F438144

General Info

Members Datasets Scaffolds Average Seq Length
413 266 827 135

Family's Representative Sequence

Representative Sequence 3300047470|Ga0495681_0058945|Ga0495681_0058945_112_576
Length 154
Sequence MGVSAKASLEPAVAAKTPAVSKPPAVPKYDIGEAMCPYRLVLEHVTSRWGVLVLIELLDRPYRFSELRRAIGRVSEKMLTQTLQTLERDGLVHRDAKPVIPPRVDYSLTGLGREAAEQVRALAVWTKDRMDDVEKSRHAYDEARASAARAPGTS

Samples

Sample ID Description Type Environment
1 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
27 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
30 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
41 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
57 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
61 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
62 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
63 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
64 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
65 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
68 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
69 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
70 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
71 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
72 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
73 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
74 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
75 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
190 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
205 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
206 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
207 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
208 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
209 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
210 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
213 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
214 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
215 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
216 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
217 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
218 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
219 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
220 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
221 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
222 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
225 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
226 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
227 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
228 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
229 2643221578 Streptomyces sp. Root63 Isolate Unclassified
230 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
231 2643221611 Acidovorax sp. Root219 Isolate Unclassified
232 2643221670 Streptomyces sp. Root431 Isolate Unclassified
233 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
234 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
235 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
236 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
237 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
238 2738543012 Acidovorax sp. CF301 Isolate Unclassified
239 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
240 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
241 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
242 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
243 2816332133 Acidovorax radicis 2721A Isolate Unclassified
244 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
245 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
246 2862574272 Streptomyces sp. AcE210 Isolate Nodule
247 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
248 2867428634 Streptomyces sp. RP5T Isolate Unclassified
249 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
250 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
251 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
252 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
253 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
254 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
255 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
256 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
