444 Bacteria 1029
239 Ga0495602_0018257 3300048088 Bacteria 7011
240 Ga0496102_0010005 3300048905 Bacteria 8155
241 Ga0496103_0039481 3300048906 Bacteria 2901
242 Ga0496106_0112942 3300048909 Bacteria 2117
243 Ga0496106_0115882 3300048909 Bacteria 2090
244 Ga0496109_0363173 3300048912 Bacteria 1368
245 Ga0496110_0814384 3300048913 Bacteria 838
246 Ga0496113_0916570 3300048916 Bacteria 693
247 Ga0501312_008599 3300049528 Bacteria 1329
248 Ga0501033_0096135 3300049570 Bacteria 2165
249 Ga0501036_0308467 3300049572 Bacteria 1323
250 Ga0501036_0921601 3300049572 Bacteria 717
251 Ga0501038_0210889 3300049574 Bacteria 1554
252 Ga0501039_0186363 3300049575 Bacteria 1632
253 Ga0501040_0028732 3300049576 Bacteria 3750
254 Ga0501040_0284315 3300049576 Bacteria 1182
255 Ga0501041_0026566 3300049577 Bacteria 3484
256 Ga0501041_0033498 3300049577 Bacteria 3108
257 Ga0501041_0081332 3300049577 Bacteria 1995
258 Ga0501042_0109309 3300049578 Bacteria 1991
259 Ga0501042_0226441 3300049578 Bacteria 1349
260 Ga0501042_0300373 3300049578 Bacteria 1160
261 Ga0501042_0499494 3300049578 Bacteria 883
262 Ga0501042_0747924 3300049578 Bacteria 711
263 Ga0501043_0430616 3300049579 Bacteria 994
264 Ga0501043_0584641 3300049579 Bacteria 826
265 Ga0501046_0087422 3300049580 Bacteria 2402
266 Ga0501046_0164860 3300049580 Bacteria 1665
267 Ga0501046_0178301 3300049580 Bacteria 1590
268 Ga0501048_0851137 3300049582 Bacteria 656
269 Ga0501067_0140193 3300049583 Bacteria 1346
270 Ga0501068_0049693 3300049584 Bacteria 2534
271 Ga0501068_0119025 3300049584 Bacteria 1646
272 Ga0501071_0328511 3300049587 Bacteria 1162
273 Ga0501071_0400283 3300049587 Bacteria 1048
274 Ga0501072_0059866 3300049588 Bacteria 3003
275 Ga0501072_0066374 3300049588 Bacteria 2846
276 Ga0501072_0257343 3300049588 Bacteria 1390
277 Ga0501072_0663621 3300049588 Bacteria 820
278 Ga0501073_0343970 3300049589 Bacteria 1030
279 Ga0501074_0502742 3300049590 Bacteria 859
280 Ga0501074_0551399 3300049590 Bacteria 816
281 Ga0501075_0037000 3300049591 Bacteria 3644
282 Ga0501075_0049863 3300049591 Bacteria 3147
283 Ga0501075_0480445 3300049591 Bacteria 948
284 Ga0501075_0521848 3300049591 Bacteria 906
285 Ga0501076_0001232 3300049592 Bacteria 17028
286 Ga0501076_0505314 3300049592 Bacteria 996
287 Ga0501076_0624188 3300049592 Bacteria 889
288 Ga0501077_0002319 3300049593 Bacteria 11460
289 Ga0501077_0018271 3300049593 Bacteria 4436
290 Ga0501077_0097917 3300049593 Bacteria 1859
291 Ga0501077_0198125 3300049593 Bacteria 1276
292 Ga0501077_0226781 3300049593 Bacteria 1188
293 Ga0501079_0016131 3300049741 Bacteria 5709
294 Ga0501079_0040196 3300049741 Bacteria 3607
295 Ga0501079_0109756 3300049741 Bacteria 2143
296 Ga0501079_0126995 3300049741 Bacteria 1984
297 Ga0501079_0133631 3300049741 Bacteria 1931
298 Ga0501079_0467442 3300049741 Bacteria 991
299 Ga0501080_0329091 3300049742 Bacteria 1382
