F438045

General Info

Members Datasets Scaffolds Average Seq Length
413 250 413 294

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10082263|Ga0099794_100822631
Length 323
Sequence MTSCDSVADPKNGSRAEDGMAKRKKGTVGVVGLGIMGGSFARNLVESGWRVLGYDTDPKRRRALAKAGVEIAPDVAALAKAVPTIITSLPSPKALDMVVAEITATKRPSKVVIEASTFTLDDKERAERALRKAGHIPLDCPISGTGAQAAVKDLVVYASGDTRTIARLKPLFLGFSRAVHDLGEFGNGSRMKYVANLLVAIHNVASAEAMVLGIKAGLDPKRIFDLVKIGAGNSRVFELRAPMMVKNNYDAATMKIKVWQKDMDVIGSYATSLGVPTPLFSATIPVYASAMSMGHGLQDTAAVCAVLEAMAGVRRSRKRRNKR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
244 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
245 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.59
Nodule 0
Rhizoplane 7.26
Rhizosphere 77.97
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10047703 3300003203 Bacteria 1458
2 Ga0065712_10142110 3300005290 Bacteria 1441
3 Ga0065707_10238411 3300005295 Bacteria 1164
4 Ga0070683_100033424 3300005329 Bacteria 4690
5 Ga0070683_100216330 3300005329 Bacteria 1821
6 Ga0070690_100155395 3300005330 Unclassified 1564
7 Ga0070670_100367656 3300005331 Bacteria 1265
8 Ga0070680_100105534 3300005336 Bacteria 2342
9 Ga0070691_10029776 3300005341 Bacteria 2556
10 Ga0070669_100342027 3300005353 Bacteria 1213
11 Ga0070674_100052471 3300005356 Bacteria 2813
12 Ga0070674_100246062 3300005356 Bacteria 1402
13 Ga0070688_100038185 3300005365 Bacteria 2931
14 Ga0070709_10216505 3300005434 Bacteria 1364
15 Ga0070709_10233124 3300005434 Bacteria 1318
16 Ga0070714_100018190 3300005435 Bacteria 5703
17 Ga0070714_100099169 3300005435 Bacteria 2563
18 Ga0070714_100371312 3300005435 Bacteria 1347
19 Ga0070713_100143123 3300005436 Bacteria 2120
20 Ga0070713_100205548 3300005436 Bacteria 1780
21 Ga0070694_100020732 3300005444 Bacteria 4193
22 Ga0070708_100133875 3300005445 Bacteria 2295
23 Ga0070678_100276793 3300005456 Bacteria 1417
24 Ga0070662_100092740 3300005457 Bacteria 2270
25 Ga0068867_100181075 3300005459 Bacteria 1675
26 Ga0070685_10024687 3300005466 Bacteria 3303
27 Ga0070685_10065427 3300005466 Bacteria 2140
28 Ga0070679_100340114 3300005530 Bacteria 1449
29 Ga0070684_100220623 3300005535 Bacteria 1730
30 Ga0068853_100289532 3300005539 Bacteria 1512
31 Ga0070704_100128335 3300005549 Bacteria 1961
32 Ga0068857_100103689 3300005577 Bacteria 2553
33 Ga0068859_100422355 3300005617 Bacteria 1429
34 Ga0068864_100055703 3300005618 Bacteria 3414
35 Ga0068862_100206072 3300005844 Bacteria 1775
36 Ga0081455_10000307 3300005937 Bacteria 64591
37 Ga0081455_10035536 3300005937 Bacteria 4451
38 Ga0081455_10065962 3300005937 Unclassified 3025
39 Ga0081540_1002509 3300005983 Bacteria 14917
40 Ga0081539_10009942 3300005985 Bacteria 7844
41 Ga0070717_10062267 3300006028 Bacteria 3093
42 Ga0075365_10000880 3300006038 Bacteria 12565
43 Ga0075365_10055329 3300006038 Bacteria 2633
44 Ga0075368_10004113 3300006042 Bacteria 4898
45 Ga0075368_10047204 3300006042 Bacteria 1704
46 Ga0075368_10074568 3300006042 Bacteria 1374
47 Ga0075368_10085796 3300006042 Bacteria 1284
48 Ga0075363_100003359 3300006048 Bacteria 6795
49 Ga0075363_100012282 3300006048 Bacteria 4125
50 Ga0075363_100032480 3300006048 Bacteria 2711
51 Ga0075363_100041438 3300006048 Bacteria 2429
52 Ga0075364_10002131 3300006051 Bacteria 11075
53 Ga0075364_10038148 3300006051 Bacteria 3112
54 Ga0075364_10095486 3300006051 Unclassified 1977