257 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
258 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
259 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
260 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
261 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
262 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
263 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
264 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
265 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
266 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.59
Metatranscriptomes 0
Isolates 10.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.2
Nodule 0.97
Rhizoplane 2.18
Rhizosphere 69.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495681_0058945 3300047470 Bacteria 1777
2 JGI24739J22299_10015057 3300001989 Bacteria 2812
3 JGI24738J21930_10021718 3300002075 Bacteria 1330
4 rootH1_10026107 3300003316 Bacteria 2806
5 rootH1_10026107 3300003323 Bacteria 20922
6 rootH2_10054684 3300003320 Bacteria 10517
7 rootL2_10117983 3300003322 Bacteria 2529
8 rootL2_10345868 3300003322 Bacteria 1152
9 rootH1_10042741 3300003323 Bacteria 5329
10 Ga0065712_10067925 3300005290 Bacteria 20547
11 Ga0065712_10072556 3300005290 Bacteria 4707
12 Ga0068853_100150404 3300005539 Bacteria 2095
13 Ga0070695_101679304 3300005545 Bacteria 531
14 Ga0068855_100395462 3300005563 Bacteria 1515
15 Ga0075365_10105221 3300006038 Bacteria 1935
16 Ga0075367_10002716 3300006178 Bacteria 8171
17 Ga0075370_10059677 3300006353 Bacteria 2171
18 Ga0105251_10005846 3300009011 Bacteria 7963
19 Ga0105251_10048107 3300009011 Bacteria 2046
20 Ga0105250_10002279 3300009092 Bacteria 9753
21 Ga0105250_10013945 3300009092 Bacteria 3309
22 Ga0105248_10275917 3300009177 Bacteria 1893
23 Ga0105237_12063224 3300009545 Bacteria 579
24 Ga0105238_10051104 3300009551 Bacteria 4158
25 Ga0105249_11865319 3300009553 Bacteria 674
26 Ga0105246_10000209 3300011119 Bacteria 29632
27 Ga0105246_10444902 3300011119 Bacteria 1087
28 Ga0157373_10562617 3300013100 Bacteria 828
29 Ga0157374_10547659 3300013296 Bacteria 1164
30 Ga0157372_10809813 3300013307 Bacteria 1088
31 Ga0182008_10011341 3300014497 Bacteria 4745
32 Ga0182007_10001793 3300015262 Bacteria 11213
33 Ga0182005_1137541 3300015265 Bacteria 704
34 Ga0163161_10130947 3300017792 Bacteria 1892
35 Ga0163161_10984698 3300017792 Bacteria 719
36 Ga0209758_1015915 3300025297 Bacteria 3859
37 Ga0207426_1026005 3300025302 Bacteria 1965
38 Ga0207696_1000128 3300025711 Bacteria 134490
39 Ga0207696_1021132 3300025711 Bacteria 2087
40 Ga0207713_1000425 3300025735 Bacteria 44808
41 Ga0207713_1048639 3300025735 Bacteria 1706
42 Ga0207647_10012223 3300025904 Bacteria 5985
43 Ga0207686_10965256 3300025934 Bacteria 690
44 Ga0207711_10177227 3300025941 Bacteria 1937
45 Ga0207639_10083114 3300026041 Bacteria 2541
46 Ga0209371_1038381 3300027312 Bacteria 988
47 Ga0209813_10101898 3300027866 Bacteria 978
48 Ga0268266_10499538 3300028379 Bacteria 1161
49 Ga0307515_10032827 3300028794 Bacteria 8577
50 Ga0307515_10093299 3300028794 Bacteria 3734
51 Ga0268256_1019641 3300030500 Bacteria 1844
52 Ga0307511_10008707 3300030521 Bacteria 10143
53 Ga0307512_10004118 3300030522 Bacteria 16147
54 Ga0307512_10006362 3300030522 Bacteria 11974
55 Ga0307512_10018458 3300030522 Bacteria 6372
56 Ga0307512_10025219 3300030522 Bacteria 5274
57 Ga0265332_10000024 3300031238 Bacteria 209663
58 Ga0307513_10027304 3300031456 Bacteria 6558
59 Ga0307513_10031738 3300031456 Bacteria 5976
60 Ga0307509_10057706 3300031507 Bacteria 4114
61 Ga0307509_10074429 3300031507 Bacteria 3532
62 Ga0307508_10006646 3300031616 Bacteria 10861
63 Ga0307508_10007857 3300031616 Bacteria 9902
64 Ga0307508_10024325 3300031616 Bacteria 5496
65 Ga0307508_10063572 3300031616 Bacteria 3256
66 Ga0307508_10249781 3300031616 Bacteria 1370
67 Ga0307514_10477422 3300031649 Bacteria 602
68 Ga0307516_10015949 3300031730 Bacteria 7879
69 Ga0307516_10222965 3300031730 Bacteria 1593
70 Ga0307516_10331284 3300031730 Bacteria 1191
71 Ga0307405_10000064 3300031731 Bacteria 49835
72 Ga0307405_10096790 3300031731 Bacteria 1969
73 Ga0307413_10872846 3300031824 Bacteria 762
74 Ga0307518_10057598 3300031838 Bacteria 2822
75 Ga0307518_10069981 3300031838 Bacteria 2542
76 Ga0307518_10207501 3300031838 Bacteria 1294
77 Ga0307410_10339558 3300031852 Bacteria 1197