300 Ga0501080_0654468 3300049742 Bacteria 929
301 Ga0501081_0001699 3300049743 Bacteria 13653
302 Ga0501081_0031894 3300049743 Bacteria 3572
303 Ga0501081_0075829 3300049743 Bacteria 2348
304 Ga0501081_0420920 3300049743 Bacteria 990
305 Ga0501081_0521783 3300049743 Bacteria 886
306 Ga0501081_0534015 3300049743 Bacteria 875
307 Ga0501081_0601060 3300049743 Bacteria 824
308 Ga0501045_0109677 3300049824 Bacteria 2046
309 Ga0501045_0177412 3300049824 Bacteria 1587
310 Ga0501045_0203310 3300049824 Bacteria 1476
311 Ga0501045_0450649 3300049824 Bacteria 957
312 Ga0501045_0567834 3300049824 Bacteria 841
313 nmdc:mga05p37_1005023_c1 3300050507 Bacteria 885
314 nmdc:mga05p37_101764_c1 3300050507 Bacteria 3538
315 nmdc:mga05p37_1185327_c1 3300050507 Bacteria 791
316 nmdc:mga05p37_174603_c1 3300050507 Bacteria 2619
317 nmdc:mga05p37_19237_c1 3300050507 Bacteria 8261
318 nmdc:mga05p37_2095_c1 3300050507 Bacteria 23279
319 nmdc:mga05p37_210572_c1 3300050507 Bacteria 2350
320 nmdc:mga05p37_25873_c1 3300050507 Bacteria 7134
321 nmdc:mga05p37_31916_c1 3300050507 Bacteria 6438
322 nmdc:mga05p37_365546_c1 3300050507 Bacteria 1695
323 nmdc:mga05p37_50210_c1 3300050507 Bacteria 5130
324 nmdc:mga05p37_5284_c1 3300050507 Bacteria 15158
325 nmdc:mga05p37_531829_c1 3300050507 Bacteria 1342
326 nmdc:mga05p37_651_c1 3300050507 Bacteria 38411
327 nmdc:mga05p37_72642_c1 3300050507 Bacteria 4234
328 nmdc:mga05p37_857_c1 3300050507 Bacteria 34239
329 nmdc:mga05p37_92283_c1 3300050507 Bacteria 3731
330 nmdc:mga09592_130618_c1 3300050508 Bacteria 2161
331 nmdc:mga09592_1634_c2 3300050508 Bacteria 7105
332 nmdc:mga09592_2243_c1 3300050508 Bacteria 15566
333 nmdc:mga09592_237029_c1 3300050508 Bacteria 1581
334 nmdc:mga09592_41601_c1 3300050508 Bacteria 3864
335 nmdc:mga09592_46786_c1 3300050508 Bacteria 3645
336 nmdc:mga09592_5241_c1 3300050508 Bacteria 10531
337 nmdc:mga09592_62437_c1 3300050508 Bacteria 3152
338 nmdc:mga09592_7135_c1 3300050508 Bacteria 9084
339 nmdc:mga0qj67_154951_c1 3300050509 Bacteria 1859
340 nmdc:mga0qj67_1872_c1 3300050509 Bacteria 14922
341 nmdc:mga0qj67_210560_c1 3300050509 Bacteria 1579
342 nmdc:mga0qj67_28141_c1 3300050509 Bacteria 4361
343 nmdc:mga0qj67_319_c1 3300050509 Bacteria 33276
344 nmdc:mga0qj67_49926_c1 3300050509 Bacteria 3307
345 nmdc:mga06r32_1760_c1 3300050510 Bacteria 19429
346 nmdc:mga06r32_22857_c1 3300050510 Bacteria 5783
347 nmdc:mga06r32_281945_c1 3300050510 Bacteria 1648
348 nmdc:mga06r32_2844_c1 3300050510 Bacteria 15537
349 nmdc:mga06r32_299668_c1 3300050510 Bacteria 1594
350 nmdc:mga06r32_31086_c1 3300050510 Bacteria 5012
351 nmdc:mga06r32_406636_c1 3300050510 Bacteria 1343
352 nmdc:mga06r32_568858_c1 3300050510 Bacteria 1106
353 nmdc:mga06r32_594677_c1 3300050510 Bacteria 1078
354 nmdc:mga06r32_7382_c1 3300050510 Bacteria 9892
355 nmdc:mga06r32_96693_c1 3300050510 Bacteria 2893
356 nmdc:mga08y16_12053_c1 3300050511 Bacteria 9084
