F438214

General Info

Members Datasets Scaffolds Average Seq Length
414 279 828 229

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10017178|rootH1_100171783
Length 235
Sequence MSSTSGSDAPHSGDTLAQEFVRFAVDTGVLRFGEFKTKAGRLSPYFFNAGLFDDGAKLGRLAEFYARRLLQARASGELEFDMLFGPAYKGIVLAAAVAVELARLGHNVPFAYNRKEAKDHGEGGTLVGAPLAGRVLIIDDVISAGTSVRESIAMITAAGATPRAVTIALDRQEKATEAGQDAEWSAVQYVQKQLGLRVAAIATLTDLLHYLRSNADPALGAHFERVAAYRERYGV

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
74 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
142 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
143 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
150 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
177 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
180 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
181 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
182 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
183 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
184 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
185 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
186 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
189 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
190 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
251 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
252 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
253 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
254 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
255 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
256 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
259 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
260 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
261 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
262 2547132374 Acidovorax radicis N35 Isolate Unclassified
263 2643221570 Acidovorax sp. Root568 Isolate Unclassified
264 2643221596 Acidovorax sp. Root70 Isolate Unclassified
265 2643221609 Acidovorax sp. Root217 Isolate Unclassified
266 2643221611 Acidovorax sp. Root219 Isolate Unclassified
267 2643221652 Acidovorax sp. Root402 Isolate Unclassified
268 2643221660 Methylibium sp. Root1272 Isolate Unclassified
269 2643221717 Acidovorax sp. Root267 Isolate Unclassified
270 2721755523 Delftia sp. HK171 Isolate Unclassified
271 2738543012 Acidovorax sp. CF301 Isolate Unclassified
272 2816332133 Acidovorax radicis 2721A Isolate Unclassified
273 2831864461 Roseateles noduli HZ7 Isolate Nodule
274 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
275 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
276 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
277 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
278 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
279 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 0
Isolates 4.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.92
Nodule 1.21
Rhizoplane 5.8
Rhizosphere 50.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10017178 3300003316 Bacteria 2607
2 JGI24739J22299_10006590 3300001989 Bacteria 4375
3 JGI25152J39213_1012854 3300002773 Bacteria 1772
4 JGI25150J39212_1001233 3300002774 Bacteria 7495
5 JGI25159J45721_1016335 3300002987 Bacteria 1586
6 JGI25151J46595_10073893 3300003187 Bacteria 1018
7 JGI25153J46596_10061432 3300003215 Bacteria 1018
8 rootH1_10003481 3300003316 Bacteria 15746
9 rootH2_10000866 3300003320 Bacteria 5563
10 rootL2_10001100 3300003322 Bacteria 26457
11 rootL2_10009986 3300003322 Bacteria 2536
12 rootH1_10033831 3300003323 Bacteria 5271
13 rootH1_10060340 3300003323 Bacteria 2138
14 JGI25160J50197_1043165 3300003354 Bacteria 1018
15 Ga0055535_1000158 3300003761 Bacteria 72697
16 Ga0055542_1000013 3300003762 Bacteria 387560
17 Ga0055526_1002962 3300003771 Bacteria 11128
18 Ga0055526_1018990 3300003771 Bacteria 2528
19 Ga0055526_1019224 3300003771 Bacteria 2500
20 Ga0055537_1005790 3300003773 Bacteria 3246
21 Ga0055537_1008354 3300003773 Bacteria 2398
22 Ga0055524_1008737 3300003775 Bacteria 4185
23 Ga0055524_1017492 3300003775 Bacteria 2528
24 Ga0055524_1017718 3300003775 Bacteria 2501
25 Ga0055536_1001934 3300003781 Bacteria 11960
26 Ga0055536_1003979 3300003781 Bacteria 7733