55 Ga0075364_10119456 3300006051 Bacteria 1764
56 Ga0070715_10038460 3300006163 Bacteria 1986
57 Ga0070712_100196953 3300006175 Bacteria 1580
58 Ga0075362_10004637 3300006177 Bacteria 4956
59 Ga0075367_10005253 3300006178 Bacteria 6401
60 Ga0075367_10016663 3300006178 Bacteria 4016
61 Ga0075367_10025758 3300006178 Bacteria 3329
62 Ga0075367_10031813 3300006178 Bacteria 3031
63 Ga0075369_10004519 3300006186 Bacteria 5149
64 Ga0075366_10003121 3300006195 Bacteria 8667
65 Ga0097621_100001458 3300006237 Bacteria 16175
66 Ga0075370_10003119 3300006353 Bacteria 7824
67 Ga0075370_10149984 3300006353 Bacteria 1366
68 Ga0068871_100003552 3300006358 Bacteria 10732
69 Ga0075428_100000068 3300006844 Bacteria 83416
70 Ga0075428_100014981 3300006844 Bacteria 8618
71 Ga0075428_100033510 3300006844 Bacteria 5671
72 Ga0075428_100036762 3300006844 Bacteria 5392
73 Ga0075428_100096376 3300006844 Unclassified 3224
74 Ga0075430_100020234 3300006846 Bacteria 5662
75 Ga0075430_100024393 3300006846 Bacteria 5147
76 Ga0075430_100028949 3300006846 Bacteria 4702
77 Ga0075430_100332809 3300006846 Unclassified 1255
78 Ga0075431_100000217 3300006847 Bacteria 42647
79 Ga0075431_100000602 3300006847 Bacteria 30370
80 Ga0075431_100016523 3300006847 Bacteria 7491
81 Ga0075433_10056353 3300006852 Bacteria 3432
82 Ga0075434_100004499 3300006871 Bacteria 12576
83 Ga0075434_100645278 3300006871 Bacteria 1077
84 Ga0075429_100002468 3300006880 Bacteria 15555
85 Ga0075429_100005381 3300006880 Bacteria 11016
86 Ga0075429_100051350 3300006880 Bacteria 3588
87 Ga0075429_100388617 3300006880 Bacteria 1222
88 Ga0097620_100422337 3300006931 Bacteria 1429
89 Ga0075435_100033979 3300007076 Bacteria 4037
90 Ga0075435_100340148 3300007076 Bacteria 1286
91 Ga0099794_10082263 3300007265 Bacteria 1589
92 Ga0099795_10020051 3300007788 Bacteria 2173
93 Ga0111539_10000725 3300009094 Bacteria 42875
94 Ga0111539_10001483 3300009094 Bacteria 31339
95 Ga0111539_10013525 3300009094 Bacteria 10199
96 Ga0111539_10216855 3300009094 Unclassified 2229
97 Ga0105245_10184396 3300009098 Bacteria 1996
98 Ga0114129_10000035 3300009147 Bacteria 110735
99 Ga0114129_10000227 3300009147 Bacteria 62698
100 Ga0105243_10075972 3300009148 Bacteria 2728
101 Ga0105237_10066260 3300009545 Bacteria 3606
102 Ga0105238_10291716 3300009551 Bacteria 1613
103 Ga0105249_10121507 3300009553 Bacteria 2482
104 Ga0105239_10173981 3300010375 Bacteria 2408
105 Ga0157372_10544207 3300013307 Bacteria 1353
106 Ga0157376_10022150 3300014969 Bacteria 4947
107 Ga0163161_10130449 3300017792 Bacteria 1895
108 Ga0213875_10000918 3300021388 Bacteria 21317
109 Ga0207682_10009429 3300025893 Bacteria 3851
110 Ga0207688_10016460 3300025901 Bacteria 4010
111 Ga0207699_10096167 3300025906 Bacteria 1869
112 Ga0207699_10113836 3300025906 Bacteria 1739
113 Ga0207643_10051055 3300025908 Bacteria 2347
114 Ga0207705_10149062 3300025909 Bacteria 1752
115 Ga0207660_10223121 3300025917 Bacteria 1480
116 Ga0207662_10010784 3300025918 Bacteria 5050
117 Ga0207662_10171018 3300025918 Bacteria 1393
118 Ga0207681_10190434 3300025923 Bacteria 1569
119 Ga0207694_10254982 3300025924 Bacteria 1436
120 Ga0207659_10150000 3300025926 Bacteria 1820
121 Ga0207700_10455925 3300025928 Bacteria 1127
122 Ga0207664_10118250 3300025929 Bacteria 2214
123 Ga0207664_10143376 3300025929 Bacteria 2023