357 nmdc:mga08y16_15277_c1 3300050511 Bacteria 8077
358 nmdc:mga08y16_45500_c1 3300050511 Bacteria 4599
359 nmdc:mga08y16_727_c1 3300050511 Bacteria 31229
360 nmdc:mga08y16_731259_c1 3300050511 Bacteria 987
361 nmdc:mga0n895_15174_c1 3300050512 Bacteria 7020
362 nmdc:mga0n895_15724_c1 3300050512 Bacteria 6916
363 nmdc:mga0n895_202712_c1 3300050512 Bacteria 2014
364 nmdc:mga0n895_2604_c1 3300050512 Bacteria 14184
365 nmdc:mga0n895_30351_c2 3300050512 Bacteria 4546
366 nmdc:mga0n895_365999_c1 3300050512 Bacteria 1460
367 nmdc:mga0n895_380_c1 3300050512 Bacteria 30032
368 nmdc:mga0n895_41133_c1 3300050512 Bacteria 4493
369 nmdc:mga0n895_43619_c1 3300050512 Bacteria 4371
370 nmdc:mga0n895_645433_c1 3300050512 Bacteria 1058
371 nmdc:mga0n895_659696_c1 3300050512 Bacteria 1044
372 nmdc:mga0n895_68545_c1 3300050512 Unclassified 3514
373 nmdc:mga0n895_850808_c1 3300050512 Bacteria 900
374 nmdc:mga0rr50_100897_c1 3300050513 Bacteria 2268
375 nmdc:mga0rr50_197008_c1 3300050513 Bacteria 1654
376 nmdc:mga0rr50_31378_c1 3300050513 Bacteria 3773
377 nmdc:mga0rr50_52778_c1 3300050513 Bacteria 3022
378 nmdc:mga08x19_108267_c1 3300050514 Bacteria 1851
379 nmdc:mga08x19_110196_c1 3300050514 Bacteria 1835
380 nmdc:mga08x19_158574_c1 3300050514 Bacteria 1536
381 nmdc:mga08x19_233613_c1 3300050514 Bacteria 1266
382 nmdc:mga08x19_25117_c1 3300050514 Bacteria 3710
383 nmdc:mga08x19_383312_c1 3300050514 Bacteria 985
384 nmdc:mga08x19_9123_c1 3300050514 Bacteria 5922
385 nmdc:mga0a205_1333_c1 3300050515 Bacteria 20823
386 nmdc:mga0a205_141168_c1 3300050515 Bacteria 2309
387 nmdc:mga0a205_160354_c1 3300050515 Bacteria 2146
388 nmdc:mga0a205_16912_c1 3300050515 Bacteria 6829
389 nmdc:mga0a205_197104_c1 3300050515 Bacteria 1905
390 nmdc:mga0a205_236983_c1 3300050515 Bacteria 1706
391 nmdc:mga0a205_29682_c1 3300050515 Bacteria 5234
392 nmdc:mga0a205_306012_c1 3300050515 Bacteria 1462
393 nmdc:mga0a205_32048_c1 3300050515 Bacteria 5039
394 nmdc:mga0a205_354170_c1 3300050515 Bacteria 1335
395 nmdc:mga0a205_44254_c1 3300050515 Bacteria 4290
396 nmdc:mga0a205_471123_c1 3300050515 Bacteria 1115
397 nmdc:mga0a205_558426_c1 3300050515 Bacteria 1000
398 nmdc:mga0a205_632773_c1 3300050515 Bacteria 922
399 Ga0495619_0129035 3300053085 Bacteria 1737
400 Ga0501084_0026449 3300054114 Bacteria 4842
401 Ga0501084_0083368 3300054114 Bacteria 2683
402 Ga0501084_0315053 3300054114 Bacteria 1321
403 Ga0590075_075415 3300059424 Bacteria 872
404 Ga0501082_0010365 3300060353 Bacteria 8026
405 Ga0501082_0223501 3300060353 Bacteria 1638
406 Ga0501082_0354216 3300060353 Bacteria 1280
407 Ga0501082_0491892 3300060353 Bacteria 1072
408 Ga0530510_0000785 3300061734 Bacteria 20630
409 Ga0530510_0003255 3300061734 Bacteria 11164
410 Ga0530510_0015227 3300061734 Bacteria 5430
411 Ga0530510_0145924 3300061734 Bacteria 1745
412 Ga0530510_0162936 3300061734 Bacteria 1650