27 Ga0055536_1016377 3300003781 Bacteria 2482
28 Ga0055534_1004419 3300003784 Bacteria 4077
29 Ga0055534_1005758 3300003784 Bacteria 3246
30 Ga0055528_1012723 3300003790 Bacteria 3246
31 Ga0055528_1012852 3300003790 Bacteria 3217
32 Ga0055530_10015643 3300003791 Bacteria 2465
33 Ga0055530_10016875 3300003791 Bacteria 2308
34 Ga0055540_1001395 3300003792 Bacteria 14417
35 Ga0055540_1014108 3300003792 Bacteria 2401
36 Ga0055540_1014181 3300003792 Bacteria 2390
37 Ga0055540_1040884 3300003792 Bacteria 1002
38 Ga0055531_10018873 3300003794 Bacteria 2823
39 Ga0055531_10021845 3300003794 Bacteria 2465
40 Ga0055531_10022660 3300003794 Bacteria 2384
41 Ga0055543_1005305 3300004625 Bacteria 3313
42 Ga0055543_1010202 3300004625 Bacteria 1979
43 Ga0055543_1010261 3300004625 Bacteria 1970
44 Ga0055543_1010623 3300004625 Bacteria 1921
45 Ga0065165_1000079 3300005262 Bacteria 162095
46 Ga0065165_1002283 3300005262 Bacteria 16845
47 Ga0065165_1019331 3300005262 Bacteria 2436
48 Ga0065165_1037481 3300005262 Bacteria 1469
49 Ga0070658_10014124 3300005327 Bacteria 6411
50 Ga0070658_10243457 3300005327 Bacteria 1525
51 Ga0070677_10057440 3300005333 Bacteria 1595
52 Ga0070680_100163935 3300005336 Bacteria 1868
53 Ga0070682_100072875 3300005337 Bacteria 2202
54 Ga0070682_100239562 3300005337 Bacteria 1301
55 Ga0070660_100324229 3300005339 Bacteria 1266
56 Ga0070668_100286902 3300005347 Bacteria 1376
57 Ga0070669_100205903 3300005353 Bacteria 1550
58 Ga0070671_100046759 3300005355 Bacteria 3599
59 Ga0070659_100233132 3300005366 Bacteria 1521
60 Ga0070667_100009626 3300005367 Bacteria 8014
61 Ga0070678_100338196 3300005456 Bacteria 1290
62 Ga0070662_100025777 3300005457 Bacteria 4064
63 Ga0070706_100077728 3300005467 Bacteria 3072
64 Ga0070707_100022060 3300005468 Bacteria 6020
65 Ga0070698_100443687 3300005471 Bacteria 1233
66 Ga0070679_100317745 3300005530 Bacteria 1507
67 Ga0068853_100265790 3300005539 Bacteria 1578
68 Ga0068853_100519574 3300005539 Bacteria 1125
69 Ga0070672_100066228 3300005543 Bacteria 2860
70 Ga0070672_100587936 3300005543 Bacteria 969
71 Ga0070665_100102159 3300005548 Bacteria 2870
72 Ga0068855_100004439 3300005563 Bacteria 17139
73 Ga0068855_100132407 3300005563 Bacteria 2846
74 Ga0070664_100166298 3300005564 Bacteria 1954
75 Ga0068857_100087312 3300005577 Bacteria 2789
76 Ga0068854_100181246 3300005578 Bacteria 1645
77 Ga0068852_100224861 3300005616 Bacteria 1786
78 Ga0068864_100024670 3300005618 Bacteria 5059
79 Ga0068864_100467175 3300005618 Bacteria 1209
80 Ga0068851_10021113 3300005834 Bacteria 3160
81 Ga0068858_100001225 3300005842 Bacteria 26559
82 Ga0068860_100001205 3300005843 Bacteria 28228
83 Ga0068862_100045494 3300005844 Bacteria 3745
84 Ga0075365_10240942 3300006038 Bacteria 1270
85 Ga0075363_100032524 3300006048 Bacteria 2710
86 Ga0075364_10132959 3300006051 Bacteria 1671
87 Ga0075362_10164851 3300006177 Bacteria 1068
88 Ga0075367_10339792 3300006178 Bacteria 947
89 Ga0075366_10020525 3300006195 Bacteria 3834
90 Ga0075366_10024227 3300006195 Bacteria 3540
91 Ga0075366_10043970 3300006195 Bacteria 2647
92 Ga0097621_100490467 3300006237 Bacteria 1112
93 Ga0075370_10018531 3300006353 Bacteria 3779
94 Ga0075370_10039428 3300006353 Bacteria 2661
95 Ga0075370_10077603 3300006353 Bacteria 1906
96 Ga0075370_10091909 3300006353 Bacteria 1751
97 Ga0068865_100112872 3300006881 Bacteria 2008
98 Ga0099823_1000002 3300006944 Bacteria 212272
99 Ga0079104_1000170 3300006946 Bacteria 92339
100 Ga0105250_10000214 3300009092 Bacteria 47939
101 Ga0105240_10008260 3300009093 Bacteria 14901
102 Ga0105240_10107758 3300009093 Bacteria 3377
103 Ga0114129_10087432 3300009147 Bacteria 4322
104 Ga0105243_10002395 3300009148 Bacteria 15715
105 Ga0105243_10009100 3300009148 Bacteria 7586
106 Ga0105243_10922996 3300009148 Bacteria 870
107 Ga0105242_10019047 3300009176 Bacteria 5377
108 Ga0105242_10325050 3300009176 Bacteria 1412
109 Ga0105248_10001875 3300009177 Bacteria 23322
110 Ga0105248_10079266 3300009177 Bacteria 3691
111 Ga0105248_10477945 3300009177 Bacteria 1404
112 Ga0105237_10029343 3300009545 Bacteria 5593
113 Ga0105238_10061931 3300009551 Bacteria 3743
114 Ga0157319_1000007 3300012497 Bacteria 318528
115 Ga0157326_1026095 3300012513 Bacteria 749