124 Ga0207690_10011454 3300025932 Bacteria 5303
125 Ga0207706_10004983 3300025933 Bacteria 12407
126 Ga0207706_10012032 3300025933 Bacteria 7884
127 Ga0207709_10052039 3300025935 Bacteria 2513
128 Ga0207709_10125475 3300025935 Bacteria 1740
129 Ga0207670_10051072 3300025936 Bacteria 2774
130 Ga0207669_10083516 3300025937 Bacteria 2054
131 Ga0207665_10121956 3300025939 Bacteria 1842
132 Ga0207691_10014634 3300025940 Bacteria 7479
133 Ga0207691_10072859 3300025940 Bacteria 3098
134 Ga0207711_10462516 3300025941 Bacteria 1181
135 Ga0207661_10064713 3300025944 Bacteria 2965
136 Ga0207661_10071565 3300025944 Bacteria 2834
137 Ga0207677_10288587 3300026023 Bacteria 1350
138 Ga0207639_10154803 3300026041 Bacteria 1924
139 Ga0207648_10095256 3300026089 Bacteria 2604
140 Ga0207676_10689717 3300026095 Bacteria 988
141 Ga0209967_1002458 3300027364 Bacteria 2400
142 Ga0209967_1015492 3300027364 Bacteria 1091
143 Ga0209588_1020732 3300027671 Bacteria 2059
144 Ga0209813_10059840 3300027866 Bacteria 1214
145 Ga0207428_10004340 3300027907 Bacteria 13544
146 Ga0207428_10005218 3300027907 Bacteria 12141
147 Ga0207428_10044183 3300027907 Bacteria 3595
148 Ga0268266_10159430 3300028379 Bacteria 2040
149 Ga0265330_10093552 3300031235 Bacteria 1289
150 Ga0265332_10003990 3300031238 Bacteria 7028
151 Ga0265325_10085725 3300031241 Bacteria 1560
152 Ga0265340_10004026 3300031247 Bacteria 8253
153 Ga0265340_10047863 3300031247 Bacteria 2080
154 Ga0265340_10069985 3300031247 Bacteria 1665
155 Ga0265339_10001909 3300031249 Bacteria 15294
156 Ga0265339_10124982 3300031249 Bacteria 1319
157 Ga0265316_10180803 3300031344 Bacteria 1570
158 Ga0265316_10378672 3300031344 Bacteria 1021
159 Ga0307513_10035639 3300031456 Bacteria 5563
160 Ga0307408_100224428 3300031548 Bacteria 1535
161 Ga0265313_10072078 3300031595 Bacteria 1588
162 Ga0316579_10013494 3300031691 Bacteria 3515
163 Ga0265314_10037086 3300031711 Bacteria 3535
164 Ga0265342_10007249 3300031712 Bacteria 8147
165 Ga0307410_10406853 3300031852 Unclassified 1101
166 Ga0307416_100014634 3300032002 Bacteria 5387
167 Ga0307411_10145471 3300032005 Bacteria 1754
168 Ga0373930_0004748 3300034816 Bacteria 2228
169 Ga0373959_0022524 3300034820 Bacteria 1218
170 Ga0373940_0011312 3300035088 Bacteria 2117
171 Ga0373940_0028840 3300035088 Bacteria 1467
172 Ga0373923_0064400 3300035111 Bacteria 1563
173 Ga0373936_0001176 3300035113 Bacteria 9420
174 Ga0373936_0032741 3300035113 Bacteria 2057
175 Ga0373939_0027719 3300035114 Bacteria 1607
176 Ga0373954_0071417 3300035118 Bacteria 1650
177 Ga0373960_0009612 3300035121 Bacteria 2347
178 Ga0373943_0049516 3300035170 Bacteria 2062
179 Ga0373946_0024048 3300035171 Bacteria 2384
180 Ga0373961_0003018 3300035241 Bacteria 4247
181 Ga0373961_0057366 3300035241 Bacteria 1171
182 Ga0373962_0000899 3300035242 Bacteria 6798
183 Ga0373931_0000357 3300035691 Bacteria 18799
184 Ga0373931_0008809 3300035691 Bacteria 4800
185 Ga0373931_0027874 3300035691 Unclassified 2887
186 Ga0373935_0001908 3300035692 Bacteria 11719
187 Ga0373935_0145958 3300035692 Unclassified 1602
188 Ga0373927_0017410 3300035695 Bacteria 4729
189 Ga0373927_0386667 3300035695 Bacteria 923
190 Ga0373933_0002487 3300035724 Bacteria 10361
191 Ga0373933_0097771 3300035724 Bacteria 1818
192 Ga0373947_0002855 3300035725 Bacteria 10317
193 Ga0373947_0072176 3300035725 Bacteria 2119