78 Ga0307410_10387482 3300031852 Bacteria 1126
79 Ga0307409_101925542 3300031995 Bacteria 621
80 Ga0307416_100371478 3300032002 Bacteria 1456
81 Ga0307416_102175499 3300032002 Bacteria 656
82 Ga0307507_10038704 3300033179 Bacteria 4828
83 Ga0307507_10132156 3300033179 Bacteria 1948
84 Ga0307507_10155467 3300033179 Bacteria 1706
85 Ga0307507_10165726 3300033179 Bacteria 1620
86 Ga0307510_10040750 3300033180 Bacteria 5091
87 Ga0307510_10513009 3300033180 Bacteria 642
88 Ga0395898_0020518 3300037466 Bacteria 6712
89 Ga0395901_0601419 3300038443 Bacteria 1109
90 Ga0451795_0019544 3300041456 Bacteria 651
91 Ga0451802_1277264 3300041460 Bacteria 1349
92 Ga0451837_1363471 3300041494 Bacteria 2162
93 Ga0451839_0484899 3300041496 Bacteria 532
94 Ga0451841_1158653 3300041498 Bacteria 1468
95 Ga0451849_0536277 3300041505 Bacteria 982
96 Ga0451849_0932585 3300041505 Bacteria 831
97 Ga0451853_1266049 3300041512 Bacteria 789
98 Ga0451853_1578620 3300041512 Bacteria 1020
99 Ga0451853_2851054 3300041512 Bacteria 2202
100 Ga0439431_0018116 3300041997 Bacteria 1663
101 Ga0439442_039071 3300042002 Bacteria 995
102 Ga0439457_018508 3300042014 Bacteria 1548
103 Ga0450897_000783 3300042128 Bacteria 1925
104 Ga0450894_000867 3300042131 Bacteria 4827
105 Ga0450894_001940 3300042131 Bacteria 2859
106 Ga0450898_000457 3300042134 Bacteria 4772
107 Ga0450898_013709 3300042134 Bacteria 1354
108 Ga0450899_001460 3300042135 Bacteria 2635
109 Ga0450899_008283 3300042135 Bacteria 1139
110 Ga0450906_002922 3300042145 Bacteria 3715
111 Ga0450908_007941 3300042184 Bacteria 1990
112 Ga0451577_0000771 3300042876 Bacteria 48361
113 Ga0466972_0021594 3300044658 Bacteria 3208
114 Ga0466965_0003963 3300044683 Bacteria 6560
115 Ga0466966_0020082 3300044684 Bacteria 4395
116 Ga0466961_0040193 3300044693 Bacteria 2998
117 Ga0466963_0002947 3300044694 Bacteria 9616
118 Ga0466963_0224964 3300044694 Bacteria 1314
119 Ga0466964_0365202 3300044706 Bacteria 745
120 Ga0453684_0003997 3300044712 Bacteria 32182
121 Ga0453684_0142755 3300044712 Bacteria 2856
122 Ga0466971_0021282 3300044719 Bacteria 2886
123 Ga0466970_0015051 3300044765 Bacteria 3978
124 Ga0466957_0002269 3300044842 Bacteria 10302
125 Ga0466959_0078408 3300045049 Bacteria 2382
126 Ga0466958_0056659 3300045836 Bacteria 2381
127 Ga0466967_0028300 3300045976 Bacteria 4677
128 Ga0466967_0043066 3300045976 Bacteria 3907
129 Ga0495617_034550 3300046452 Bacteria 1697
130 Ga0495627_012367 3300046453 Bacteria 3032
131 Ga0495592_0006486 3300046454 Bacteria 8710
132 Ga0495592_0102772 3300046454 Bacteria 2034
133 Ga0495603_0001519 3300046455 Bacteria 13539
134 Ga0495603_0029575 3300046455 Bacteria 3303
135 Ga0495603_0129859 3300046455 Bacteria 1467
136 Ga0495603_0490598 3300046455 Bacteria 703
137 Ga0495590_0249638 3300046457 Bacteria 660
138 Ga0495629_0002558 3300046459 Bacteria 13949
139 Ga0495629_0067312 3300046459 Bacteria 2499
140 Ga0495629_0110988 3300046459 Bacteria 1912
141 Ga0495629_0154565 3300046459 Bacteria 1594
142 Ga0495629_0206039 3300046459 Bacteria 1359
143 Ga0495629_0455822 3300046459 Bacteria 865
144 Ga0495638_0039270 3300046460 Bacteria 3005
145 Ga0495638_0283503 3300046460 Bacteria 899
146 Ga0495651_0017883 3300046462 Bacteria 5489
147 Ga0495651_0018286 3300046462 Bacteria 5427
148 Ga0495653_0015894 3300046463 Bacteria 6134
149 Ga0495580_0133351 3300046472 Bacteria 1722
150 Ga0495580_0476296 3300046472 Bacteria 835
151 Ga0495582_0416025 3300046473 Bacteria 775
152 Ga0495605_0024278 3300046474 Bacteria 3174
153 Ga0495639_0003516 3300046475 Bacteria 6762
154 Ga0495662_0001291 3300046476 Bacteria 12398
155 Ga0495662_0043423 3300046476 Bacteria 2170
156 Ga0495662_0052642 3300046476 Bacteria 1965
157 Ga0495662_0238046 3300046476 Bacteria 897
158 Ga0495664_0020980 3300046477 Bacteria 3771
159 Ga0495584_0128393 3300046491 Bacteria 1286
160 Ga0495585_0087998 3300046492 Bacteria 1675
161 Ga0495585_0227306 3300046492 Bacteria 939
162 Ga0495585_0242562 3300046492 Bacteria 902
163 Ga0495594_0001573 3300046499 Bacteria 11858
164 Ga0495594_0198504 3300046499 Bacteria 1143
165 Ga0495594_0490185 3300046499 Bacteria 698
166 Ga0495583_0048431 3300046506 Bacteria 1950
167 Ga0495583_0160510 3300046506 Bacteria 927
168 Ga0495606_0181145 3300046507 Bacteria 1214
169 Ga0495608_0004832 3300046511 Bacteria 9631