413 Ga0530510_0413464 3300061734 Bacteria 1018
414 Ga0530510_0708726 3300061734 Bacteria 767
415 Ga0065707_10200865
416 Ga0058859_11764633
417 Ga0070690_100100186
418 Ga0070680_100673154
419 Ga0070680_100862416
420 Ga0070669_100122964
421 Ga0070669_100299187
422 Ga0070674_100097826
423 Ga0070703_10173446
424 Ga0070705_100004205
425 Ga0070700_100531984
426 Ga0070694_100043046
427 Ga0070694_100138163
428 Ga0070708_100002976
429 Ga0070708_100040407
430 Ga0070708_100171999
431 Ga0070708_100514539
432 Ga0070708_101122929
433 Ga0070662_100134667
434 Ga0070706_100045504
435 Ga0070706_100060761
436 Ga0070706_100185856
437 Ga0070706_100382534
438 Ga0070706_100967259
439 Ga0070707_100036972
440 Ga0070707_100348004
441 Ga0070707_100565094
442 Ga0070707_100593030
443 Ga0070699_100021790
444 Ga0070699_100693018
445 Ga0070699_100936754
446 Ga0070697_100006237
447 Ga0070697_100011351
448 Ga0070697_100021047
449 Ga0070697_100166933
450 Ga0070697_100214193
451 Ga0070697_100576537
452 Ga0070672_100045547
453 Ga0070695_100072011
454 Ga0070695_100240573
455 Ga0070696_100005759
456 Ga0070696_100098764
457 Ga0070696_100148844
458 Ga0070696_100313586
459 Ga0070696_100333828
460 Ga0070704_100070853
461 Ga0070704_100114986
462 Ga0070704_100147736
463 Ga0070704_100207371
464 Ga0068854_100642692
465 Ga0068859_100226417
466 Ga0068860_100089264
467 Ga0068862_100354723
468 Ga0068862_100447858
469 Ga0081538_10027036
470 Ga0081539_10000702
471 Ga0081539_10168701
472 Ga0075432_10127267
473 Ga0075428_100000123
474 Ga0075428_100001197
475 Ga0075428_100002086
476 Ga0075428_100020650
477 Ga0075428_100043187
478 Ga0075428_100120715
479 Ga0075428_100133355
480 Ga0075428_100288736
481 Ga0075428_100380433
482 Ga0075428_100384975
483 Ga0075428_100800274
484 Ga0075430_100001228
485 Ga0075430_100011291
486 Ga0075430_100039501
487 Ga0075430_100048590
488 Ga0075430_100170248
489 Ga0075431_100001438
490 Ga0075431_100006732
491 Ga0075431_100012038
492 Ga0075431_100062344
493 Ga0075431_100074511
494 Ga0075431_100247071
495 Ga0075431_100430368
496 Ga0075431_100432514
497 Ga0075433_10001044
498 Ga0075433_10008044
499 Ga0075433_10018887
500 Ga0075433_10102905
501 Ga0075433_10158418
502 Ga0075433_10183145
503 Ga0075433_10187062
504 Ga0075433_10332007
505 Ga0075433_10639757
506 Ga0075433_10832283
507 Ga0075434_100005031
508 Ga0075434_100006853
509 Ga0075434_100042962
510 Ga0075434_100045555
511 Ga0075434_100054548
512 Ga0075434_100205281
513 Ga0075434_100327324
514 Ga0075434_100627755
515 Ga0075429_100000222
516 Ga0075429_100002747
517 Ga0075429_100008516
518 Ga0075429_100015970
519 Ga0075429_100018851
520 Ga0075429_100019188
521 Ga0075429_100035682
522 Ga0075429_100038532
523 Ga0075429_100051170
524 Ga0075429_100148280
525 Ga0068865_100275752
526 Ga0068865_100309668
527 Ga0075436_100007325
528 Ga0075436_100007647
529 Ga0075436_100013908
530 Ga0097620_100226422
531 Ga0075435_100007177