194 Ga0373937_0000098 3300036401 Bacteria 81900
195 Ga0373937_0027157 3300036401 Bacteria 5174
196 Ga0373937_0449799 3300036401 Bacteria 1223
197 Ga0373925_0000075 3300037068 Bacteria 105395
198 Ga0436364_0266645 3300037853 Bacteria 19395
199 Ga0436364_1260934 3300037853 Unclassified 1347
200 Ga0436364_1306448 3300037853 Bacteria 1329
201 Ga0436365_0480378 3300039437 Bacteria 4075
202 Ga0436365_1780498 3300039437 Bacteria 3621
203 Ga0439453_0000873 3300041408 Bacteria 3600
204 Ga0451853_3286882 3300041512 Bacteria 1110
205 Ga0439446_0038782 3300042156 Bacteria 1398
206 Ga0466963_0164696 3300044694 Bacteria 1544
207 Ga0466967_0068553 3300045976 Bacteria 3168
208 Ga0495592_0000060 3300046454 Bacteria 100113
209 Ga0495629_0017051 3300046459 Bacteria 5211
210 Ga0495638_0007272 3300046460 Bacteria 7960
211 Ga0495651_0000181 3300046462 Bacteria 46803
212 Ga0495653_0000740 3300046463 Bacteria 24927
213 Ga0495605_0089714 3300046474 Bacteria 1426
214 Ga0495662_0004671 3300046476 Bacteria 6872
215 Ga0495664_0000003 3300046477 Bacteria 551602
216 Ga0495584_0007218 3300046491 Bacteria 5798
217 Ga0495608_0000011 3300046511 Bacteria 248514
218 Ga0495618_0000044 3300046514 Bacteria 95526
219 Ga0495628_0000001 3300046516 Bacteria 917742
220 Ga0495628_0039819 3300046516 Bacteria 3758
221 Ga0495630_0002317 3300046517 Bacteria 13234
222 Ga0495631_0057306 3300046518 Bacteria 1696
223 Ga0495652_0000002 3300046529 Bacteria 946606
224 Ga0495652_0220665 3300046529 Bacteria 1425
225 Ga0495640_0000002 3300046533 Bacteria 646434
226 Ga0495587_0000001 3300046536 Bacteria 724132
227 Ga0495645_0000002 3300046543 Bacteria 651644
228 Ga0495667_0000039 3300046559 Bacteria 131308
229 Ga0495634_0000010 3300046642 Bacteria 143792
230 Ga0495635_0000001 3300046663 Bacteria 704901
231 Ga0495635_0039757 3300046663 Bacteria 3253
232 Ga0495657_0000042 3300046675 Bacteria 114669
233 Ga0495599_0000013 3300046678 Bacteria 179828
234 Ga0495623_0000024 3300046679 Bacteria 96499
235 Ga0495646_0000009 3300046680 Bacteria 200698
236 Ga0495658_0045197 3300046683 Bacteria 2471
237 Ga0495624_0044630 3300046690 Bacteria 2825
238 Ga0495600_0000209 3300046809 Bacteria 33688
239 Ga0495600_0274278 3300046809 Bacteria 1069
240 Ga0495581_0046497 3300047315 Bacteria 2508
241 Ga0495604_0000069 3300047317 Bacteria 89935
242 Ga0495604_0172445 3300047317 Unclassified 1520
243 Ga0495674_0000002 3300047319 Bacteria 642785
244 Ga0495672_0057463 3300047320 Bacteria 2259
245 Ga0495672_0125275 3300047320 Bacteria 1359
246 Ga0495680_0000328 3300047322 Bacteria 53287
247 Ga0495680_0180267 3300047322 Bacteria 1525
248 Ga0495675_0000245 3300047444 Bacteria 39142
249 Ga0495684_0000016 3300047471 Bacteria 169338
250 Ga0495684_0261919 3300047471 Bacteria 1254
251 Ga0495593_0000555 3300047673 Bacteria 21201
252 Ga0495602_0000024 3300048088 Bacteria 151162
253 Ga0495602_0079218 3300048088 Bacteria 2772
254 Ga0495615_0043429 3300048090 Bacteria 1131
255 Ga0496101_0003618 3300048904 Bacteria 9646
256 Ga0496102_0001206 3300048905 Bacteria 23466
257 Ga0496102_0482253 3300048905 Unclassified 1161
258 Ga0496104_0001937 3300048907 Bacteria 17935
259 Ga0496104_0003403 3300048907 Bacteria 13734
260 Ga0496104_0015391 3300048907 Bacteria 6927
261 Ga0496105_0007102 3300048908 Bacteria 8638
262 Ga0496105_0078472 3300048908 Bacteria 2726