170 Ga0495616_0008308 3300046513 Bacteria 6158
171 Ga0495618_0202973 3300046514 Bacteria 1254
172 Ga0495618_0208429 3300046514 Bacteria 1236
173 Ga0495620_0045598 3300046515 Bacteria 1896
174 Ga0495620_0097963 3300046515 Bacteria 1171
175 Ga0495628_0019667 3300046516 Bacteria 5578
176 Ga0495628_0117463 3300046516 Bacteria 2042
177 Ga0495628_0307406 3300046516 Bacteria 1172
178 Ga0495630_0009162 3300046517 Bacteria 7119
179 Ga0495630_0411113 3300046517 Bacteria 1037
180 Ga0495631_0005347 3300046518 Bacteria 6738
181 Ga0495631_0363025 3300046518 Bacteria 616
182 Ga0495632_0007151 3300046519 Bacteria 7060
183 Ga0495632_0050365 3300046519 Bacteria 2054
184 Ga0495637_0066328 3300046520 Bacteria 1467
185 Ga0495643_0003750 3300046522 Bacteria 10993
186 Ga0495643_0090718 3300046522 Bacteria 1576
187 Ga0495666_0006424 3300046526 Bacteria 5918
188 Ga0495666_0079039 3300046526 Bacteria 1557
189 Ga0495652_0023738 3300046529 Bacteria 5436
190 Ga0495652_0054650 3300046529 Bacteria 3399
191 Ga0495640_0004219 3300046533 Bacteria 11498
192 Ga0495640_0011622 3300046533 Bacteria 6763
193 Ga0495586_0001638 3300046535 Bacteria 12278
194 Ga0495587_0019346 3300046536 Bacteria 4215
195 Ga0495609_0042575 3300046538 Bacteria 2039
196 Ga0495597_0018483 3300046542 Bacteria 3271
197 Ga0495597_0079847 3300046542 Bacteria 1400
198 Ga0495597_0235210 3300046542 Bacteria 724
199 Ga0495645_0010587 3300046543 Bacteria 6473
200 Ga0495622_0003411 3300046557 Bacteria 7495
201 Ga0495622_0069725 3300046557 Bacteria 1623
202 Ga0495622_0109345 3300046557 Bacteria 1265
203 Ga0495667_0019386 3300046559 Bacteria 4589
204 Ga0495667_0088268 3300046559 Bacteria 2010
205 Ga0495656_0107998 3300046615 Bacteria 1297
206 Ga0495668_0000141 3300046616 Bacteria 108840
207 Ga0495668_0111037 3300046616 Bacteria 1499
208 Ga0495634_0021795 3300046642 Bacteria 4522
209 Ga0495634_0219650 3300046642 Bacteria 1173
210 Ga0495634_0314185 3300046642 Bacteria 945
211 Ga0495634_0315930 3300046642 Bacteria 941
212 Ga0495611_0008397 3300046648 Bacteria 4374
213 Ga0495611_0019712 3300046648 Bacteria 2898
214 Ga0495611_0109933 3300046648 Bacteria 1283
215 Ga0495611_0229682 3300046648 Bacteria 862
216 Ga0495625_0020324 3300046660 Bacteria 5129
217 Ga0495625_0060258 3300046660 Bacteria 2689
218 Ga0495625_0127290 3300046660 Bacteria 1728
219 Ga0495635_0009436 3300046663 Bacteria 6821
220 Ga0495635_0019699 3300046663 Bacteria 4698
221 Ga0495635_0133895 3300046663 Bacteria 1689
222 Ga0495588_0009681 3300046674 Bacteria 4465
223 Ga0495588_0022861 3300046674 Bacteria 3092
224 Ga0495588_0096289 3300046674 Bacteria 1552
225 Ga0495657_0008422 3300046675 Bacteria 7889
226 Ga0495657_0010980 3300046675 Bacteria 6792
227 Ga0495657_0042172 3300046675 Bacteria 3117
228 Ga0495657_0068699 3300046675 Bacteria 2320
229 Ga0495599_0026956 3300046678 Bacteria 3600
230 Ga0495623_0010150 3300046679 Bacteria 6094
231 Ga0495623_0038402 3300046679 Bacteria 3062
232 Ga0495646_0020161 3300046680 Bacteria 4215
233 Ga0495646_0369959 3300046680 Bacteria 748
234 Ga0495613_0006215 3300046689 Bacteria 8931
235 Ga0495613_0017533 3300046689 Bacteria 5331
236 Ga0495613_0023325 3300046689 Bacteria 4609
237 Ga0495613_0034482 3300046689 Bacteria 3758
238 Ga0495613_0115587 3300046689 Bacteria 1930
239 Ga0495613_0229292 3300046689 Bacteria 1301
240 Ga0495613_0270894 3300046689 Bacteria 1181
241 Ga0495613_0728522 3300046689 Bacteria 651
242 Ga0495624_0085879 3300046690 Bacteria 1943
243 Ga0495670_0002396 3300046691 Bacteria 9243
244 Ga0495671_0468567 3300046692 Bacteria 602
245 Ga0495649_0074934 3300046694 Bacteria 1812
246 Ga0495649_0078650 3300046694 Bacteria 1764
247 Ga0495589_0027296 3300046794 Bacteria 2886
248 Ga0495589_0055324 3300046794 Bacteria 1955
249 Ga0495589_0331418 3300046794 Bacteria 702
250 Ga0495600_0040435 3300046809 Bacteria 3036
251 Ga0495600_0580988 3300046809 Bacteria 682
252 Ga0495660_0007259 3300046810 Bacteria 6523
253 Ga0495660_0311144 3300046810 Bacteria 710
254 Ga0495581_0125706 3300047315 Bacteria 1493
255 Ga0495581_0254793 3300047315 Bacteria 1026
256 Ga0495581_0353875 3300047315 Bacteria 857
257 Ga0495604_0000132 3300047317 Bacteria 63177
258 Ga0495604_0019625 3300047317 Bacteria 5410
259 Ga0495604_0216122 3300047317 Bacteria 1322
260 Ga0495604_0314931 3300047317 Bacteria 1047
261 Ga0495636_0003549 3300047318 Bacteria 6046
262 Ga0495636_0009173 3300047318 Bacteria 3891
