F438088

General Info

Members Datasets Scaffolds Average Seq Length
413 256 826 110

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10590269|Ga0207708_105902692
Length 136
Sequence VKQRLCDVNTAAVGKLPQHTDDKSGIGVHYVDAYLKPMNAKLEDGTAVKCKRRGLKIVLTVGARKGEGLMRRLGVGPDPVVMLDAALQDAAKGAGVEVFATYCESHTTDLPFHGAAGLLRSSFKTAAHLPMALMYK

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
157 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
158 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
206 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
207 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
227 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
233 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.78
Nodule 0
Rhizoplane 4.36
Rhizosphere 87.89
Stem 0
Stem Tuber 0
Unclassified 23.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10590269 3300026075 Unclassified 940
2 Ga0065714_10129673 3300005288 Unclassified 1186
3 Ga0065704_10124767 3300005289 Bacteria 1713
4 Ga0065712_10000695 3300005290 Bacteria 9164
5 Ga0065715_10166433 3300005293 Unclassified 1583
6 Ga0065707_10089282 3300005295 Unclassified 4401
7 Ga0065707_11171585 3300005295 Unclassified 500
8 Ga0070658_10294243 3300005327 Bacteria 1384
9 Ga0070676_10295542 3300005328 Bacteria 1096
10 Ga0070676_10515017 3300005328 Bacteria 851
11 Ga0070676_10587181 3300005328 Bacteria 802
12 Ga0070683_100195702 3300005329 Unclassified 1919
13 Ga0070683_100362238 3300005329 Bacteria 1381
14 Ga0070690_100141646 3300005330 Unclassified 1633
15 Ga0070690_100844720 3300005330 Bacteria 713
16 Ga0070670_100001152 3300005331 Bacteria 20970
17 Ga0070670_100097201 3300005331 Bacteria 2533
18 Ga0070677_10485634 3300005333 Bacteria 667
19 Ga0070666_10224606 3300005335 Unclassified 1325
20 Ga0070680_100574387 3300005336 Unclassified 967
21 Ga0070682_100451790 3300005337 Bacteria 984
22 Ga0068868_101377692 3300005338 Unclassified 657
23 Ga0070661_100017610 3300005344 Bacteria 5070
24 Ga0070669_100006384 3300005353 Bacteria 8492
25 Ga0070675_100078210 3300005354 Bacteria 2754
26 Ga0070675_100470465 3300005354 Unclassified 1129
27 Ga0070675_100492857 3300005354 Bacteria 1103
28 Ga0070675_101986787 3300005354 Unclassified 536
29 Ga0070671_100050387 3300005355 Unclassified 3463
30 Ga0070671_101023412 3300005355 Bacteria 724
31 Ga0070674_100470515 3300005356 Bacteria 1041
32 Ga0070673_100653700 3300005364 Unclassified 962
33 Ga0070673_100948692 3300005364 Unclassified 799
34 Ga0070688_100909764 3300005365 Unclassified 694
35 Ga0070659_100061786 3300005366 Unclassified 2961
36 Ga0070667_100610089 3300005367 Bacteria 1006
37 Ga0070667_102123644 3300005367 Bacteria 529
38 Ga0070667_102349776 3300005367 Unclassified 502
39 Ga0070714_102265620 3300005435 Bacteria 528
40 Ga0070714_102404886 3300005435 Unclassified 512
41 Ga0070713_100155159 3300005436 Bacteria 2040
42 Ga0070713_100352451 3300005436 Bacteria 1366
43 Ga0070701_10123067 3300005438 Unclassified 1464
44 Ga0070700_100763434 3300005441 Unclassified 775
45 Ga0070700_101915632 3300005441 Unclassified 513
46 Ga0070678_100460780 3300005456 Unclassified 1115
47 Ga0070678_101399539 3300005456 Bacteria 653
48 Ga0070662_100377794 3300005457 Unclassified 1166
49 Ga0070681_10685727 3300005458 Bacteria 940
50 Ga0068867_102261573 3300005459 Bacteria 516
51 Ga0070685_10243491 3300005466 Unclassified 1188
52 Ga0070679_101717071 3300005530 Bacteria 576
53 Ga0070684_100000515 3300005535 Bacteria 26549
54 Ga0070684_100065451 3300005535 Bacteria 3190
55 Ga0068853_100122405 3300005539 Bacteria 2322
56 Ga0070672_100165169 3300005543 Bacteria 1838
57 Ga0070672_100200867 3300005543 Bacteria 1667
58 Ga0070672_100325697 3300005543 Unclassified 1307
59 Ga0070672_100351975 3300005543 Bacteria 1256
60 Ga0070686_101300983 3300005544 Unclassified 607
61 Ga0070696_101074458 3300005546 Unclassified 675
62 Ga0070693_100069489 3300005547 Bacteria 2070
63 Ga0070704_100278986 3300005549 Bacteria 1383
64 Ga0070664_100001660 3300005564 Bacteria 17800
65 Ga0070664_100818542 3300005564 Unclassified 871