263 Ga0496105_0098706 3300048908 Bacteria 2411
264 Ga0496105_0230853 3300048908 Unclassified 1504
265 Ga0496106_0005172 3300048909 Bacteria 9662
266 Ga0496107_0000601 3300048910 Bacteria 20084
267 Ga0496108_0003482 3300048911 Bacteria 12623
268 Ga0496108_0007425 3300048911 Bacteria 8885
269 Ga0496108_0214621 3300048911 Bacteria 1671
270 Ga0496109_0003972 3300048912 Bacteria 12347
271 Ga0496109_0052660 3300048912 Bacteria 3710
272 Ga0496110_0001677 3300048913 Bacteria 16256
273 Ga0496110_0143589 3300048913 Bacteria 2158
274 Ga0496110_0247386 3300048913 Bacteria 1623
275 Ga0496111_0000535 3300048914 Bacteria 19672
276 Ga0496111_0059084 3300048914 Bacteria 2778
277 Ga0496112_0016516 3300048915 Bacteria 6918
278 Ga0496112_0032487 3300048915 Bacteria 5068
279 Ga0496113_0004152 3300048916 Bacteria 8837
280 Ga0496113_0099506 3300048916 Bacteria 2252
281 Ga0496114_0088495 3300048917 Bacteria 2627
282 Ga0496114_0246836 3300048917 Bacteria 1571
283 Ga0496115_0129169 3300048918 Bacteria 2082
284 Ga0496115_0247997 3300048918 Bacteria 1467
285 Ga0496121_0000225 3300048924 Bacteria 122351
286 Ga0501032_0056592 3300049569 Bacteria 2636
287 Ga0501032_0173952 3300049569 Bacteria 1411
288 Ga0501034_0025281 3300049571 Bacteria 6045
289 Ga0501034_0048101 3300049571 Bacteria 4304
290 Ga0501034_0135086 3300049571 Bacteria 2447
291 Ga0501034_0141766 3300049571 Bacteria 2382
292 Ga0501034_0252506 3300049571 Bacteria 1708
293 Ga0501036_0026273 3300049572 Bacteria 4913
294 Ga0501036_0058089 3300049572 Bacteria 3277
295 Ga0501036_0095536 3300049572 Bacteria 2512
296 Ga0501036_0121245 3300049572 Bacteria 2208
297 Ga0501036_0157022 3300049572 Bacteria 1918
298 Ga0501036_0554669 3300049572 Bacteria 954
299 Ga0501037_0034931 3300049573 Bacteria 3708
300 Ga0501037_0035778 3300049573 Bacteria 3659
301 Ga0501037_0397449 3300049573 Bacteria 945
302 Ga0501038_0033874 3300049574 Bacteria 4494
303 Ga0501039_0106202 3300049575 Bacteria 2193
304 Ga0501040_0094181 3300049576 Unclassified 2084
305 Ga0501040_0228289 3300049576 Bacteria 1325
306 Ga0501041_0272850 3300049577 Bacteria 1064
307 Ga0501042_0273624 3300049578 Bacteria 1219
308 Ga0501043_0047680 3300049579 Bacteria 3368
309 Ga0501043_0229976 3300049579 Bacteria 1432
310 Ga0501046_0014619 3300049580 Bacteria 6613
311 Ga0501047_0218040 3300049581 Bacteria 1764
312 Ga0501047_0233383 3300049581 Bacteria 1692
313 Ga0501047_0358786 3300049581 Bacteria 1293
314 Ga0501048_0065868 3300049582 Bacteria 2561
315 Ga0501068_0032180 3300049584 Bacteria 3117
316 Ga0501068_0055034 3300049584 Bacteria 2410
317 Ga0501068_0291549 3300049584 Bacteria 1043
318 Ga0501070_0046008 3300049586 Bacteria 3629
319 Ga0501072_0014777 3300049588 Bacteria 5986
320 Ga0501072_0111890 3300049588 Bacteria 2174
321 Ga0501073_0049271 3300049589 Bacteria 2954
322 Ga0501073_0129221 3300049589 Bacteria 1751
323 Ga0501073_0199746 3300049589 Bacteria 1383
324 Ga0501073_0229528 3300049589 Bacteria 1282
325 Ga0501074_0052200 3300049590 Bacteria 2952
326 Ga0501074_0148012 3300049590 Bacteria 1679
327 Ga0501075_0057695 3300049591 Bacteria 2923
328 Ga0501075_0057873 3300049591 Bacteria 2919
329 Ga0501076_0013656 3300049592 Bacteria 6094
330 Ga0501076_0052082 3300049592 Bacteria 3242
331 Ga0501076_0078296 3300049592 Bacteria 2653
332 Ga0501076_0283493 3300049592 Bacteria 1357
333 Ga0501077_0005408 3300049593 Bacteria 7765