263 Ga0495636_0108976 3300047318 Bacteria 1217
264 Ga0495636_0312269 3300047318 Bacteria 737
265 Ga0495636_0443222 3300047318 Bacteria 623
266 Ga0495674_0017771 3300047319 Bacteria 6621
267 Ga0495674_0544839 3300047319 Bacteria 924
268 Ga0495672_0054846 3300047320 Bacteria 2327
269 Ga0495676_0006189 3300047321 Bacteria 11004
270 Ga0495676_0013792 3300047321 Bacteria 7246
271 Ga0495676_0182912 3300047321 Bacteria 1467
272 Ga0495676_0241438 3300047321 Bacteria 1236
273 Ga0495680_0018124 3300047322 Bacteria 5987
274 Ga0495683_0033359 3300047323 Bacteria 2619
275 Ga0495683_0049836 3300047323 Bacteria 2097
276 Ga0495683_0072757 3300047323 Bacteria 1686
277 Ga0495683_0309257 3300047323 Bacteria 677
278 Ga0495687_002461 3300047443 Bacteria 14807
279 Ga0495687_004954 3300047443 Bacteria 8711
280 Ga0495687_049805 3300047443 Bacteria 1788
281 Ga0495687_071642 3300047443 Bacteria 1387
282 Ga0495687_126336 3300047443 Bacteria 913
283 Ga0495675_0017718 3300047444 Bacteria 4515
284 Ga0495675_0482662 3300047444 Bacteria 713
285 Ga0495677_0166413 3300047445 Bacteria 852
286 Ga0495679_066631 3300047446 Bacteria 1045
287 Ga0495685_000473 3300047447 Bacteria 12516
288 Ga0495685_002653 3300047447 Bacteria 5637
289 Ga0495685_008550 3300047447 Bacteria 3402
290 Ga0495685_011336 3300047447 Bacteria 3004
291 Ga0495685_024422 3300047447 Bacteria 2080
292 Ga0495685_091191 3300047447 Bacteria 1010
293 Ga0495673_0081127 3300047469 Bacteria 1344
294 Ga0495681_0002970 3300047470 Bacteria 11953
295 Ga0495681_0236914 3300047470 Bacteria 726
296 Ga0495684_0037002 3300047471 Bacteria 3741
297 Ga0495684_0324489 3300047471 Bacteria 1100
298 Ga0495686_0171595 3300047472 Bacteria 1261
299 Ga0495593_0030608 3300047673 Bacteria 2944
300 Ga0495593_0040990 3300047673 Bacteria 2491
301 Ga0495593_0343525 3300047673 Bacteria 746
302 Ga0495602_0031786 3300048088 Bacteria 4983
303 Ga0495614_0000238 3300048089 Bacteria 21398
304 Ga0495614_0033367 3300048089 Bacteria 2214
305 Ga0495614_0069373 3300048089 Bacteria 1518
306 Ga0495626_0113473 3300048091 Bacteria 1171
307 Ga0495626_0278947 3300048091 Bacteria 664
308 Ga0496104_1798606 3300048907 Bacteria 515
309 Ga0496106_0072687 3300048909 Bacteria 2630
310 Ga0496108_0077955 3300048911 Bacteria 2804
311 Ga0496113_0202709 3300048916 Bacteria 1577
312 Ga0496114_1130989 3300048917 Bacteria 668
313 Ga0496117_0019393 3300048920 Bacteria 5586
314 Ga0496118_0002259 3300048921 Bacteria 26365
315 Ga0496118_0003041 3300048921 Bacteria 21612
316 Ga0496119_0108822 3300048922 Bacteria 1542
317 Ga0496119_0272446 3300048922 Bacteria 845
318 Ga0496122_0081735 3300048925 Bacteria 2247
319 Ga0496123_0076673 3300048926 Bacteria 2056
320 Ga0496124_0536560 3300048927 Bacteria 775
321 Ga0496125_0006194 3300048928 Bacteria 13031
322 Ga0496125_0061792 3300048928 Bacteria 3001
323 Ga0496126_0000929 3300048929 Bacteria 50582
324 Ga0495682_0008014 3300049460 Bacteria 4177
325 Ga0501034_0121263 3300049571 Bacteria 2601
326 Ga0501036_0078282 3300049572 Bacteria 2796
327 Ga0501037_0952764 3300049573 Bacteria 561
328 Ga0501038_0386062 3300049574 Bacteria 1085
329 Ga0501047_0494546 3300049581 Bacteria 1050
330 Ga0501070_1375588 3300049586 Bacteria 537
331 Ga0501202_056374 3300049652 Bacteria 880
332 Ga0501224_027940 3300049664 Bacteria 844
333 Ga0501235_019116 3300049669 Bacteria 1520
334 Ga0501257_076818 3300049686 Bacteria 858
335 Ga0501035_0044661 3300049822 Bacteria 3989
336 Ga0501035_0475575 3300049822 Bacteria 1031
337 nmdc:mga0yw44_51890_c1 3300050492 Bacteria 2484
338 nmdc:mga0yw44_598728_c1 3300050492 Bacteria 749
339 nmdc:mga0k408_132692_c1 3300050493 Bacteria 1479
340 nmdc:mga06z11_1811_c1 3300050494 Bacteria 8049
341 nmdc:mga07m45_2920_c1 3300050496 Bacteria 8107
342 nmdc:mga07m45_852039_c1 3300050496 Bacteria 522
343 Ga0495601_0034373 3300053077 Bacteria 3162
344 Ga0495619_0368817 3300053085 Bacteria 992
345 Ga0500578_0006894 3300053086 Bacteria 7535
346 Ga0500644_0028367 3300053088 Bacteria 1750
347 Ga0500566_0057944 3300053094 Bacteria 2200
348 Ga0500641_0251508 3300053096 Bacteria 741
349 Ga0500650_0143552 3300053098 Bacteria 1106
350 Ga0500654_040478 3300053099 Bacteria 2655
351 Ga0500553_053719 3300053101 Bacteria 1922
352 Ga0500560_031373 3300053107 Bacteria 1608
353 Ga0500569_022877 3300053109 Bacteria 1672
354 Ga0500580_152276 3300053113 Bacteria 832