66 Ga0070702_100814936 3300005615 Unclassified 723
67 Ga0068852_100289832 3300005616 Bacteria 1581
68 Ga0068852_101151771 3300005616 Unclassified 796
69 Ga0068864_100223228 3300005618 Bacteria 1739
70 Ga0068863_100189063 3300005841 Bacteria 1979
71 Ga0068863_100728231 3300005841 Bacteria 987
72 Ga0068863_101597261 3300005841 Unclassified 661
73 Ga0068862_100008592 3300005844 Bacteria 8450
74 Ga0081455_10259569 3300005937 Bacteria 1266
75 Ga0070717_10548081 3300006028 Bacteria 1047
76 Ga0075365_10033953 3300006038 Bacteria 3292
77 Ga0075368_10028700 3300006042 Bacteria 2151
78 Ga0075368_10049483 3300006042 Bacteria 1667
79 Ga0075363_100145934 3300006048 Bacteria 1334
80 Ga0075364_10003809 3300006051 Bacteria 8631
81 Ga0075364_10017756 3300006051 Bacteria 4448
82 Ga0075364_10172171 3300006051 Bacteria 1464
83 Ga0070712_100033781 3300006175 Unclassified 3463
84 Ga0075362_10000187 3300006177 Bacteria 17095
85 Ga0075367_10011588 3300006178 Bacteria 4673
86 Ga0075367_10015429 3300006178 Bacteria 4152
87 Ga0075366_10008028 3300006195 Bacteria 5848
88 Ga0075366_10080219 3300006195 Bacteria 1948
89 Ga0075370_10056890 3300006353 Bacteria 2223
90 Ga0075370_10626790 3300006353 Bacteria 652
91 Ga0068871_100990277 3300006358 Unclassified 782
92 Ga0075428_100030634 3300006844 Bacteria 5948
93 Ga0075428_100043440 3300006844 Bacteria 4940
94 Ga0075428_100443019 3300006844 Bacteria 1391
95 Ga0075428_100849106 3300006844 Bacteria 969
96 Ga0075430_100167233 3300006846 Bacteria 1830
97 Ga0075430_100422010 3300006846 Bacteria 1101
98 Ga0075430_100816032 3300006846 Bacteria 769
99 Ga0075430_101244077 3300006846 Bacteria 613
100 Ga0075431_100307377 3300006847 Bacteria 1601
101 Ga0075433_10074536 3300006852 Bacteria 2986
102 Ga0075433_10946237 3300006852 Bacteria 751
103 Ga0075434_100129399 3300006871 Bacteria 2543
104 Ga0075434_100226568 3300006871 Unclassified 1889
105 Ga0075429_100023343 3300006880 Bacteria 5367
106 Ga0075429_100060207 3300006880 Bacteria 3308
107 Ga0075429_100187676 3300006880 Bacteria 1811
108 Ga0075429_101012933 3300006880 Bacteria 726
109 Ga0068865_101694560 3300006881 Bacteria 570
110 Ga0105240_10119176 3300009093 Bacteria 3180
111 Ga0105240_10806322 3300009093 Bacteria 1017
112 Ga0111539_10000982 3300009094 Bacteria 37391
113 Ga0111539_10002888 3300009094 Bacteria 22812
114 Ga0111539_10112149 3300009094 Bacteria 3199
115 Ga0111539_10602482 3300009094 Bacteria 1279
116 Ga0111539_11192593 3300009094 Unclassified 884
117 Ga0111539_11389361 3300009094 Bacteria 814
118 Ga0111539_12951868 3300009094 Bacteria 550
119 Ga0105245_12931871 3300009098 Unclassified 529
120 Ga0114129_10001828 3300009147 Bacteria 28970
121 Ga0114129_10028915 3300009147 Bacteria 7852
122 Ga0114129_10063962 3300009147 Bacteria 5134
123 Ga0105241_10598823 3300009174 Unclassified 995
124 Ga0105248_10025228 3300009177 Bacteria 6609
125 Ga0105249_10001093 3300009553 Bacteria 24114
126 Ga0105239_10018495 3300010375 Bacteria 7696
127 Ga0105239_11096309 3300010375 Unclassified 916
128 Ga0105239_12093169 3300010375 Bacteria 657
129 Ga0105246_11602941 3300011119 Bacteria 615
130 Ga0157369_10236118 3300013105 Bacteria 1910
131 Ga0157369_10360505 3300013105 Bacteria 1509
132 Ga0157369_10465065 3300013105 Unclassified 1309
133 Ga0157369_10731631 3300013105 Bacteria 1018
134 Ga0157369_11370659 3300013105 Bacteria 720
135 Ga0157369_11745522 3300013105 Unclassified 632
136 Ga0157369_12144915 3300013105 Bacteria 567
137 Ga0157374_10103215 3300013296 Unclassified 2736
138 Ga0157374_10485112 3300013296 Bacteria 1239
139 Ga0157378_11761648 3300013297 Unclassified 667
140 Ga0163162_10148635 3300013306 Bacteria 2460
141 Ga0163162_10476561 3300013306 Unclassified 1379
142 Ga0163162_10982081 3300013306 Bacteria 954
143 Ga0163162_12627950 3300013306 Unclassified 579
144 Ga0163162_13372096 3300013306 Bacteria 510
145 Ga0157372_10277281 3300013307 Bacteria 1949
146 Ga0157372_10295271 3300013307 Bacteria 1885
147 Ga0157372_11421450 3300013307 Bacteria 800
148 Ga0157375_10409777 3300013308 Unclassified 1522