334 Ga0501077_0077941 3300049593 Bacteria 2100
335 Ga0501079_0009679 3300049741 Bacteria 7308
336 Ga0501080_0027061 3300049742 Bacteria 5332
337 Ga0501080_0033462 3300049742 Bacteria 4797
338 Ga0501081_0012691 3300049743 Bacteria 5540
339 Ga0501081_0213836 3300049743 Bacteria 1401
340 Ga0501081_0225345 3300049743 Bacteria 1364
341 Ga0501083_0112482 3300049744 Bacteria 1789
342 Ga0501035_0079886 3300049822 Bacteria 2888
343 Ga0501044_0067303 3300049823 Bacteria 3649
344 Ga0501044_0081667 3300049823 Bacteria 3271
345 Ga0501044_0192418 3300049823 Bacteria 2002
346 Ga0501044_0403286 3300049823 Bacteria 1279
347 Ga0501045_0271970 3300049824 Bacteria 1261
348 Ga0501045_0291890 3300049824 Unclassified 1213
349 Ga0501045_0292629 3300049824 Bacteria 1212
350 nmdc:mga03683_15662_c1 3300050489 Bacteria 2834
351 nmdc:mga03683_3107_c1 3300050489 Bacteria 5282
352 nmdc:mga03n38_12584_c1 3300050490 Bacteria 3189
353 nmdc:mga03n38_40912_c1 3300050490 Bacteria 2017
354 nmdc:mga00v17_146439_c1 3300050491 Unclassified 1516
355 nmdc:mga00v17_189614_c1 3300050491 Bacteria 1328
356 nmdc:mga00v17_25314_c1 3300050491 Bacteria 3449
357 nmdc:mga0yw44_142628_c1 3300050492 Bacteria 1558
358 nmdc:mga0yw44_40027_c1 3300050492 Unclassified 2782
359 nmdc:mga0k408_5072_c1 3300050493 Bacteria 6978
360 nmdc:mga06z11_174360_c1 3300050494 Bacteria 1237
361 nmdc:mga06z11_34168_c1 3300050494 Bacteria 2494
362 nmdc:mga06z11_39702_c1 3300050494 Bacteria 2344
363 nmdc:mga06z11_47337_c1 3300050494 Bacteria 2184
364 nmdc:mga06z11_68706_c1 3300050494 Bacteria 1868
365 nmdc:mga06z11_74459_c1 3300050494 Bacteria 1805
366 nmdc:mga04h51_23134_c1 3300050495 Bacteria 1889
367 nmdc:mga04h51_42036_c1 3300050495 Bacteria 1497
368 nmdc:mga05p37_203_c1 3300050507 Bacteria 59589
369 nmdc:mga05p37_76_c1 3300050507 Bacteria 86726
370 nmdc:mga09592_218764_c1 3300050508 Bacteria 1650
371 nmdc:mga09592_2614_c1 3300050508 Bacteria 14574
372 nmdc:mga09592_29272_c1 3300050508 Bacteria 4580
373 nmdc:mga09592_72985_c1 3300050508 Bacteria 2915
374 nmdc:mga0qj67_3805_c1 3300050509 Bacteria 10900
375 nmdc:mga0qj67_381171_c1 3300050509 Bacteria 1139
376 nmdc:mga0qj67_98026_c1 3300050509 Bacteria 2361
377 nmdc:mga06r32_134_c1 3300050510 Bacteria 54737
378 nmdc:mga06r32_1490_c1 3300050510 Bacteria 21045
379 nmdc:mga06r32_426044_c1 3300050510 Bacteria 1308
380 nmdc:mga06r32_8156_c1 3300050510 Bacteria 9422
381 nmdc:mga08y16_152042_c1 3300050511 Unclassified 2405
382 nmdc:mga08y16_33512_c1 3300050511 Bacteria 5394
383 nmdc:mga08y16_961_c1 3300050511 Bacteria 28000
384 nmdc:mga0n895_109601_c1 3300050512 Bacteria 2776
385 nmdc:mga0n895_9151_c1 3300050512 Bacteria 8647
386 nmdc:mga0rr50_359833_c1 3300050513 Bacteria 1225
387 nmdc:mga08x19_41107_c1 3300050514 Bacteria 2945
388 nmdc:mga0a205_580_c2 3300050515 Bacteria 27924
389 nmdc:mga0sz30_35740_c1 3300050516 Bacteria 2075
390 Ga0495601_0000001 3300053077 Bacteria 549454
391 Ga0495601_0184097 3300053077 Bacteria 1365
392 Ga0495612_0000017 3300053078 Bacteria 152112
393 Ga0495595_0000010 3300053084 Bacteria 178819
394 Ga0495619_0000004 3300053085 Bacteria 500068
395 Ga0500641_0004194 3300053096 Bacteria 5089
396 Ga0500562_025676 3300053108 Bacteria 1543
397 Ga0500593_110529 3300053117 Bacteria 1130
398 Ga0500595_003170 3300053119 Bacteria 7783
399 Ga0500595_037471 3300053119 Bacteria 1581