355 Ga0500594_0002499 3300053118 Bacteria 4000
356 Ga0500618_005769 3300053125 Bacteria 3723
357 Ga0500628_002016 3300053129 Bacteria 3412
358 Ga0500652_012236 3300053131 Bacteria 3004
359 Ga0500652_195933 3300053131 Bacteria 821
360 Ga0500561_0000258 3300053137 Bacteria 9236
361 Ga0500573_0027054 3300053140 Bacteria 3297
362 Ga0500573_0139219 3300053140 Bacteria 1338
363 Ga0500600_0003624 3300053149 Bacteria 8966
364 Ga0500600_0041112 3300053149 Bacteria 2667
365 Ga0500622_0171969 3300053156 Bacteria 1008
366 Ga0500633_0100009 3300053160 Bacteria 1066
367 Ga0500634_0033984 3300053161 Bacteria 2778
368 Ga0500636_0434863 3300053177 Bacteria 598
369 Ga0500656_002409 3300053732 Bacteria 1689
370 Ga0500587_000835 3300053739 Bacteria 4045
371 Ga0466962_0010237 3300061719 Bacteria 4502
372 2585308156 2582581313 Bacteria 10042643
373 2585319530 2582581314 Bacteria 11452267
374 2599883261 2599185288 Bacteria 6666191
375 2599949157 2599185303 Bacteria 6512725
376 2616696862 2616644814 Bacteria 11555299
377 2643902849 2643221578 Bacteria 9213798
378 2643942057 2643221587 Bacteria 7586415
379 2644074079 2643221611 Bacteria 6820941
380 2644389705 2643221670 Bacteria 6497041
381 2644404641 2643221673 Bacteria 9196637
382 2644429140 2643221677 Bacteria 7584031
383 2644439260 2643221678 Bacteria 9540101
384 2738811506 2738541294 Bacteria 6925949
385 2738898866 2738541309 Bacteria 6926455
386 2739242778 2738543012 Bacteria 7115078
387 2785370711 2784746768 Bacteria 10036182
388 2808843259 2808606359 Bacteria 9866990
389 2808912841 2808606375 Bacteria 9466072
390 2809588945 2808606522 Bacteria 9488490
391 2816472907 2816332133 Bacteria 7249298
392 2862391073 2862382967 Bacteria 10317375
393 2862516219 2862507626 Bacteria 9425308
394 2862578254 2862574272 Bacteria 10567477
395 2863411628 2863404153 Bacteria 9672205
396 2867432509 2867428634 Bacteria 9590268
397 2873154757 2873151551 Bacteria 8625867
398 2877679877 2877676314 Bacteria 9512378
399 2912758138 2912757875 Bacteria 7940295
400 2918505746 2918501144 Bacteria 8668083
401 2919475980 2919468124 Bacteria 9133025
402 2954003055 2954002825 Bacteria 9173742
403 2954715068 2954711539 Bacteria 10867210
404 2954725010 2954721474 Bacteria 10456478
405 2954736808 2954731030 Bacteria 10243860
406 2954743943 2954740390 Bacteria 10229294
407 2954755656 2954749733 Bacteria 10366972
408 2954762884 2954759201 Bacteria 9358192
409 2974324277 2974320154 Bacteria 4571377
410 2990062239 2990059506 Bacteria 9321252
411 3006393692 3006393351 Bacteria 6615579
412 8001789142 8001781756 Bacteria 9586736
413 8008566471 8008558824 Bacteria 10610750
414 8054290623 8054285046 Bacteria 6919322
415 Ga0495681_0058945
416 JGI24739J22299_10015057
417 JGI24738J21930_10021718
418 rootH1_10026107
419 rootH2_10054684
420 rootL2_10117983
421 rootL2_10345868
422 rootH1_10042741
423 Ga0065712_10067925
424 Ga0065712_10072556
425 Ga0068853_100150404
426 Ga0070695_101679304
427 Ga0068855_100395462
428 Ga0075365_10105221
429 Ga0075367_10002716
430 Ga0075370_10059677
431 Ga0105251_10005846
432 Ga0105251_10048107
433 Ga0105250_10002279
434 Ga0105250_10013945
435 Ga0105248_10275917
436 Ga0105237_12063224
437 Ga0105238_10051104
438 Ga0105249_11865319
439 Ga0105246_10000209
440 Ga0105246_10444902
441 Ga0157373_10562617
442 Ga0157374_10547659
443 Ga0157372_10809813
444 Ga0182008_10011341
445 Ga0182007_10001793
446 Ga0182005_1137541
447 Ga0163161_10130947
448 Ga0163161_10984698
449 Ga0209758_1015915
450 Ga0207426_1026005
451 Ga0207696_1000128
452 Ga0207696_1021132
453 Ga0207713_1000425
454 Ga0207713_1048639
455 Ga0207647_10012223
456 Ga0207686_10965256
457 Ga0207711_10177227
458 Ga0207639_10083114
459 Ga0209371_1038381
460 Ga0209813_10101898
461 Ga0268266_10499538
462 Ga0307515_10032827
463 Ga0307515_10093299
464 Ga0268256_1019641
465 Ga0307511_10008707
466 Ga0307512_10004118
467 Ga0307512_10006362
468 Ga0307512_10018458
469 Ga0307512_10025219
470 Ga0265332_10000024
471 Ga0307513_10027304
472 Ga0307513_10031738
473 Ga0307509_10057706
474 Ga0307509_10074429
475 Ga0307508_10006646
476 Ga0307508_10007857
477 Ga0307508_10024325
478 Ga0307508_10063572
479 Ga0307508_10249781
480 Ga0307514_10477422
481 Ga0307516_10015949
482 Ga0307516_10222965
483 Ga0307516_10331284
484 Ga0307405_10000064
485 Ga0307405_10096790
486 Ga0307413_10872846