149 Ga0157375_13703097 3300013308 Bacteria 508
150 Ga0163163_10005247 3300014325 Bacteria 11173
151 Ga0163163_10884190 3300014325 Unclassified 957
152 Ga0163163_11461771 3300014325 Bacteria 745
153 Ga0157380_10643106 3300014326 Bacteria 1057
154 Ga0157377_10041761 3300014745 Bacteria 2545
155 Ga0157377_10263953 3300014745 Unclassified 1121
156 Ga0157376_10464387 3300014969 Unclassified 1237
157 Ga0157376_10510393 3300014969 Bacteria 1183
158 Ga0157376_11324462 3300014969 Unclassified 750
159 Ga0163161_10877409 3300017792 Unclassified 759
160 Ga0207697_10116167 3300025315 Unclassified 1149
161 Ga0207680_10891704 3300025903 Unclassified 637
162 Ga0207645_10317039 3300025907 Bacteria 1040
163 Ga0207705_11276521 3300025909 Bacteria 561
164 Ga0207707_10521421 3300025912 Bacteria 1012
165 Ga0207695_10606888 3300025913 Bacteria 975
166 Ga0207693_10038621 3300025915 Unclassified 3758
167 Ga0207663_10335688 3300025916 Bacteria 1140
168 Ga0207649_10229036 3300025920 Bacteria 1328
169 Ga0207649_10305655 3300025920 Unclassified 1164
170 Ga0207652_10710463 3300025921 Unclassified 896
171 Ga0207681_10007893 3300025923 Bacteria 6508
172 Ga0207650_10014056 3300025925 Bacteria 5558
173 Ga0207650_10228354 3300025925 Bacteria 1500
174 Ga0207659_10056359 3300025926 Bacteria 2815
175 Ga0207659_10110775 3300025926 Bacteria 2087
176 Ga0207664_10795329 3300025929 Unclassified 851
177 Ga0207644_10072079 3300025931 Unclassified 2529
178 Ga0207690_10376729 3300025932 Unclassified 1127
179 Ga0207706_10159204 3300025933 Unclassified 1985
180 Ga0207669_10327588 3300025937 Bacteria 1175
181 Ga0207704_10262080 3300025938 Bacteria 1304
182 Ga0207691_10008318 3300025940 Bacteria 9965
183 Ga0207691_10554653 3300025940 Unclassified 974
184 Ga0207691_10853282 3300025940 Bacteria 764
185 Ga0207691_11143147 3300025940 Unclassified 647
186 Ga0207711_10107493 3300025941 Unclassified 2477
187 Ga0207661_10048584 3300025944 Unclassified 3373
188 Ga0207661_10262249 3300025944 Bacteria 1539
189 Ga0207679_10005441 3300025945 Bacteria 7978
190 Ga0207679_11054623 3300025945 Unclassified 745
191 Ga0207667_10148884 3300025949 Bacteria 2410
192 Ga0207651_10334693 3300025960 Unclassified 1270
193 Ga0207651_11480346 3300025960 Bacteria 611
194 Ga0207712_10399551 3300025961 Unclassified 1155
195 Ga0207640_10860316 3300025981 Bacteria 789
196 Ga0207658_10239622 3300025986 Unclassified 1536
197 Ga0207658_10949046 3300025986 Bacteria 784
198 Ga0207658_11300293 3300025986 Bacteria 665
199 Ga0207639_10067039 3300026041 Bacteria 2792
200 Ga0207641_10089856 3300026088 Unclassified 2685
201 Ga0207675_100173432 3300026118 Bacteria 2062
202 Ga0207683_10223116 3300026121 Unclassified 1717
203 Ga0207683_10346436 3300026121 Unclassified 1363
204 Ga0207683_10519711 3300026121 Unclassified 1100
205 Ga0207698_10298768 3300026142 Bacteria 1498
206 Ga0209813_10013067 3300027866 Bacteria 2209
207 Ga0207428_10005592 3300027907 Bacteria 11691
208 Ga0207428_10008483 3300027907 Bacteria 9279
209 Ga0268265_10169954 3300028380 Bacteria 1862
210 Ga0265338_10009163 3300028800 Bacteria 11875
211 Ga0265338_10569413 3300028800 Bacteria 791
212 Ga0265330_10000643 3300031235 Bacteria 22456
213 Ga0265332_10080148 3300031238 Bacteria 1385
214 Ga0265328_10053096 3300031239 Unclassified 1487
215 Ga0265325_10000415 3300031241 Bacteria 30438
216 Ga0265325_10033109 3300031241 Bacteria 2756
217 Ga0265339_10000170 3300031249 Bacteria 55127
218 Ga0265339_10015984 3300031249 Unclassified 4485
219 Ga0265339_10017603 3300031249 Bacteria 4228
220 Ga0265331_10056865 3300031250 Bacteria 1856
221 Ga0265316_10002978 3300031344 Bacteria 17317
222 Ga0265316_10039895 3300031344 Unclassified 3767
223 Ga0265316_10297383 3300031344 Bacteria 1176
224 Ga0307408_100022969 3300031548 Bacteria 4245
225 Ga0307408_100023019 3300031548 Bacteria 4240
226 Ga0307408_100053690 3300031548 Bacteria 2911
227 Ga0265313_10001128 3300031595 Bacteria 25524
228 Ga0265313_10044651 3300031595 Unclassified 2162
229 Ga0265314_10191945 3300031711 Bacteria 1214
230 Ga0265314_10191947 3300031711 Bacteria 1214