116 Ga0157369_10014593 3300013105 Bacteria 8864
117 Ga0163162_10308548 3300013306 Bacteria 1714
118 Ga0157375_10259815 3300013308 Bacteria 1898
119 Ga0157375_11174324 3300013308 Bacteria 900
120 Ga0163163_11322664 3300014325 Bacteria 783
121 Ga0157380_10009511 3300014326 Bacteria 6970
122 Ga0182008_10016497 3300014497 Bacteria 3838
123 Ga0182008_10018882 3300014497 Bacteria 3566
124 Ga0157379_10001105 3300014968 Bacteria 22052
125 Ga0182006_1011822 3300015261 Bacteria 3827
126 Ga0182007_10001118 3300015262 Bacteria 14549
127 Ga0182007_10003172 3300015262 Bacteria 7870
128 Ga0182005_1053606 3300015265 Bacteria 1098
129 Ga0183362_10004 3300015683 Bacteria 569303
130 Ga0163161_10016404 3300017792 Bacteria 5170
131 Ga0163161_10022017 3300017792 Bacteria 4483
132 Ga0213872_10000273 3300021361 Bacteria 43983
133 Ga0213872_10000412 3300021361 Bacteria 35039
134 Ga0213872_10013656 3300021361 Bacteria 3802
135 Ga0209436_102297 3300025208 Bacteria 5858
136 Ga0209436_121742 3300025208 Bacteria 839
137 Ga0209672_100583 3300025228 Bacteria 19381
138 Ga0209147_100512 3300025229 Bacteria 22553
139 Ga0209258_100020 3300025242 Bacteria 565241
140 Ga0207425_1000708 3300025245 Bacteria 17958
141 Ga0209148_1000031 3300025254 Bacteria 564601
142 Ga0209129_1000055 3300025258 Bacteria 261708
143 Ga0209129_1011629 3300025258 Bacteria 2087
144 Ga0209565_1000310 3300025263 Bacteria 45322
145 Ga0209565_1019371 3300025263 Bacteria 1455
146 Ga0209673_1000502 3300025273 Bacteria 64647
147 Ga0209673_1000812 3300025273 Bacteria 41302
148 Ga0209673_1003039 3300025273 Bacteria 10382
149 Ga0209673_1005706 3300025273 Bacteria 6206
150 Ga0209673_1019852 3300025273 Bacteria 2400
151 Ga0209130_1003815 3300025284 Bacteria 6107
152 Ga0209130_1004053 3300025284 Bacteria 5798
153 Ga0209675_1000862 3300025291 Bacteria 19667
154 Ga0209676_1000040 3300025292 Bacteria 438184
155 Ga0209676_1001426 3300025292 Bacteria 22674
156 Ga0209676_1001865 3300025292 Bacteria 17343
157 Ga0209676_1018538 3300025292 Bacteria 2425
158 Ga0209025_1002900 3300025294 Bacteria 17118
159 Ga0209025_1005102 3300025294 Bacteria 10921
160 Ga0209564_1000030 3300025295 Bacteria 503296
161 Ga0209564_1001950 3300025295 Bacteria 18249
162 Ga0209564_1002512 3300025295 Bacteria 14205
163 Ga0209758_1000042 3300025297 Bacteria 407145
164 Ga0209758_1009166 3300025297 Bacteria 6227
165 Ga0209050_1000021 3300025298 Bacteria 574406
166 Ga0209050_1020154 3300025298 Bacteria 2494
167 Ga0209256_1000056 3300025299 Bacteria 283044
168 Ga0209256_1000124 3300025299 Bacteria 165390
169 Ga0209256_1000197 3300025299 Bacteria 114432
170 Ga0209256_1014848 3300025299 Bacteria 2767
171 Ga0209256_1035615 3300025299 Bacteria 1313
172 Ga0207426_1000055 3300025302 Bacteria 374450
173 Ga0207426_1000079 3300025302 Bacteria 314709
174 Ga0209051_1000028 3300025303 Bacteria 404269
175 Ga0209051_1001256 3300025303 Bacteria 22674
176 Ga0209051_1003834 3300025303 Bacteria 9628
177 Ga0209051_1015251 3300025303 Bacteria 3545
178 Ga0209257_1000043 3300025304 Bacteria 512127
179 Ga0209257_1001377 3300025304 Bacteria 29185
180 Ga0209257_1004265 3300025304 Bacteria 11281
181 Ga0209257_1007210 3300025304 Bacteria 6815
182 Ga0209257_1014968 3300025304 Bacteria 3275
183 Ga0209257_1016815 3300025304 Bacteria 2929
184 Ga0207656_10013524 3300025321 Bacteria 3122
185 Ga0207656_10033012 3300025321 Bacteria 2153
186 Ga0207696_1004903 3300025711 Bacteria 5667
187 Ga0207682_10043730 3300025893 Bacteria 1834
188 Ga0207680_10090060 3300025903 Bacteria 1949
189 Ga0207684_10073622 3300025910 Bacteria 2901
190 Ga0207654_10096983 3300025911 Bacteria 1809
191 Ga0207695_10026040 3300025913 Bacteria 6534
192 Ga0207695_10215911 3300025913 Bacteria 1827
193 Ga0207671_10344783 3300025914 Bacteria 1181
194 Ga0207660_10076190 3300025917 Bacteria 2452
195 Ga0207662_10022444 3300025918 Bacteria 3620
196 Ga0207657_10032898 3300025919 Bacteria 4679
197 Ga0207649_10004438 3300025920 Bacteria 7615
198 Ga0207646_10019012 3300025922 Bacteria 6396
199 Ga0207694_10043258 3300025924 Bacteria 3476
200 Ga0207694_10092734 3300025924 Bacteria 2384
201 Ga0207694_10116148 3300025924 Bacteria 2133
202 Ga0207644_10005624 3300025931 Bacteria 8164
203 Ga0207686_10004563 3300025934 Bacteria 7421