400 Ga0500588_0026153 3300053146 Bacteria 1630
401 Ga0500616_0004397 3300053153 Bacteria 10067
402 Ga0500616_0083260 3300053153 Bacteria 1603
403 Ga0500636_0007380 3300053177 Bacteria 6358
404 Ga0501084_0026027 3300054114 Bacteria 4880
405 Ga0501084_0070622 3300054114 Bacteria 2924
406 Ga0501084_0077923 3300054114 Bacteria 2778
407 Ga0501084_0175710 3300054114 Bacteria 1808
408 Ga0501084_0383858 3300054114 Bacteria 1187
409 Ga0501082_0000510 3300060353 Bacteria 34491
410 Ga0501082_0009645 3300060353 Bacteria 8310
411 Ga0501082_0137714 3300060353 Bacteria 2118
412 Ga0530510_0188081 3300061734 Unclassified 1532
413 Ga0530510_0392331 3300061734 Bacteria 1045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005341 Ga0070691_10029776 Ga0070691_100297761 245
2 3300034816 Ga0373930_0004748 Ga0373930_0004748_466_1374 245
3 3300034820 Ga0373959_0022524 Ga0373959_0022524_97_1005 245
4 3300035121 Ga0373960_0009612 Ga0373960_0009612_1251_2159 245
5 3300035241 Ga0373961_0057366 Ga0373961_0057366_140_1048 245
6 3300035691 Ga0373931_0000357 Ga0373931_0000357_2737_3645 245
7 3300006048 Ga0075363_100003359 Ga0075363_1000033598 248
8 3300006051 Ga0075364_10002131 Ga0075364_100021317 248
9 3300006177 Ga0075362_10004637 Ga0075362_100046373 248
10 3300006195 Ga0075366_10003121 Ga0075366_100031215 248
11 3300050489 nmdc:mga03683_3107_c1 nmdc:mga03683_3107_c1_1699_2586 248
12 3300050491 nmdc:mga00v17_25314_c1 nmdc:mga00v17_25314_c1_1003_1890 248
13 3300050493 nmdc:mga0k408_5072_c1 nmdc:mga0k408_5072_c1_3010_3897 248
14 3300009094 Ga0111539_10216855 Ga0111539_102168553 249
15 3300050511 nmdc:mga08y16_152042_c1 nmdc:mga08y16_152042_c1_326_1234 249
16 3300032002 Ga0307416_100014634 Ga0307416_1000146345 250
17 3300032005 Ga0307411_10145471 Ga0307411_101454712 250
18 3300050508 nmdc:mga09592_218764_c1 nmdc:mga09592_218764_c1_11_802 252
19 3300006846 Ga0075430_100028949 Ga0075430_1000289496 253
20 3300046491 Ga0495584_0007218 Ga0495584_0007218_4399_5313 257
21 3300005983 Ga0081540_1002509 Ga0081540_10025098 258
22 3300005937 Ga0081455_10000307 Ga0081455_1000030746 259
23 3300006844 Ga0075428_100033510 Ga0075428_1000335103 260
24 3300006038 Ga0075365_10000880 Ga0075365_100008802 265
25 3300006048 Ga0075363_100012282 Ga0075363_1000122823 265
26 3300006051 Ga0075364_10038148 Ga0075364_100381482 265
27 3300006178 Ga0075367_10005253 Ga0075367_100052534 265
28 3300050490 nmdc:mga03n38_12584_c1 nmdc:mga03n38_12584_c1_1905_2789 265
29 3300050494 nmdc:mga06z11_47337_c1 nmdc:mga06z11_47337_c1_1275_2159 265
30 3300050495 nmdc:mga04h51_23134_c1 nmdc:mga04h51_23134_c1_46_930 265
31 3300053153 Ga0500616_0083260 Ga0500616_0083260_45_929 265
32 3300048924 Ga0496121_0000225 Ga0496121_0000225_45156_46061 266
33 3300005434 Ga0070709_10216505 Ga0070709_102165051 267
34 3300006042 Ga0075368_10047204 Ga0075368_100472042 267
35 3300006178 Ga0075367_10016663 Ga0075367_100166634 267
36 3300025906 Ga0207699_10113836 Ga0207699_101138362 267
37 3300050494 nmdc:mga06z11_39702_c1 nmdc:mga06z11_39702_c1_464_1348 267
38 3300050495 nmdc:mga04h51_42036_c1 nmdc:mga04h51_42036_c1_166_1050 267
39 3300005549 Ga0070704_100128335 Ga0070704_1001283352 268
40 3300005937 Ga0081455_10065962 Ga0081455_100659624 268
41 3300006051 Ga0075364_10095486 Ga0075364_100954862 268
42 3300006844 Ga0075428_100036762 Ga0075428_1000367622 268
43 3300006846 Ga0075430_100332809 Ga0075430_1003328091 268