231 Ga0265342_10000156 3300031712 Bacteria 77615
232 Ga0265342_10044700 3300031712 Bacteria 2669
233 Ga0307405_10029042 3300031731 Bacteria 3228
234 Ga0307405_10222029 3300031731 Bacteria 1387
235 Ga0307406_10030635 3300031901 Bacteria 3268
236 Ga0307412_10709487 3300031911 Bacteria 864
237 Ga0307409_100021414 3300031995 Bacteria 4432
238 Ga0307409_100071049 3300031995 Bacteria 2766
239 Ga0307409_100094492 3300031995 Bacteria 2460
240 Ga0307409_100769986 3300031995 Unclassified 968
241 Ga0307409_101940543 3300031995 Bacteria 618
242 Ga0307416_100011337 3300032002 Bacteria 5936
243 Ga0307416_102988513 3300032002 Bacteria 566
244 Ga0307411_10097259 3300032005 Bacteria 2071
245 Ga0307411_10204789 3300032005 Bacteria 1518
246 Ga0307415_100020737 3300032126 Bacteria 4020
247 Ga0307415_100498811 3300032126 Bacteria 1064
248 Ga0307415_100663868 3300032126 Bacteria 936
249 Ga0373954_0243808 3300035118 Bacteria 884
250 Ga0373935_1142770 3300035692 Unclassified 580
251 Ga0373937_1258168 3300036401 Bacteria 688
252 Ga0373937_1432998 3300036401 Bacteria 638
253 Ga0395899_0052092 3300037312 Bacteria 3035
254 Ga0395900_0054276 3300037418 Bacteria 4126
255 Ga0395900_0325846 3300037418 Bacteria 1515
256 Ga0395898_0073054 3300037466 Bacteria 3313
257 Ga0395898_0792897 3300037466 Bacteria 888
258 Ga0395905_0070688 3300037471 Bacteria 3271
259 Ga0395901_0138840 3300038443 Bacteria 2554
260 Ga0395901_0184532 3300038443 Bacteria 2188
261 Ga0436365_0420638 3300039437 Bacteria 7618
262 Ga0436365_1640477 3300039437 Bacteria 833
263 Ga0439461_0150954 3300041410 Bacteria 600
264 Ga0451843_1040870 3300041509 Bacteria 693
265 Ga0451853_3356063 3300041512 Unclassified 749
266 Ga0439431_0217700 3300041997 Bacteria 560
267 Ga0439433_0124142 3300041999 Unclassified 652
268 Ga0439437_013571 3300042000 Bacteria 947
269 Ga0439450_001496 3300042008 Bacteria 3438
270 Ga0439435_0264910 3300042436 Bacteria 582
271 Ga0439464_0020170 3300042439 Bacteria 1824
272 Ga0453684_0285428 3300044712 Bacteria 1881
273 Ga0495592_0058877 3300046454 Bacteria 2831
274 Ga0495629_0344879 3300046459 Bacteria 1016
275 Ga0495651_0243393 3300046462 Bacteria 1232
276 Ga0495653_0264125 3300046463 Bacteria 1136
277 Ga0495580_0665930 3300046472 Bacteria 683
278 Ga0495662_0011804 3300046476 Bacteria 4268
279 Ga0495664_0002333 3300046477 Bacteria 10171
280 Ga0495594_0278212 3300046499 Unclassified 954
281 Ga0495608_0129124 3300046511 Bacteria 1618
282 Ga0495628_0018823 3300046516 Bacteria 5715
283 Ga0495630_0157695 3300046517 Bacteria 1727
284 Ga0495652_0320114 3300046529 Bacteria 1121
285 Ga0495652_0481646 3300046529 Bacteria 863
286 Ga0495665_0285487 3300046531 Bacteria 846
287 Ga0495640_0098161 3300046533 Bacteria 1925
288 Ga0495587_0067861 3300046536 Bacteria 2078
289 Ga0495645_0003087 3300046543 Bacteria 11280
290 Ga0495667_0033830 3300046559 Bacteria 3419
291 Ga0495634_0065881 3300046642 Bacteria 2399
292 Ga0495634_0598338 3300046642 Bacteria 640
293 Ga0495635_0111956 3300046663 Unclassified 1864
294 Ga0495657_0366638 3300046675 Bacteria 851
295 Ga0495623_0147793 3300046679 Bacteria 1392
296 Ga0495646_0014048 3300046680 Bacteria 5091
297 Ga0495613_0193781 3300046689 Unclassified 1435
298 Ga0495600_0382039 3300046809 Bacteria 878
299 Ga0495604_0096950 3300047317 Bacteria 2175
300 Ga0495674_0188420 3300047319 Bacteria 1715
301 Ga0495674_0229099 3300047319 Bacteria 1534
302 Ga0495674_0298223 3300047319 Bacteria 1317
303 Ga0495680_0055389 3300047322 Bacteria 3076
304 Ga0495675_0042567 3300047444 Bacteria 2893
305 Ga0495684_0020136 3300047471 Bacteria 5137
306 Ga0495684_0252761 3300047471 Bacteria 1282
307 Ga0495602_0095491 3300048088 Bacteria 2454
308 Ga0496101_0091056 3300048904 Bacteria 2269
309 Ga0496102_0069361 3300048905 Bacteria 3236
310 Ga0496102_0349527 3300048905 Unclassified 1392
311 Ga0496103_0108586 3300048906 Bacteria 1761
312 Ga0496104_0004106 3300048907 Bacteria 12639
313 Ga0496105_0067952 3300048908 Unclassified 2943
314 Ga0496105_0496849 3300048908 Bacteria 958