204 Ga0207686_10171179 3300025934 Bacteria 1531
205 Ga0207709_10000394 3300025935 Bacteria 43194
206 Ga0207709_10000405 3300025935 Bacteria 42204
207 Ga0207709_10000599 3300025935 Bacteria 30037
208 Ga0207704_10216542 3300025938 Bacteria 1414
209 Ga0207691_10021546 3300025940 Bacteria 6085
210 Ga0207691_10097452 3300025940 Bacteria 2628
211 Ga0207711_10001495 3300025941 Bacteria 21766
212 Ga0207711_10024503 3300025941 Bacteria 5058
213 Ga0207689_10418398 3300025942 Bacteria 1118
214 Ga0207661_10161831 3300025944 Bacteria 1942
215 Ga0207679_10068408 3300025945 Bacteria 2668
216 Ga0207667_10052610 3300025949 Bacteria 4287
217 Ga0207667_10075066 3300025949 Bacteria 3511
218 Ga0207640_10018090 3300025981 Bacteria 4134
219 Ga0207658_10054696 3300025986 Bacteria 2954
220 Ga0207703_10005857 3300026035 Bacteria 9843
221 Ga0207702_10027695 3300026078 Bacteria 4707
222 Ga0207648_10328047 3300026089 Bacteria 1376
223 Ga0207676_10057783 3300026095 Bacteria 3057
224 Ga0207674_10106970 3300026116 Bacteria 2774
225 Ga0207683_10115504 3300026121 Bacteria 2406
226 Ga0207698_10009572 3300026142 Bacteria 6188
227 Ga0209281_1000072 3300027111 Bacteria 273114
228 Ga0209389_1004640 3300027296 Bacteria 11506
229 Ga0209371_1014151 3300027312 Bacteria 2200
230 Ga0209974_10008569 3300027876 Bacteria 3494
231 Ga0209974_10011086 3300027876 Bacteria 3034
232 Ga0268265_10027029 3300028380 Bacteria 4090
233 Ga0268264_10001570 3300028381 Bacteria 21193
234 Ga0265334_10120438 3300028573 Bacteria 938
235 Ga0307515_10064558 3300028794 Bacteria 5117
236 Ga0268256_1016687 3300030500 Bacteria 2094
237 Ga0307512_10084547 3300030522 Bacteria 2254
238 Ga0307512_10103153 3300030522 Bacteria 1921
239 Ga0265330_10000037 3300031235 Bacteria 120957
240 Ga0265332_10000008 3300031238 Bacteria 301609
241 Ga0265320_10197673 3300031240 Bacteria 898
242 Ga0265325_10006706 3300031241 Bacteria 6966
243 Ga0265327_10016607 3300031251 Bacteria 4664
244 Ga0265327_10040939 3300031251 Bacteria 2501
245 Ga0265316_10002522 3300031344 Bacteria 18928
246 Ga0307509_10000135 3300031507 Bacteria 109066
247 Ga0307408_100011173 3300031548 Bacteria 5931
248 Ga0307408_100011897 3300031548 Bacteria 5757
249 Ga0307408_100474000 3300031548 Bacteria 1090
250 Ga0307514_10019455 3300031649 Bacteria 5558
251 Ga0307514_10250824 3300031649 Bacteria 1048
252 Ga0265314_10000065 3300031711 Bacteria 158383
253 Ga0307405_10103239 3300031731 Bacteria 1916
254 Ga0307413_10196002 3300031824 Bacteria 1454
255 Ga0307518_10299414 3300031838 Bacteria 979
256 Ga0307406_10008719 3300031901 Bacteria 5667
257 Ga0307416_100439155 3300032002 Bacteria 1355
258 Ga0307414_10220573 3300032004 Bacteria 1556
259 Ga0373937_0067704 3300036401 Bacteria 3291
260 Ga0395905_0000086 3300037471 Bacteria 153641
261 Ga0395905_0000390 3300037471 Bacteria 62192
262 Ga0395905_0385029 3300037471 Bacteria 1296
263 Ga0436365_1021364 3300039437 Bacteria 5141
264 Ga0436361_0074660 3300039447 Bacteria 44726
265 Ga0436361_0202129 3300039447 Bacteria 39168
266 Ga0436361_0620560 3300039447 Bacteria 5994
267 Ga0436361_0623219 3300039447 Bacteria 47496
268 Ga0439466_0003534 3300041411 Bacteria 6044
269 Ga0439465_0025346 3300041413 Bacteria 1871
270 Ga0451807_2698648 3300041486 Bacteria 1438
271 Ga0451845_0199018 3300041501 Bacteria 1287
272 Ga0439441_026064 3300042001 Bacteria 1107
273 Ga0439442_004034 3300042002 Bacteria 2911
274 Ga0439442_028642 3300042002 Bacteria 1161
275 Ga0439432_065741 3300042006 Bacteria 1111
276 Ga0439449_0007875 3300042007 Bacteria 4046
277 Ga0439449_0042139 3300042007 Bacteria 1697
278 Ga0439462_0060794 3300042015 Bacteria 1022
279 Ga0450920_008819 3300042122 Bacteria 1848
280 Ga0450890_002877 3300042127 Bacteria 2320
281 Ga0450897_003199 3300042128 Bacteria 1298
282 Ga0450889_007013 3300042144 Bacteria 1135
283 Ga0450906_003380 3300042145 Bacteria 3434
284 Ga0450907_004040 3300042146 Bacteria 2549
285 Ga0450908_006290 3300042184 Bacteria 2259
286 Ga0439434_0012747 3300042435 Bacteria 2490
287 Ga0439459_0007464 3300042438 Bacteria 1847
288 Ga0450918_001796 3300042531 Bacteria 4179
289 Ga0450893_0001790 3300042532 Bacteria 3309
290 Ga0450893_0002949 3300042532 Bacteria 2678
291 Ga0451577_0000191 3300042876 Bacteria 128991