532 Ga0075435_100028889
533 Ga0075435_100101551
534 Ga0075435_100111432
535 Ga0075435_100155232
536 Ga0099794_10005122
537 Ga0099794_10084001
538 Ga0099794_10321123
539 Ga0111539_10003984
540 Ga0111539_10014882
541 Ga0111539_10018969
542 Ga0111539_10068737
543 Ga0114129_10000003
544 Ga0114129_10002359
545 Ga0114129_10002850
546 Ga0114129_10003687
547 Ga0114129_10017925
548 Ga0114129_10036045
549 Ga0114129_10042831
550 Ga0114129_10055268
551 Ga0114129_10078518
552 Ga0114129_10175660
553 Ga0114129_10203081
554 Ga0114129_10970962
555 Ga0114129_10979271
556 Ga0105242_10318173
557 Ga0105242_10711573
558 Ga0105249_10533824
559 Ga0105249_10716174
560 Ga0105249_10798966
561 Ga0099796_10124137
562 Ga0157378_10051081
563 Ga0157378_10130792
564 Ga0157378_11191230
565 Ga0163162_10183437
566 Ga0163162_10336110
567 Ga0163162_10431278
568 Ga0157380_10232303
569 Ga0163161_10178040
570 Ga0207642_10085964
571 Ga0207645_10205172
572 Ga0207684_10000888
573 Ga0207684_10058545
574 Ga0207684_10073471
575 Ga0207684_10135043
576 Ga0207684_10439488
577 Ga0207652_10318611
578 Ga0207646_10022814
579 Ga0207646_10035346
580 Ga0207646_10180602
581 Ga0207646_10524441
582 Ga0207646_10592116
583 Ga0207681_10135557
584 Ga0207681_10186749
585 Ga0207681_10605817
586 Ga0207706_10019531
587 Ga0207706_10240751
588 Ga0207691_10033083
589 Ga0207712_10169738
590 Ga0207712_10832297
591 Ga0207668_10974791
592 Ga0207640_10342086
593 Ga0207658_10966211
594 Ga0207677_10752136
595 Ga0207678_10381893
596 Ga0207708_10448693
597 Ga0207708_10512941
598 Ga0207648_10029579
599 Ga0207675_100056240
600 Ga0209588_1011857
601 Ga0209588_1049888
602 Ga0209588_1101646
603 Ga0207428_10000035
604 Ga0207428_10009951
605 Ga0207428_10064190
606 Ga0268265_10022902
607 Ga0268265_10240356
608 Ga0268265_10341678
609 Ga0268264_10057639
610 Ga0265765_1009149
611 Ga0265760_10010235
612 Ga0307405_10052706
613 Ga0307410_10137268
614 Ga0307409_100247997
615 Ga0307416_100424898
616 Ga0307411_10024043
617 Ga0373958_0029671
618 Ga0373958_0075890
619 Ga0373940_0105723
620 Ga0373951_0008216
621 Ga0373923_0037037
622 Ga0373932_0013176
623 Ga0373939_0071161
624 Ga0373946_0349266
625 Ga0373955_0012215
626 Ga0373961_0035133
627 Ga0373962_0007057
628 Ga0373931_0003145
629 Ga0373931_0051807
630 Ga0373937_0015873
631 Ga0395899_0200215
632 Ga0395900_0081510
633 Ga0395900_0111549
634 Ga0395898_0120534
635 Ga0395898_0271355
636 Ga0395905_0337000
637 Ga0395901_0013258
638 Ga0439441_018858
639 Ga0451577_0051580
640 Ga0451577_0508624
641 Ga0453683_0281107
642 Ga0453683_0451241
643 Ga0453683_0631056
644 Ga0451576_1012618
645 Ga0495580_0012689
646 Ga0495639_0326771
647 Ga0495594_0074706
648 Ga0495642_0141058
649 Ga0495659_0231266
650 Ga0495669_0377170
651 Ga0495604_0087593
652 Ga0495675_0264716
653 Ga0495602_0018257
654 Ga0496102_0010005
655 Ga0496103_0039481
656 Ga0496106_0112942
657 Ga0496106_0115882