315 Ga0496106_0346528 3300048909 Bacteria 1193
316 Ga0496107_0248250 3300048910 Bacteria 1324
317 Ga0496108_0069008 3300048911 Unclassified 2982
318 Ga0496108_0180271 3300048911 Bacteria 1829
319 Ga0496109_0003511 3300048912 Bacteria 13099
320 Ga0496109_0379316 3300048912 Bacteria 1336
321 Ga0496110_0012863 3300048913 Bacteria 6897
322 Ga0496111_0252751 3300048914 Unclassified 1308
323 Ga0496112_0036308 3300048915 Bacteria 4807
324 Ga0496112_0476140 3300048915 Bacteria 1185
325 Ga0496113_0156854 3300048916 Unclassified 1798
326 Ga0501291_018052 3300049514 Bacteria 1093
327 Ga0501291_034813 3300049514 Bacteria 864
328 Ga0501291_070739 3300049514 Bacteria 675
329 Ga0501299_011535 3300049522 Unclassified 1494
330 Ga0501299_046370 3300049522 Bacteria 887
331 Ga0501301_007974 3300049524 Bacteria 826
332 Ga0501031_0034531 3300049568 Bacteria 3301
333 Ga0501034_0016694 3300049571 Bacteria 7527
334 Ga0501036_0041985 3300049572 Bacteria 3872
335 Ga0501036_0074907 3300049572 Bacteria 2863
336 Ga0501038_0228395 3300049574 Bacteria 1482
337 Ga0501039_0043952 3300049575 Bacteria 3451
338 Ga0501040_0127301 3300049576 Bacteria 1789
339 Ga0501041_0091208 3300049577 Bacteria 1881
340 Ga0501041_0802036 3300049577 Bacteria 604
341 Ga0501042_0473572 3300049578 Bacteria 909
342 Ga0501043_0626743 3300049579 Bacteria 792
343 Ga0501048_0133854 3300049582 Bacteria 1751
344 Ga0501068_0125288 3300049584 Bacteria 1604
345 Ga0501069_0357398 3300049585 Bacteria 861
346 Ga0501071_0002866 3300049587 Bacteria 10632
347 Ga0501071_0321967 3300049587 Bacteria 1174
348 Ga0501071_0546175 3300049587 Unclassified 890
349 Ga0501072_0011868 3300049588 Bacteria 6655
350 Ga0501072_0161660 3300049588 Bacteria 1786
351 Ga0501073_0106896 3300049589 Bacteria 1942
352 Ga0501075_0033202 3300049591 Bacteria 3839
353 Ga0501076_0021485 3300049592 Bacteria 4952
354 Ga0501076_0038318 3300049592 Bacteria 3763
355 Ga0501077_0362980 3300049593 Bacteria 925
356 Ga0501202_055827 3300049652 Bacteria 883
357 Ga0501202_117318 3300049652 Bacteria 665
358 Ga0501217_028829 3300049661 Bacteria 1354
359 Ga0501079_0509997 3300049741 Unclassified 946
360 Ga0501080_0337751 3300049742 Bacteria 1362
361 Ga0501080_0804965 3300049742 Bacteria 824
362 Ga0501081_0505494 3300049743 Bacteria 901
363 Ga0501083_0661479 3300049744 Bacteria 679
364 Ga0501281_10286 3300049777 Unclassified 661
365 Ga0501283_017831 3300049779 Unclassified 1113
366 nmdc:mga03683_21613_c1 3300050489 Bacteria 2484
367 nmdc:mga03n38_182074_c1 3300050490 Bacteria 1077
368 nmdc:mga00v17_137950_c1 3300050491 Bacteria 1562
369 nmdc:mga00v17_3548_c1 3300050491 Bacteria 8060
370 nmdc:mga00v17_7122_c1 3300050491 Bacteria 5959
371 nmdc:mga0yw44_162546_c1 3300050492 Bacteria 1462
372 nmdc:mga0yw44_27979_c1 3300050492 Bacteria 2173
373 nmdc:mga0k408_16251_c1 3300050493 Bacteria 4127
374 nmdc:mga0k408_206141_c1 3300050493 Bacteria 1174
375 nmdc:mga06z11_716480_c1 3300050494 Bacteria 610
376 nmdc:mga04h51_15896_c1 3300050495 Bacteria 2176
377 nmdc:mga04h51_234222_c1 3300050495 Bacteria 731
378 nmdc:mga07m45_135957_c1 3300050496 Bacteria 1423
379 nmdc:mga05p37_426_c1 3300050507 Bacteria 45626
380 nmdc:mga05p37_5661_c1 3300050507 Bacteria 14692
381 nmdc:mga05p37_6042_c1 3300050507 Bacteria 14252
382 nmdc:mga09592_26286_c2 3300050508 Bacteria 3663
383 nmdc:mga09592_29301_c1 3300050508 Bacteria 4578
384 nmdc:mga09592_59165_c1 3300050508 Bacteria 3239
385 nmdc:mga09592_649215_c1 3300050508 Unclassified 901
386 nmdc:mga09592_928482_c1 3300050508 Bacteria 730
387 nmdc:mga09592_989606_c1 3300050508 Bacteria 703
388 nmdc:mga0qj67_19480_c1 3300050509 Bacteria 5184
389 nmdc:mga0qj67_40656_c1 3300050509 Unclassified 3654
390 nmdc:mga0qj67_4737_c1 3300050509 Bacteria 9882
391 nmdc:mga06r32_1922101_c1 3300050510 Unclassified 526
392 nmdc:mga06r32_33342_c1 3300050510 Bacteria 4850
393 nmdc:mga06r32_76759_c1 3300050510 Bacteria 3245
394 nmdc:mga08y16_1220064_c1 3300050511 Bacteria 722
395 nmdc:mga08y16_12962_c1 3300050511 Bacteria 8773
396 nmdc:mga08y16_448933_c1 3300050511 Bacteria 1315