292 Ga0451577_0138888 3300042876 Bacteria 2183
293 Ga0451577_0244114 3300042876 Bacteria 1625
294 Ga0466972_0024894 3300044658 Bacteria 2970
295 Ga0466972_0254684 3300044658 Bacteria 820
296 Ga0466963_0173345 3300044694 Bacteria 1504
297 Ga0453684_0000590 3300044712 Bacteria 134718
298 Ga0453684_0231780 3300044712 Bacteria 2131
299 Ga0466968_0173423 3300044735 Bacteria 1000
300 Ga0451576_0004219 3300045051 Bacteria 18885
301 Ga0451576_0060229 3300045051 Bacteria 3961
302 Ga0451576_0173982 3300045051 Bacteria 2247
303 Ga0451576_0447865 3300045051 Bacteria 1355
304 Ga0495592_0000185 3300046454 Bacteria 54711
305 Ga0495590_0004591 3300046457 Bacteria 5556
306 Ga0495638_0041107 3300046460 Bacteria 2927
307 Ga0495651_0407808 3300046462 Bacteria 886
308 Ga0495610_0054875 3300046512 Bacteria 1923
309 Ga0495616_0000562 3300046513 Bacteria 28069
310 Ga0495631_0000101 3300046518 Bacteria 57202
311 Ga0495663_0003450 3300046525 Bacteria 4557
312 Ga0495654_0006288 3300046530 Bacteria 6764
313 Ga0495654_0180617 3300046530 Bacteria 914
314 Ga0495621_0006825 3300046539 Bacteria 3354
315 Ga0495622_0047908 3300046557 Bacteria 1986
316 Ga0495633_0001008 3300046558 Bacteria 23030
317 Ga0495656_0001785 3300046615 Bacteria 7067
318 Ga0495668_0012650 3300046616 Bacteria 5001
319 Ga0495625_0000136 3300046660 Bacteria 114576
320 Ga0495661_0038865 3300046665 Bacteria 2961
321 Ga0495588_0132628 3300046674 Bacteria 1314
322 Ga0495658_0083407 3300046683 Bacteria 1880
323 Ga0495624_0169761 3300046690 Bacteria 1331
324 Ga0495670_0009912 3300046691 Bacteria 4683
325 Ga0495670_0055771 3300046691 Bacteria 1982
326 Ga0495660_0078524 3300046810 Bacteria 1735
327 Ga0495676_0082091 3300047321 Bacteria 2440
328 Ga0495677_0065963 3300047445 Bacteria 1346
329 Ga0495593_0016527 3300047673 Bacteria 4160
330 Ga0496100_0024076 3300048903 Bacteria 3708
331 Ga0496101_0019898 3300048904 Bacteria 4590
332 Ga0496102_0002452 3300048905 Bacteria 15829
333 Ga0496103_0019063 3300048906 Bacteria 4120
334 Ga0496103_0071034 3300048906 Bacteria 2178
335 Ga0496104_0020479 3300048907 Bacteria 6063
336 Ga0496104_0033120 3300048907 Bacteria 4811
337 Ga0496105_0002217 3300048908 Bacteria 14074
338 Ga0496105_0182747 3300048908 Bacteria 1717
339 Ga0496105_0199376 3300048908 Bacteria 1634
340 Ga0496106_0055508 3300048909 Bacteria 2994
341 Ga0496107_0104870 3300048910 Bacteria 2075
342 Ga0496108_0011679 3300048911 Bacteria 7145
343 Ga0496109_0085579 3300048912 Bacteria 2910
344 Ga0496109_0160808 3300048912 Bacteria 2104
345 Ga0496109_0931781 3300048912 Bacteria 806
346 Ga0496110_0007166 3300048913 Bacteria 8879
347 Ga0496110_0047572 3300048913 Bacteria 3757
348 Ga0496110_0186342 3300048913 Bacteria 1884
349 Ga0496111_0040039 3300048914 Bacteria 3361
350 Ga0496112_0009077 3300048915 Bacteria 8933
351 Ga0496113_0012910 3300048916 Bacteria 5633
352 Ga0496114_0457811 3300048917 Bacteria 1129
353 Ga0496116_0102648 3300048919 Bacteria 1704
354 Ga0496117_0038911 3300048920 Bacteria 3517
355 Ga0496121_0072002 3300048924 Bacteria 2776
356 Ga0496121_0100084 3300048924 Bacteria 2238
357 Ga0496122_0080760 3300048925 Bacteria 2266
358 Ga0496122_0108807 3300048925 Bacteria 1827
359 Ga0496122_0120821 3300048925 Bacteria 1690
360 Ga0496122_0128190 3300048925 Bacteria 1619
361 Ga0496122_0180492 3300048925 Bacteria 1260
362 Ga0496123_0043743 3300048926 Bacteria 3072
363 Ga0496123_0066417 3300048926 Bacteria 2284
364 Ga0496124_0011416 3300048927 Bacteria 8882
365 Ga0496124_0033599 3300048927 Bacteria 4511
366 Ga0496124_0048172 3300048927 Bacteria 3643
367 Ga0496125_0084746 3300048928 Bacteria 2405
368 Ga0496125_0120096 3300048928 Bacteria 1877
369 nmdc:mga03683_30814_c1 3300050489 Bacteria 2148
370 nmdc:mga0k408_107614_c1 3300050493 Bacteria 1647
371 nmdc:mga0k408_15424_c1 3300050493 Bacteria 4227
372 nmdc:mga0k408_34058_c1 3300050493 Bacteria 2914
373 nmdc:mga0k408_57455_c1 3300050493 Bacteria 2259
374 nmdc:mga0k408_59166_c1 3300050493 Bacteria 2226
375 nmdc:mga07m45_219555_c1 3300050496 Bacteria 1106
376 nmdc:mga07m45_2587_c1 3300050496 Bacteria 8525
377 nmdc:mga07m45_2731_c1 3300050496 Bacteria 8316
378 nmdc:mga05p37_47840_c1 3300050507 Bacteria 5259
379 Ga0500635_0070832 3300053080 Bacteria 1236