658 Ga0496109_0363173
659 Ga0496110_0814384
660 Ga0496113_0916570
661 Ga0501312_008599
662 Ga0501033_0096135
663 Ga0501036_0308467
664 Ga0501036_0921601
665 Ga0501038_0210889
666 Ga0501039_0186363
667 Ga0501040_0028732
668 Ga0501040_0284315
669 Ga0501041_0026566
670 Ga0501041_0033498
671 Ga0501041_0081332
672 Ga0501042_0109309
673 Ga0501042_0226441
674 Ga0501042_0300373
675 Ga0501042_0499494
676 Ga0501042_0747924
677 Ga0501043_0430616
678 Ga0501043_0584641
679 Ga0501046_0087422
680 Ga0501046_0164860
681 Ga0501046_0178301
682 Ga0501048_0851137
683 Ga0501067_0140193
684 Ga0501068_0049693
685 Ga0501068_0119025
686 Ga0501071_0328511
687 Ga0501071_0400283
688 Ga0501072_0059866
689 Ga0501072_0066374
690 Ga0501072_0257343
691 Ga0501072_0663621
692 Ga0501073_0343970
693 Ga0501074_0502742
694 Ga0501074_0551399
695 Ga0501075_0037000
696 Ga0501075_0049863
697 Ga0501075_0480445
698 Ga0501075_0521848
699 Ga0501076_0001232
700 Ga0501076_0505314
701 Ga0501076_0624188
702 Ga0501077_0002319
703 Ga0501077_0018271
704 Ga0501077_0097917
705 Ga0501077_0198125
706 Ga0501077_0226781
707 Ga0501079_0016131
708 Ga0501079_0040196
709 Ga0501079_0109756
710 Ga0501079_0126995
711 Ga0501079_0133631
712 Ga0501079_0467442
713 Ga0501080_0329091
714 Ga0501080_0654468
715 Ga0501081_0001699
716 Ga0501081_0031894
717 Ga0501081_0075829
718 Ga0501081_0420920
719 Ga0501081_0521783
720 Ga0501081_0534015
721 Ga0501081_0601060
722 Ga0501045_0109677
723 Ga0501045_0177412
724 Ga0501045_0203310
725 Ga0501045_0450649
726 Ga0501045_0567834
727 nmdc:mga05p37_1005023_c1
728 nmdc:mga05p37_101764_c1
729 nmdc:mga05p37_1185327_c1
730 nmdc:mga05p37_174603_c1
731 nmdc:mga05p37_19237_c1
732 nmdc:mga05p37_2095_c1
733 nmdc:mga05p37_210572_c1
734 nmdc:mga05p37_25873_c1
735 nmdc:mga05p37_31916_c1
736 nmdc:mga05p37_365546_c1
737 nmdc:mga05p37_50210_c1
738 nmdc:mga05p37_5284_c1
739 nmdc:mga05p37_531829_c1
740 nmdc:mga05p37_651_c1
741 nmdc:mga05p37_72642_c1
742 nmdc:mga05p37_857_c1
743 nmdc:mga05p37_92283_c1
744 nmdc:mga09592_130618_c1
745 nmdc:mga09592_1634_c2
746 nmdc:mga09592_2243_c1
747 nmdc:mga09592_237029_c1
748 nmdc:mga09592_41601_c1
749 nmdc:mga09592_46786_c1
750 nmdc:mga09592_5241_c1
751 nmdc:mga09592_62437_c1
752 nmdc:mga09592_7135_c1
753 nmdc:mga0qj67_154951_c1
754 nmdc:mga0qj67_1872_c1
755 nmdc:mga0qj67_210560_c1
756 nmdc:mga0qj67_28141_c1
757 nmdc:mga0qj67_319_c1
758 nmdc:mga0qj67_49926_c1
759 nmdc:mga06r32_1760_c1
760 nmdc:mga06r32_22857_c1
761 nmdc:mga06r32_281945_c1
762 nmdc:mga06r32_2844_c1
763 nmdc:mga06r32_299668_c1
764 nmdc:mga06r32_31086_c1
765 nmdc:mga06r32_406636_c1
766 nmdc:mga06r32_568858_c1
767 nmdc:mga06r32_594677_c1
768 nmdc:mga06r32_7382_c1
769 nmdc:mga06r32_96693_c1
770 nmdc:mga08y16_12053_c1
771 nmdc:mga08y16_15277_c1
772 nmdc:mga08y16_45500_c1
773 nmdc:mga08y16_727_c1
774 nmdc:mga08y16_731259_c1
775 nmdc:mga0n895_15174_c1
776 nmdc:mga0n895_15724_c1
777 nmdc:mga0n895_202712_c1