397 nmdc:mga08y16_488880_c1 3300050511 Bacteria 1252
398 nmdc:mga08y16_6847_c1 3300050511 Bacteria 11950
399 nmdc:mga08y16_795665_c1 3300050511 Bacteria 939
400 nmdc:mga0n895_224401_c1 3300050512 Unclassified 1907
401 nmdc:mga0n895_252900_c1 3300050512 Bacteria 1788
402 nmdc:mga0rr50_433059_c1 3300050513 Bacteria 1113
403 nmdc:mga0a205_676263_c1 3300050515 Bacteria 883
404 nmdc:mga0a205_91648_c1 3300050515 Bacteria 2937
405 nmdc:mga0a205_960796_c1 3300050515 Unclassified 701
406 Ga0495601_0966514 3300053077 Bacteria 536
407 Ga0495595_0664125 3300053084 Bacteria 534
408 Ga0495619_0074122 3300053085 Bacteria 2282
409 Ga0501084_0050688 3300054114 Bacteria 3473
410 Ga0590071_052466 3300059421 Bacteria 990
411 Ga0590071_153067 3300059421 Bacteria 598
412 Ga0501082_1711451 3300060353 Bacteria 549
413 Ga0530510_0424307 3300061734 Unclassified 1004
414 Ga0207708_10590269
415 Ga0065714_10129673
416 Ga0065704_10124767
417 Ga0065712_10000695
418 Ga0065715_10166433
419 Ga0065707_10089282
420 Ga0065707_11171585
421 Ga0070658_10294243
422 Ga0070676_10295542
423 Ga0070676_10515017
424 Ga0070676_10587181
425 Ga0070683_100195702
426 Ga0070683_100362238
427 Ga0070690_100141646
428 Ga0070690_100844720
429 Ga0070670_100001152
430 Ga0070670_100097201
431 Ga0070677_10485634
432 Ga0070666_10224606
433 Ga0070680_100574387
434 Ga0070682_100451790
435 Ga0068868_101377692
436 Ga0070661_100017610
437 Ga0070669_100006384
438 Ga0070675_100078210
439 Ga0070675_100470465
440 Ga0070675_100492857
441 Ga0070675_101986787
442 Ga0070671_100050387
443 Ga0070671_101023412
444 Ga0070674_100470515
445 Ga0070673_100653700
446 Ga0070673_100948692
447 Ga0070688_100909764
448 Ga0070659_100061786
449 Ga0070667_100610089
450 Ga0070667_102123644
451 Ga0070667_102349776
452 Ga0070714_102265620
453 Ga0070714_102404886
454 Ga0070713_100155159
455 Ga0070713_100352451
456 Ga0070701_10123067
457 Ga0070700_100763434
458 Ga0070700_101915632
459 Ga0070678_100460780
460 Ga0070678_101399539
461 Ga0070662_100377794
462 Ga0070681_10685727
463 Ga0068867_102261573
464 Ga0070685_10243491
465 Ga0070679_101717071
466 Ga0070684_100000515
467 Ga0070684_100065451
468 Ga0068853_100122405
469 Ga0070672_100165169
470 Ga0070672_100200867
471 Ga0070672_100325697
472 Ga0070672_100351975
473 Ga0070686_101300983
474 Ga0070696_101074458
475 Ga0070693_100069489
476 Ga0070704_100278986
477 Ga0070664_100001660
478 Ga0070664_100818542
479 Ga0070702_100814936
480 Ga0068852_100289832
481 Ga0068852_101151771
482 Ga0068864_100223228
483 Ga0068863_100189063
484 Ga0068863_100728231
485 Ga0068863_101597261
486 Ga0068862_100008592
487 Ga0081455_10259569
488 Ga0070717_10548081
489 Ga0075365_10033953
490 Ga0075368_10028700
491 Ga0075368_10049483
492 Ga0075363_100145934
493 Ga0075364_10003809
494 Ga0075364_10017756
495 Ga0075364_10172171
496 Ga0070712_100033781
497 Ga0075362_10000187
498 Ga0075367_10011588
499 Ga0075367_10015429
500 Ga0075366_10008028
501 Ga0075366_10080219
502 Ga0075370_10056890
503 Ga0075370_10626790
504 Ga0068871_100990277
505 Ga0075428_100030634
506 Ga0075428_100043440
507 Ga0075428_100443019
508 Ga0075428_100849106
509 Ga0075430_100167233
510 Ga0075430_100422010
511 Ga0075430_100816032
512 Ga0075430_101244077
513 Ga0075431_100307377
514 Ga0075433_10074536
515 Ga0075433_10946237
516 Ga0075434_100129399
517 Ga0075434_100226568
518 Ga0075429_100023343
519 Ga0075429_100060207
520 Ga0075429_100187676
521 Ga0075429_101012933
522 Ga0068865_101694560
523 Ga0105240_10119176
524 Ga0105240_10806322
525 Ga0111539_10000982
526 Ga0111539_10002888
527 Ga0111539_10112149
528 Ga0111539_10602482
529 Ga0111539_11192593
530 Ga0111539_11389361
531 Ga0111539_12951868
532 Ga0105245_12931871
533 Ga0114129_10001828
534 Ga0114129_10028915
535 Ga0114129_10063962
536 Ga0105241_10598823
537 Ga0105248_10025228
538 Ga0105249_10001093
539 Ga0105239_10018495
540 Ga0105239_11096309
541 Ga0105239_12093169
542 Ga0105246_11602941
543 Ga0157369_10236118
544 Ga0157369_10360505
545 Ga0157369_10465065
546 Ga0157369_10731631
547 Ga0157369_11370659
548 Ga0157369_11745522