380 Ga0500643_047311 3300053087 Bacteria 1240
381 Ga0500651_0000136 3300053093 Bacteria 45911
382 Ga0500651_0151160 3300053093 Bacteria 1394
383 Ga0500562_001753 3300053108 Bacteria 5414
384 Ga0500562_057922 3300053108 Bacteria 1040
385 Ga0500571_000102 3300053110 Bacteria 28122
386 Ga0500572_034122 3300053111 Bacteria 1440
387 Ga0500592_002205 3300053116 Bacteria 3147
388 Ga0500594_0030656 3300053118 Bacteria 1413
389 Ga0500608_114528 3300053122 Bacteria 1232
390 Ga0500564_072763 3300053138 Bacteria 1549
391 Ga0500568_0012029 3300053139 Bacteria 3989
392 Ga0500574_000703 3300053141 Bacteria 4421
393 Ga0500634_0016322 3300053161 Bacteria 3961
394 Ga0500634_0052647 3300053161 Bacteria 2185
395 Ga0500638_034129 3300053162 Bacteria 2461
396 Ga0500636_0175871 3300053177 Bacteria 1154
397 2548501814 2547132374 Bacteria 5530232
398 2643864072 2643221570 Bacteria 5103772
399 2643992382 2643221596 Bacteria 5006805
400 2644060050 2643221609 Bacteria 6756331
401 2644072654 2643221611 Bacteria 6820941
402 2644292271 2643221652 Bacteria 5140275
403 2644339611 2643221660 Bacteria 4208257
404 2644646460 2643221717 Bacteria 5676132
405 2722881168 2721755523 Bacteria 6430384
406 2739245678 2738543012 Bacteria 7115078
407 2816470418 2816332133 Bacteria 7249298
408 2831865451 2831864461 Bacteria 6502356
409 2839141097 2839138175 Bacteria 6549354
410 2842720929 2842718218 Bacteria 4560148
411 2919708621 2919704043 Bacteria 5560311
412 2932425555 2932422444 Bacteria 4678430
413 2974321190 2974320154 Bacteria 4571377
414 2990714603 2990710928 Bacteria 5002431
415 rootH1_10017178
416 JGI24739J22299_10006590
417 JGI25152J39213_1012854
418 JGI25150J39212_1001233
419 JGI25159J45721_1016335
420 JGI25151J46595_10073893
421 JGI25153J46596_10061432
422 rootH1_10003481
423 rootH2_10000866
424 rootL2_10001100
425 rootL2_10009986
426 rootH1_10033831
427 rootH1_10060340
428 JGI25160J50197_1043165
429 Ga0055535_1000158
430 Ga0055542_1000013
431 Ga0055526_1002962
432 Ga0055526_1018990
433 Ga0055526_1019224
434 Ga0055537_1005790
435 Ga0055537_1008354
436 Ga0055524_1008737
437 Ga0055524_1017492
438 Ga0055524_1017718
439 Ga0055536_1001934
440 Ga0055536_1003979
441 Ga0055536_1016377
442 Ga0055534_1004419
443 Ga0055534_1005758
444 Ga0055528_1012723
445 Ga0055528_1012852
446 Ga0055530_10015643
447 Ga0055530_10016875
448 Ga0055540_1001395
449 Ga0055540_1014108
450 Ga0055540_1014181
451 Ga0055540_1040884
452 Ga0055531_10018873
453 Ga0055531_10021845
454 Ga0055531_10022660
455 Ga0055543_1005305
456 Ga0055543_1010202
457 Ga0055543_1010261
458 Ga0055543_1010623
459 Ga0065165_1000079
460 Ga0065165_1002283
461 Ga0065165_1019331
462 Ga0065165_1037481
463 Ga0070658_10014124
464 Ga0070658_10243457
465 Ga0070677_10057440
466 Ga0070680_100163935
467 Ga0070682_100072875
468 Ga0070682_100239562
469 Ga0070660_100324229
470 Ga0070668_100286902
471 Ga0070669_100205903
472 Ga0070671_100046759
473 Ga0070659_100233132
474 Ga0070667_100009626
475 Ga0070678_100338196
476 Ga0070662_100025777
477 Ga0070706_100077728
478 Ga0070707_100022060
479 Ga0070698_100443687
480 Ga0070679_100317745
481 Ga0068853_100265790
482 Ga0068853_100519574
483 Ga0070672_100066228
484 Ga0070672_100587936
485 Ga0070665_100102159
486 Ga0068855_100004439
487 Ga0068855_100132407
488 Ga0070664_100166298
489 Ga0068857_100087312
490 Ga0068854_100181246
491 Ga0068852_100224861
492 Ga0068864_100024670
493 Ga0068864_100467175
494 Ga0068851_10021113
495 Ga0068858_100001225
496 Ga0068860_100001205
497 Ga0068862_100045494
498 Ga0075365_10240942
499 Ga0075363_100032524
500 Ga0075364_10132959
501 Ga0075362_10164851
502 Ga0075367_10339792
503 Ga0075366_10020525
504 Ga0075366_10024227
505 Ga0075366_10043970
506 Ga0097621_100490467
507 Ga0075370_10018531
508 Ga0075370_10039428
509 Ga0075370_10077603
510 Ga0075370_10091909
511 Ga0068865_100112872
512 Ga0099823_1000002
513 Ga0079104_1000170
514 Ga0105250_10000214
515 Ga0105240_10008260
516 Ga0105240_10107758
517 Ga0114129_10087432
518 Ga0105243_10002395
519 Ga0105243_10009100
520 Ga0105243_10922996
521 Ga0105242_10019047
522 Ga0105242_10325050
523 Ga0105248_10001875
524 Ga0105248_10079266
525 Ga0105248_10477945
526 Ga0105237_10029343
527 Ga0105238_10061931
528 Ga0157319_1000007
529 Ga0157326_1026095
530 Ga0157369_10014593