487 Ga0307518_10057598
488 Ga0307518_10069981
489 Ga0307518_10207501
490 Ga0307410_10339558
491 Ga0307410_10387482
492 Ga0307409_101925542
493 Ga0307416_100371478
494 Ga0307416_102175499
495 Ga0307507_10038704
496 Ga0307507_10132156
497 Ga0307507_10155467
498 Ga0307507_10165726
499 Ga0307510_10040750
500 Ga0307510_10513009
501 Ga0395898_0020518
502 Ga0395901_0601419
503 Ga0451795_0019544
504 Ga0451802_1277264
505 Ga0451837_1363471
506 Ga0451839_0484899
507 Ga0451841_1158653
508 Ga0451849_0536277
509 Ga0451849_0932585
510 Ga0451853_1266049
511 Ga0451853_1578620
512 Ga0451853_2851054
513 Ga0439431_0018116
514 Ga0439442_039071
515 Ga0439457_018508
516 Ga0450897_000783
517 Ga0450894_000867
518 Ga0450894_001940
519 Ga0450898_000457
520 Ga0450898_013709
521 Ga0450899_001460
522 Ga0450899_008283
523 Ga0450906_002922
524 Ga0450908_007941
525 Ga0451577_0000771
526 Ga0466972_0021594
527 Ga0466965_0003963
528 Ga0466966_0020082
529 Ga0466961_0040193
530 Ga0466963_0002947
531 Ga0466963_0224964
532 Ga0466964_0365202
533 Ga0453684_0003997
534 Ga0453684_0142755
535 Ga0466971_0021282
536 Ga0466970_0015051
537 Ga0466957_0002269
538 Ga0466959_0078408
539 Ga0466958_0056659
540 Ga0466967_0028300
541 Ga0466967_0043066
542 Ga0495617_034550
543 Ga0495627_012367
544 Ga0495592_0006486
545 Ga0495592_0102772
546 Ga0495603_0001519
547 Ga0495603_0029575
548 Ga0495603_0129859
549 Ga0495603_0490598
550 Ga0495590_0249638
551 Ga0495629_0002558
552 Ga0495629_0067312
553 Ga0495629_0110988
554 Ga0495629_0154565
555 Ga0495629_0206039
556 Ga0495629_0455822
557 Ga0495638_0039270
558 Ga0495638_0283503
559 Ga0495651_0017883
560 Ga0495651_0018286
561 Ga0495653_0015894
562 Ga0495580_0133351
563 Ga0495580_0476296
564 Ga0495582_0416025
565 Ga0495605_0024278
566 Ga0495639_0003516
567 Ga0495662_0001291
568 Ga0495662_0043423
569 Ga0495662_0052642
570 Ga0495662_0238046
571 Ga0495664_0020980
572 Ga0495584_0128393
573 Ga0495585_0087998
574 Ga0495585_0227306
575 Ga0495585_0242562
576 Ga0495594_0001573
577 Ga0495594_0198504
578 Ga0495594_0490185
579 Ga0495583_0048431
580 Ga0495583_0160510
581 Ga0495606_0181145
582 Ga0495608_0004832
583 Ga0495616_0008308
584 Ga0495618_0202973
585 Ga0495618_0208429
586 Ga0495620_0045598
587 Ga0495620_0097963
588 Ga0495628_0019667
589 Ga0495628_0117463
590 Ga0495628_0307406
591 Ga0495630_0009162
592 Ga0495630_0411113
593 Ga0495631_0005347
594 Ga0495631_0363025
595 Ga0495632_0007151
596 Ga0495632_0050365
597 Ga0495637_0066328
598 Ga0495643_0003750
599 Ga0495643_0090718
600 Ga0495666_0006424
601 Ga0495666_0079039
602 Ga0495652_0023738
603 Ga0495652_0054650
604 Ga0495640_0004219
605 Ga0495640_0011622
606 Ga0495586_0001638
607 Ga0495587_0019346
608 Ga0495609_0042575
609 Ga0495597_0018483
610 Ga0495597_0079847
611 Ga0495597_0235210
612 Ga0495645_0010587
613 Ga0495622_0003411
614 Ga0495622_0069725
615 Ga0495622_0109345
616 Ga0495667_0019386
617 Ga0495667_0088268
618 Ga0495656_0107998
619 Ga0495668_0000141
620 Ga0495668_0111037
621 Ga0495634_0021795
622 Ga0495634_0219650
623 Ga0495634_0314185
624 Ga0495634_0315930
625 Ga0495611_0008397
626 Ga0495611_0019712
627 Ga0495611_0109933
628 Ga0495611_0229682
629 Ga0495625_0020324
630 Ga0495625_0060258
631 Ga0495625_0127290
632 Ga0495635_0009436
633 Ga0495635_0019699
634 Ga0495635_0133895
635 Ga0495588_0009681
636 Ga0495588_0022861
637 Ga0495588_0096289
638 Ga0495657_0008422
639 Ga0495657_0010980
640 Ga0495657_0042172
641 Ga0495657_0068699
642 Ga0495599_0026956
643 Ga0495623_0010150
644 Ga0495623_0038402
645 Ga0495646_0020161
646 Ga0495646_0369959
647 Ga0495613_0006215
648 Ga0495613_0017533
649 Ga0495613_0023325
650 Ga0495613_0034482
651 Ga0495613_0115587
652 Ga0495613_0229292
653 Ga0495613_0270894
654 Ga0495613_0728522
655 Ga0495624_0085879
656 Ga0495670_0002396
657 Ga0495671_0468567
658 Ga0495649_0074934
659 Ga0495649_0078650
660 Ga0495589_0027296
661 Ga0495589_0055324
662 Ga0495589_0331418
663 Ga0495600_0040435
664 Ga0495600_0580988
665 Ga0495660_0007259
666 Ga0495660_0311144
667 Ga0495581_0125706
668 Ga0495581_0254793
669 Ga0495581_0353875
670 Ga0495604_0000132
671 Ga0495604_0019625
672 Ga0495604_0216122
673 Ga0495604_0314931
674 Ga0495636_0003549
675 Ga0495636_0009173
676 Ga0495636_0108976
677 Ga0495636_0312269
678 Ga0495636_0443222
679 Ga0495674_0017771
680 Ga0495674_0544839
681 Ga0495672_0054846
682 Ga0495676_0006189
683 Ga0495676_0013792