549 Ga0157369_12144915
550 Ga0157374_10103215
551 Ga0157374_10485112
552 Ga0157378_11761648
553 Ga0163162_10148635
554 Ga0163162_10476561
555 Ga0163162_10982081
556 Ga0163162_12627950
557 Ga0163162_13372096
558 Ga0157372_10277281
559 Ga0157372_10295271
560 Ga0157372_11421450
561 Ga0157375_10409777
562 Ga0157375_13703097
563 Ga0163163_10005247
564 Ga0163163_10884190
565 Ga0163163_11461771
566 Ga0157380_10643106
567 Ga0157377_10041761
568 Ga0157377_10263953
569 Ga0157376_10464387
570 Ga0157376_10510393
571 Ga0157376_11324462
572 Ga0163161_10877409
573 Ga0207697_10116167
574 Ga0207680_10891704
575 Ga0207645_10317039
576 Ga0207705_11276521
577 Ga0207707_10521421
578 Ga0207695_10606888
579 Ga0207693_10038621
580 Ga0207663_10335688
581 Ga0207649_10229036
582 Ga0207649_10305655
583 Ga0207652_10710463
584 Ga0207681_10007893
585 Ga0207650_10014056
586 Ga0207650_10228354
587 Ga0207659_10056359
588 Ga0207659_10110775
589 Ga0207664_10795329
590 Ga0207644_10072079
591 Ga0207690_10376729
592 Ga0207706_10159204
593 Ga0207669_10327588
594 Ga0207704_10262080
595 Ga0207691_10008318
596 Ga0207691_10554653
597 Ga0207691_10853282
598 Ga0207691_11143147
599 Ga0207711_10107493
600 Ga0207661_10048584
601 Ga0207661_10262249
602 Ga0207679_10005441
603 Ga0207679_11054623
604 Ga0207667_10148884
605 Ga0207651_10334693
606 Ga0207651_11480346
607 Ga0207712_10399551
608 Ga0207640_10860316
609 Ga0207658_10239622
610 Ga0207658_10949046
611 Ga0207658_11300293
612 Ga0207639_10067039
613 Ga0207641_10089856
614 Ga0207675_100173432
615 Ga0207683_10223116
616 Ga0207683_10346436
617 Ga0207683_10519711
618 Ga0207698_10298768
619 Ga0209813_10013067
620 Ga0207428_10005592
621 Ga0207428_10008483
622 Ga0268265_10169954
623 Ga0265338_10009163
624 Ga0265338_10569413
625 Ga0265330_10000643
626 Ga0265332_10080148
627 Ga0265328_10053096
628 Ga0265325_10000415
629 Ga0265325_10033109
630 Ga0265339_10000170
631 Ga0265339_10015984
632 Ga0265339_10017603
633 Ga0265331_10056865
634 Ga0265316_10002978
635 Ga0265316_10039895
636 Ga0265316_10297383
637 Ga0307408_100022969
638 Ga0307408_100023019
639 Ga0307408_100053690
640 Ga0265313_10001128
641 Ga0265313_10044651
642 Ga0265314_10191945
643 Ga0265314_10191947
644 Ga0265342_10000156
645 Ga0265342_10044700
646 Ga0307405_10029042
647 Ga0307405_10222029
648 Ga0307406_10030635
649 Ga0307412_10709487
650 Ga0307409_100021414
651 Ga0307409_100071049
652 Ga0307409_100094492
653 Ga0307409_100769986
654 Ga0307409_101940543
655 Ga0307416_100011337
656 Ga0307416_102988513
657 Ga0307411_10097259
658 Ga0307411_10204789
659 Ga0307415_100020737
660 Ga0307415_100498811
661 Ga0307415_100663868
662 Ga0373954_0243808
663 Ga0373935_1142770
664 Ga0373937_1258168
665 Ga0373937_1432998
666 Ga0395899_0052092
667 Ga0395900_0054276
668 Ga0395900_0325846
669 Ga0395898_0073054
670 Ga0395898_0792897
671 Ga0395905_0070688
672 Ga0395901_0138840
673 Ga0395901_0184532
674 Ga0436365_0420638
675 Ga0436365_1640477
676 Ga0439461_0150954
677 Ga0451843_1040870
678 Ga0451853_3356063
679 Ga0439431_0217700
680 Ga0439433_0124142
681 Ga0439437_013571
682 Ga0439450_001496
683 Ga0439435_0264910
684 Ga0439464_0020170
685 Ga0453684_0285428
686 Ga0495592_0058877
687 Ga0495629_0344879
688 Ga0495651_0243393
689 Ga0495653_0264125
690 Ga0495580_0665930
691 Ga0495662_0011804
692 Ga0495664_0002333
693 Ga0495594_0278212
694 Ga0495608_0129124
695 Ga0495628_0018823
696 Ga0495630_0157695
697 Ga0495652_0320114
698 Ga0495652_0481646
699 Ga0495665_0285487
700 Ga0495640_0098161
701 Ga0495587_0067861
702 Ga0495645_0003087
703 Ga0495667_0033830
704 Ga0495634_0065881
705 Ga0495634_0598338
706 Ga0495635_0111956
707 Ga0495657_0366638
708 Ga0495623_0147793
709 Ga0495646_0014048
710 Ga0495613_0193781
711 Ga0495600_0382039
712 Ga0495604_0096950
713 Ga0495674_0188420
714 Ga0495674_0229099
715 Ga0495674_0298223
716 Ga0495680_0055389
717 Ga0495675_0042567
718 Ga0495684_0020136
719 Ga0495684_0252761
720 Ga0495602_0095491
721 Ga0496101_0091056
722 Ga0496102_0069361
723 Ga0496102_0349527
724 Ga0496103_0108586
725 Ga0496104_0004106
726 Ga0496105_0067952