531 Ga0163162_10308548
532 Ga0157375_10259815
533 Ga0157375_11174324
534 Ga0163163_11322664
535 Ga0157380_10009511
536 Ga0182008_10016497
537 Ga0182008_10018882
538 Ga0157379_10001105
539 Ga0182006_1011822
540 Ga0182007_10001118
541 Ga0182007_10003172
542 Ga0182005_1053606
543 Ga0183362_10004
544 Ga0163161_10016404
545 Ga0163161_10022017
546 Ga0213872_10000273
547 Ga0213872_10000412
548 Ga0213872_10013656
549 Ga0209436_102297
550 Ga0209436_121742
551 Ga0209672_100583
552 Ga0209147_100512
553 Ga0209258_100020
554 Ga0207425_1000708
555 Ga0209148_1000031
556 Ga0209129_1000055
557 Ga0209129_1011629
558 Ga0209565_1000310
559 Ga0209565_1019371
560 Ga0209673_1000502
561 Ga0209673_1000812
562 Ga0209673_1003039
563 Ga0209673_1005706
564 Ga0209673_1019852
565 Ga0209130_1003815
566 Ga0209130_1004053
567 Ga0209675_1000862
568 Ga0209676_1000040
569 Ga0209676_1001426
570 Ga0209676_1001865
571 Ga0209676_1018538
572 Ga0209025_1002900
573 Ga0209025_1005102
574 Ga0209564_1000030
575 Ga0209564_1001950
576 Ga0209564_1002512
577 Ga0209758_1000042
578 Ga0209758_1009166
579 Ga0209050_1000021
580 Ga0209050_1020154
581 Ga0209256_1000056
582 Ga0209256_1000124
583 Ga0209256_1000197
584 Ga0209256_1014848
585 Ga0209256_1035615
586 Ga0207426_1000055
587 Ga0207426_1000079
588 Ga0209051_1000028
589 Ga0209051_1001256
590 Ga0209051_1003834
591 Ga0209051_1015251
592 Ga0209257_1000043
593 Ga0209257_1001377
594 Ga0209257_1004265
595 Ga0209257_1007210
596 Ga0209257_1014968
597 Ga0209257_1016815
598 Ga0207656_10013524
599 Ga0207656_10033012
600 Ga0207696_1004903
601 Ga0207682_10043730
602 Ga0207680_10090060
603 Ga0207684_10073622
604 Ga0207654_10096983
605 Ga0207695_10026040
606 Ga0207695_10215911
607 Ga0207671_10344783
608 Ga0207660_10076190
609 Ga0207662_10022444
610 Ga0207657_10032898
611 Ga0207649_10004438
612 Ga0207646_10019012
613 Ga0207694_10043258
614 Ga0207694_10092734
615 Ga0207694_10116148
616 Ga0207644_10005624
617 Ga0207686_10004563
618 Ga0207686_10171179
619 Ga0207709_10000394
620 Ga0207709_10000405
621 Ga0207709_10000599
622 Ga0207704_10216542
623 Ga0207691_10021546
624 Ga0207691_10097452
625 Ga0207711_10001495
626 Ga0207711_10024503
627 Ga0207689_10418398
628 Ga0207661_10161831
629 Ga0207679_10068408
630 Ga0207667_10052610
631 Ga0207667_10075066
632 Ga0207640_10018090
633 Ga0207658_10054696
634 Ga0207703_10005857
635 Ga0207702_10027695
636 Ga0207648_10328047
637 Ga0207676_10057783
638 Ga0207674_10106970
639 Ga0207683_10115504
640 Ga0207698_10009572
641 Ga0209281_1000072
642 Ga0209389_1004640
643 Ga0209371_1014151
644 Ga0209974_10008569
645 Ga0209974_10011086
646 Ga0268265_10027029
647 Ga0268264_10001570
648 Ga0265334_10120438
649 Ga0307515_10064558
650 Ga0268256_1016687
651 Ga0307512_10084547
652 Ga0307512_10103153
653 Ga0265330_10000037
654 Ga0265332_10000008
655 Ga0265320_10197673
656 Ga0265325_10006706
657 Ga0265327_10016607
658 Ga0265327_10040939
659 Ga0265316_10002522
660 Ga0307509_10000135
661 Ga0307408_100011173
662 Ga0307408_100011897
663 Ga0307408_100474000
664 Ga0307514_10019455
665 Ga0307514_10250824
666 Ga0265314_10000065
667 Ga0307405_10103239
668 Ga0307413_10196002
669 Ga0307518_10299414
670 Ga0307406_10008719
671 Ga0307416_100439155
672 Ga0307414_10220573
673 Ga0373937_0067704
674 Ga0395905_0000086
675 Ga0395905_0000390
676 Ga0395905_0385029
677 Ga0436365_1021364
678 Ga0436361_0074660
679 Ga0436361_0202129
680 Ga0436361_0620560
681 Ga0436361_0623219
682 Ga0439466_0003534
683 Ga0439465_0025346
684 Ga0451807_2698648
685 Ga0451845_0199018
686 Ga0439441_026064
687 Ga0439442_004034
688 Ga0439442_028642
689 Ga0439432_065741
690 Ga0439449_0007875
691 Ga0439449_0042139
692 Ga0439462_0060794
693 Ga0450920_008819
694 Ga0450890_002877
695 Ga0450897_003199
696 Ga0450889_007013
697 Ga0450906_003380
698 Ga0450907_004040
699 Ga0450908_006290
700 Ga0439434_0012747
701 Ga0439459_0007464
702 Ga0450918_001796
703 Ga0450893_0001790
704 Ga0450893_0002949
705 Ga0451577_0000191
706 Ga0451577_0138888
707 Ga0451577_0244114
708 Ga0466972_0024894
709 Ga0466972_0254684
710 Ga0466963_0173345
711 Ga0453684_0000590
712 Ga0453684_0231780
713 Ga0466968_0173423
714 Ga0451576_0004219
715 Ga0451576_0060229
716 Ga0451576_0173982
717 Ga0451576_0447865
718 Ga0495592_0000185