684 Ga0495676_0182912
685 Ga0495676_0241438
686 Ga0495680_0018124
687 Ga0495683_0033359
688 Ga0495683_0049836
689 Ga0495683_0072757
690 Ga0495683_0309257
691 Ga0495687_002461
692 Ga0495687_004954
693 Ga0495687_049805
694 Ga0495687_071642
695 Ga0495687_126336
696 Ga0495675_0017718
697 Ga0495675_0482662
698 Ga0495677_0166413
699 Ga0495679_066631
700 Ga0495685_000473
701 Ga0495685_002653
702 Ga0495685_008550
703 Ga0495685_011336
704 Ga0495685_024422
705 Ga0495685_091191
706 Ga0495673_0081127
707 Ga0495681_0002970
708 Ga0495681_0236914
709 Ga0495684_0037002
710 Ga0495684_0324489
711 Ga0495686_0171595
712 Ga0495593_0030608
713 Ga0495593_0040990
714 Ga0495593_0343525
715 Ga0495602_0031786
716 Ga0495614_0000238
717 Ga0495614_0033367
718 Ga0495614_0069373
719 Ga0495626_0113473
720 Ga0495626_0278947
721 Ga0496104_1798606
722 Ga0496106_0072687
723 Ga0496108_0077955
724 Ga0496113_0202709
725 Ga0496114_1130989
726 Ga0496117_0019393
727 Ga0496118_0002259
728 Ga0496118_0003041
729 Ga0496119_0108822
730 Ga0496119_0272446
731 Ga0496122_0081735
732 Ga0496123_0076673
733 Ga0496124_0536560
734 Ga0496125_0006194
735 Ga0496125_0061792
736 Ga0496126_0000929
737 Ga0495682_0008014
738 Ga0501034_0121263
739 Ga0501036_0078282
740 Ga0501037_0952764
741 Ga0501038_0386062
742 Ga0501047_0494546
743 Ga0501070_1375588
744 Ga0501202_056374
745 Ga0501224_027940
746 Ga0501235_019116
747 Ga0501257_076818
748 Ga0501035_0044661
749 Ga0501035_0475575
750 nmdc:mga0yw44_51890_c1
751 nmdc:mga0yw44_598728_c1
752 nmdc:mga0k408_132692_c1
753 nmdc:mga06z11_1811_c1
754 nmdc:mga07m45_2920_c1
755 nmdc:mga07m45_852039_c1
756 Ga0495601_0034373
757 Ga0495619_0368817
758 Ga0500578_0006894
759 Ga0500644_0028367
760 Ga0500566_0057944
761 Ga0500641_0251508
762 Ga0500650_0143552
763 Ga0500654_040478
764 Ga0500553_053719
765 Ga0500560_031373
766 Ga0500569_022877
767 Ga0500580_152276
768 Ga0500594_0002499
769 Ga0500618_005769
770 Ga0500628_002016
771 Ga0500652_012236
772 Ga0500652_195933
773 Ga0500561_0000258
774 Ga0500573_0027054
775 Ga0500573_0139219
776 Ga0500600_0003624
777 Ga0500600_0041112
778 Ga0500622_0171969
779 Ga0500633_0100009
780 Ga0500634_0033984
781 Ga0500636_0434863
782 Ga0500656_002409
783 Ga0500587_000835
784 Ga0466962_0010237
785 2585308156
786 2585319530
787 2599883261
788 2599949157
789 2616696862
790 2643902849
791 2643942057
792 2644074079
793 2644389705
794 2644404641
795 2644429140
796 2644439260
797 2738811506
798 2738898866
799 2739242778
800 2785370711
801 2808843259
802 2808912841
803 2809588945
804 2816472907
805 2862391073
806 2862516219
807 2862578254
808 2863411628
809 2867432509
810 2873154757
811 2877679877
812 2912758138
813 2918505746
814 2919475980
815 2954003055
816 2954715068
817 2954725010
818 2954736808
819 2954743943
820 2954755656
821 2954762884
822 2974324277
823 2990062239
824 3006393692
825 8001789142
826 8008566471
827 8054290623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

44

134

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yyv-assembly1.cif.gz_B putative transcriptional regulator ytfh from salmonella typhimurium 0.9349 27 130
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9042 28 120
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.9015 29 127
7bze-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, k13a mutant 0.8896 28 126
2hzt-assembly1.cif.gz_B crystal structure of a putative hth-type transcriptional regulator ytcd 0.8853 29 123
ID Description Score Start End Superfamily
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.931 37 100 1.10.10.10
1yyvB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9281 27 130 1.10.10.10
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8963 31 101 1.10.10.10
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8909 29 122 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8888 33 102 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7K1VUB1-F1-model_v4 Transcriptional regulator 0.9986 28 136 GO:0003677
AF-A0A401MDW8-F1-model_v4 Redox-sensing transcriptional regulator qorR 0.9976 33 138 GO:0003677
AF-A0A5N8XQ15-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9946 28 139 GO:0003677
AF-A0A1D2IEW3-F1-model_v4 Putative HTH-type transcriptional regulator YybR 0.9939 28 138 GO:0003677
AF-A0A6I7Z036-F1-model_v4 Transcriptional regulator 0.9935 28 138 GO:0003677

Map