727 Ga0496105_0496849
728 Ga0496106_0346528
729 Ga0496107_0248250
730 Ga0496108_0069008
731 Ga0496108_0180271
732 Ga0496109_0003511
733 Ga0496109_0379316
734 Ga0496110_0012863
735 Ga0496111_0252751
736 Ga0496112_0036308
737 Ga0496112_0476140
738 Ga0496113_0156854
739 Ga0501291_018052
740 Ga0501291_034813
741 Ga0501291_070739
742 Ga0501299_011535
743 Ga0501299_046370
744 Ga0501301_007974
745 Ga0501031_0034531
746 Ga0501034_0016694
747 Ga0501036_0041985
748 Ga0501036_0074907
749 Ga0501038_0228395
750 Ga0501039_0043952
751 Ga0501040_0127301
752 Ga0501041_0091208
753 Ga0501041_0802036
754 Ga0501042_0473572
755 Ga0501043_0626743
756 Ga0501048_0133854
757 Ga0501068_0125288
758 Ga0501069_0357398
759 Ga0501071_0002866
760 Ga0501071_0321967
761 Ga0501071_0546175
762 Ga0501072_0011868
763 Ga0501072_0161660
764 Ga0501073_0106896
765 Ga0501075_0033202
766 Ga0501076_0021485
767 Ga0501076_0038318
768 Ga0501077_0362980
769 Ga0501202_055827
770 Ga0501202_117318
771 Ga0501217_028829
772 Ga0501079_0509997
773 Ga0501080_0337751
774 Ga0501080_0804965
775 Ga0501081_0505494
776 Ga0501083_0661479
777 Ga0501281_10286
778 Ga0501283_017831
779 nmdc:mga03683_21613_c1
780 nmdc:mga03n38_182074_c1
781 nmdc:mga00v17_137950_c1
782 nmdc:mga00v17_3548_c1
783 nmdc:mga00v17_7122_c1
784 nmdc:mga0yw44_162546_c1
785 nmdc:mga0yw44_27979_c1
786 nmdc:mga0k408_16251_c1
787 nmdc:mga0k408_206141_c1
788 nmdc:mga06z11_716480_c1
789 nmdc:mga04h51_15896_c1
790 nmdc:mga04h51_234222_c1
791 nmdc:mga07m45_135957_c1
792 nmdc:mga05p37_426_c1
793 nmdc:mga05p37_5661_c1
794 nmdc:mga05p37_6042_c1
795 nmdc:mga09592_26286_c2
796 nmdc:mga09592_29301_c1
797 nmdc:mga09592_59165_c1
798 nmdc:mga09592_649215_c1
799 nmdc:mga09592_928482_c1
800 nmdc:mga09592_989606_c1
801 nmdc:mga0qj67_19480_c1
802 nmdc:mga0qj67_40656_c1
803 nmdc:mga0qj67_4737_c1
804 nmdc:mga06r32_1922101_c1
805 nmdc:mga06r32_33342_c1
806 nmdc:mga06r32_76759_c1
807 nmdc:mga08y16_1220064_c1
808 nmdc:mga08y16_12962_c1
809 nmdc:mga08y16_448933_c1
810 nmdc:mga08y16_488880_c1
811 nmdc:mga08y16_6847_c1
812 nmdc:mga08y16_795665_c1
813 nmdc:mga0n895_224401_c1
814 nmdc:mga0n895_252900_c1
815 nmdc:mga0rr50_433059_c1
816 nmdc:mga0a205_676263_c1
817 nmdc:mga0a205_91648_c1
818 nmdc:mga0a205_960796_c1
819 Ga0495601_0966514
820 Ga0495595_0664125
821 Ga0495619_0074122
822 Ga0501084_0050688
823 Ga0590071_052466
824 Ga0590071_153067
825 Ga0501082_1711451
826 Ga0530510_0424307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r6w-assembly1.cif.gz_A-2 crystal structure of the k133r mutant of o-succinylbenzoate synthase (osbs) from escherichia coli. complex with shchc 0.9045 56 70
4tr8-assembly1.cif.gz_B crystal structure of dna polymerase sliding clamp from pseudomonas aeruginosa 0.7828 45 67
6irw-assembly1.cif.gz_A crystal structure of the human cap-specific adenosine methyltransferase bound to sah 0.774 48 69
6fvl-assembly1.cif.gz_B dna polymerase sliding clamp from escherichia coli with bound p7 peptide 0.76 45 67
6fvm-assembly1.cif.gz_B mutant dna polymerase sliding clamp from escherichia coli with bound p7 peptide 0.7569 45 67
ID Description Score Start End Superfamily
af_Q3UJV1_7_279_2.170.210.20 Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;Spindle assembly abnormal protein 6, N-terminal domain 0.8332 46 70 2.170.210.20
af_Q4D4Q5_106_279_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8259 43 70 1.20.140.150
af_P9WLN3_1_321_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.7918 48 69 3.90.1200.10
af_A0A0R0F7J8_13_126_2.30.240.10 Mainly Beta;Roll;at5g01610, DUF538 DOMAIN;At5g01610-like 0.7873 50 69 2.30.240.10
af_Q23532_7_215_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7867 46 70 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A7C2XWV8-F1-model_v4 Uncharacterized protein 0.9709 3 109
AF-A0A7C2XWV8-F1-model_v4 Uncharacterized protein 0.9535 3 109
AF-A0A2U3LJ06-F1-model_v4 Uncharacterized protein 0.952 1 109
AF-A0A2U3LJ06-F1-model_v4 Uncharacterized protein 0.9437 1 109
AF-A0A2X1PM78-F1-model_v4 Uncharacterized protein 0.943 40 67

Map