719 Ga0495590_0004591
720 Ga0495638_0041107
721 Ga0495651_0407808
722 Ga0495610_0054875
723 Ga0495616_0000562
724 Ga0495631_0000101
725 Ga0495663_0003450
726 Ga0495654_0006288
727 Ga0495654_0180617
728 Ga0495621_0006825
729 Ga0495622_0047908
730 Ga0495633_0001008
731 Ga0495656_0001785
732 Ga0495668_0012650
733 Ga0495625_0000136
734 Ga0495661_0038865
735 Ga0495588_0132628
736 Ga0495658_0083407
737 Ga0495624_0169761
738 Ga0495670_0009912
739 Ga0495670_0055771
740 Ga0495660_0078524
741 Ga0495676_0082091
742 Ga0495677_0065963
743 Ga0495593_0016527
744 Ga0496100_0024076
745 Ga0496101_0019898
746 Ga0496102_0002452
747 Ga0496103_0019063
748 Ga0496103_0071034
749 Ga0496104_0020479
750 Ga0496104_0033120
751 Ga0496105_0002217
752 Ga0496105_0182747
753 Ga0496105_0199376
754 Ga0496106_0055508
755 Ga0496107_0104870
756 Ga0496108_0011679
757 Ga0496109_0085579
758 Ga0496109_0160808
759 Ga0496109_0931781
760 Ga0496110_0007166
761 Ga0496110_0047572
762 Ga0496110_0186342
763 Ga0496111_0040039
764 Ga0496112_0009077
765 Ga0496113_0012910
766 Ga0496114_0457811
767 Ga0496116_0102648
768 Ga0496117_0038911
769 Ga0496121_0072002
770 Ga0496121_0100084
771 Ga0496122_0080760
772 Ga0496122_0108807
773 Ga0496122_0120821
774 Ga0496122_0128190
775 Ga0496122_0180492
776 Ga0496123_0043743
777 Ga0496123_0066417
778 Ga0496124_0011416
779 Ga0496124_0033599
780 Ga0496124_0048172
781 Ga0496125_0084746
782 Ga0496125_0120096
783 nmdc:mga03683_30814_c1
784 nmdc:mga0k408_107614_c1
785 nmdc:mga0k408_15424_c1
786 nmdc:mga0k408_34058_c1
787 nmdc:mga0k408_57455_c1
788 nmdc:mga0k408_59166_c1
789 nmdc:mga07m45_219555_c1
790 nmdc:mga07m45_2587_c1
791 nmdc:mga07m45_2731_c1
792 nmdc:mga05p37_47840_c1
793 Ga0500635_0070832
794 Ga0500643_047311
795 Ga0500651_0000136
796 Ga0500651_0151160
797 Ga0500562_001753
798 Ga0500562_057922
799 Ga0500571_000102
800 Ga0500572_034122
801 Ga0500592_002205
802 Ga0500594_0030656
803 Ga0500608_114528
804 Ga0500564_072763
805 Ga0500568_0012029
806 Ga0500574_000703
807 Ga0500634_0016322
808 Ga0500634_0052647
809 Ga0500638_034129
810 Ga0500636_0175871
811 2548501814
812 2643864072
813 2643992382
814 2644060050
815 2644072654
816 2644292271
817 2644339611
818 2644646460
819 2722881168
820 2739245678
821 2816470418
822 2831865451
823 2839141097
824 2842720929
825 2919708621
826 2932425555
827 2974321190
828 2990714603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

53

191

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tak-assembly1.cif.gz_AAA crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.9552 12 227
6taj-assembly2.cif.gz_BBB-2 crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution 0.9464 13 227
1sto-assembly1.cif.gz_A-2 crystal structure of orotate phosphoribosyltransferase 0.9432 12 227
3n2l-assembly6.cif.gz_H 2.1 angstrom resolution crystal structure of an orotate phosphoribosyltransferase (pyre) from vibrio cholerae o1 biovar eltor str. n16961 0.9392 12 206
6tak-assembly1.cif.gz_AAA crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.9372 12 227
ID Description Score Start End Superfamily
3n2lH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9392 12 206 3.40.50.2020
3n2lH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9233 12 206 3.40.50.2020
3mjdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9106 16 227 3.40.50.2020
3mjdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8978 16 227 3.40.50.2020
af_O94331_1_215_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8835 12 229 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A126ZDK1-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9546 6 229 GO:0000287
GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-Q21RH6-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9488 14 229 GO:0000287
GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A370FNH6-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9485 1 228 GO:0000287
GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-C9Y6Y3-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9472 12 229 GO:0000287
GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A254N542-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.946 12 227 GO:0000287
GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132

Map