778 nmdc:mga0n895_2604_c1
779 nmdc:mga0n895_30351_c2
780 nmdc:mga0n895_365999_c1
781 nmdc:mga0n895_380_c1
782 nmdc:mga0n895_41133_c1
783 nmdc:mga0n895_43619_c1
784 nmdc:mga0n895_645433_c1
785 nmdc:mga0n895_659696_c1
786 nmdc:mga0n895_68545_c1
787 nmdc:mga0n895_850808_c1
788 nmdc:mga0rr50_100897_c1
789 nmdc:mga0rr50_197008_c1
790 nmdc:mga0rr50_31378_c1
791 nmdc:mga0rr50_52778_c1
792 nmdc:mga08x19_108267_c1
793 nmdc:mga08x19_110196_c1
794 nmdc:mga08x19_158574_c1
795 nmdc:mga08x19_233613_c1
796 nmdc:mga08x19_25117_c1
797 nmdc:mga08x19_383312_c1
798 nmdc:mga08x19_9123_c1
799 nmdc:mga0a205_1333_c1
800 nmdc:mga0a205_141168_c1
801 nmdc:mga0a205_160354_c1
802 nmdc:mga0a205_16912_c1
803 nmdc:mga0a205_197104_c1
804 nmdc:mga0a205_236983_c1
805 nmdc:mga0a205_29682_c1
806 nmdc:mga0a205_306012_c1
807 nmdc:mga0a205_32048_c1
808 nmdc:mga0a205_354170_c1
809 nmdc:mga0a205_44254_c1
810 nmdc:mga0a205_471123_c1
811 nmdc:mga0a205_558426_c1
812 nmdc:mga0a205_632773_c1
813 Ga0495619_0129035
814 Ga0501084_0026449
815 Ga0501084_0083368
816 Ga0501084_0315053
817 Ga0590075_075415
818 Ga0501082_0010365
819 Ga0501082_0223501
820 Ga0501082_0354216
821 Ga0501082_0491892
822 Ga0530510_0000785
823 Ga0530510_0003255
824 Ga0530510_0015227
825 Ga0530510_0145924
826 Ga0530510_0162936
827 Ga0530510_0413464
828 Ga0530510_0708726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

22

168

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yev-assembly2.cif.gz_A structure of caa3-type cytochrome oxidase 0.9223 28 207
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8915 27 206
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.8767 27 207
1fft-assembly2.cif.gz_H the structure of ubiquinol oxidase from escherichia coli 0.8596 27 206
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.8563 17 206
ID Description Score Start End Superfamily
2w2uA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9674 72 114 1.20.58.80
af_O44735_1_97_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9366 66 112 1.20.58.80
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9284 27 207 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9027 24 205 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.871 17 207 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A4U7D577-F1-model_v4 Heme-copper oxidase subunit III 0.9865 68 175 GO:0004129
GO:0005886
GO:0019646
AF-A0A1Q7S499-F1-model_v4 Heme-copper oxidase subunit III family profile domain-containing protein 0.9766 28 207 GO:0004129
GO:0005886
GO:0019646
AF-A0A7V3XE04-F1-model_v4 Cytochrome oxidase subunit III 0.9709 30 207 GO:0004129
GO:0005886
GO:0019646
AF-A0A2D6R1S2-F1-model_v4 Cytochrome oxidase subunit III 0.9673 24 207 GO:0004129
GO:0005886
GO:0019646
AF-A0A1Q7X8R7-F1-model_v4 Heme-copper oxidase subunit III family profile domain-containing protein 0.9668 51 207 GO:0004129
GO:0005886
GO:0019646

Map