44 3300050492 nmdc:mga0yw44_40027_c1 nmdc:mga0yw44_40027_c1_1566_2561 268
45 3300050509 nmdc:mga0qj67_381171_c1 nmdc:mga0qj67_381171_c1_34_927 268
46 3300050510 nmdc:mga06r32_426044_c1 nmdc:mga06r32_426044_c1_17_1012 268
47 3300035088 Ga0373940_0011312 Ga0373940_0011312_55_897 272
48 3300048088 Ga0495602_0079218 Ga0495602_0079218_1101_1955 273
49 3300006846 Ga0075430_100024393 Ga0075430_1000243932 274
50 3300025939 Ga0207665_10121956 Ga0207665_101219562 274
51 3300031852 Ga0307410_10406853 Ga0307410_104068532 275
52 3300006844 Ga0075428_100096376 Ga0075428_1000963762 277
53 3300025929 Ga0207664_10118250 Ga0207664_101182502 277
54 3300048917 Ga0496114_0246836 Ga0496114_0246836_502_1392 279
55 3300049592 Ga0501076_0283493 Ga0501076_0283493_23_865 279
56 3300049743 Ga0501081_0225345 Ga0501081_0225345_56_898 279
57 3300050494 nmdc:mga06z11_74459_c1 nmdc:mga06z11_74459_c1_793_1638 279
58 3300061734 Ga0530510_0392331 Ga0530510_0392331_118_960 279
59 3300035695 Ga0373927_0386667 Ga0373927_0386667_14_880 280
60 3300046516 Ga0495628_0039819 Ga0495628_0039819_583_1437 280
61 3300053077 Ga0495601_0184097 Ga0495601_0184097_384_1238 280
62 3300031548 Ga0307408_100224428 Ga0307408_1002244282 282
63 3300005436 Ga0070713_100205548 Ga0070713_1002055481 283
64 3300006871 Ga0075434_100645278 Ga0075434_1006452781 283
65 3300025928 Ga0207700_10455925 Ga0207700_104559251 283
66 3300049571 Ga0501034_0135086 Ga0501034_0135086_1125_2024 283
67 3300049572 Ga0501036_0026273 Ga0501036_0026273_3605_4504 283
68 3300049573 Ga0501037_0034931 Ga0501037_0034931_2269_3168 283
69 3300049582 Ga0501048_0065868 Ga0501048_0065868_380_1279 283
70 3300049584 Ga0501068_0032180 Ga0501068_0032180_1596_2495 283
71 3300049589 Ga0501073_0049271 Ga0501073_0049271_1659_2558 283
72 3300049589 Ga0501073_0229528 Ga0501073_0229528_406_1269 283
73 3300049742 Ga0501080_0033462 Ga0501080_0033462_2172_3071 283
74 3300021388 Ga0213875_10000918 Ga0213875_100009188 284
75 3300037853 Ga0436364_0266645 Ga0436364_0266645_5396_6298 284
76 3300005336 Ga0070680_100105534 Ga0070680_1001055343 285
77 3300005530 Ga0070679_100340114 Ga0070679_1003401142 285
78 3300006042 Ga0075368_10004113 Ga0075368_100041135 285
79 3300006048 Ga0075363_100041438 Ga0075363_1000414382 285
80 3300006186 Ga0075369_10004519 Ga0075369_100045192 285
81 3300006844 Ga0075428_100000068 Ga0075428_10000006850 285
82 3300006847 Ga0075431_100000217 Ga0075431_10000021728 285
83 3300006880 Ga0075429_100002468 Ga0075429_1000024686 285
84 3300009094 Ga0111539_10001483 Ga0111539_100014834 285
85 3300009147 Ga0114129_10000035 Ga0114129_1000003537 285
86 3300025909 Ga0207705_10149062 Ga0207705_101490622 285
87 3300025917 Ga0207660_10223121 Ga0207660_102231211 285
88 3300027907 Ga0207428_10004340 Ga0207428_1000434011 285
89 3300048913 Ga0496110_0247386 Ga0496110_0247386_266_1171 285
90 3300050490 nmdc:mga03n38_40912_c1 nmdc:mga03n38_40912_c1_536_1453 285
91 3300050491 nmdc:mga00v17_189614_c1 nmdc:mga00v17_189614_c1_310_1227 285
92 3300050492 nmdc:mga0yw44_142628_c1 nmdc:mga0yw44_142628_c1_368_1285 285
93 3300050494 nmdc:mga06z11_68706_c1 nmdc:mga06z11_68706_c1_136_1053 285
94 3300050507 nmdc:mga05p37_203_c1 nmdc:mga05p37_203_c1_5293_6198 285
95 3300050508 nmdc:mga09592_2614_c1 nmdc:mga09592_2614_c1_8201_9106 285
96 3300050509 nmdc:mga0qj67_98026_c1 nmdc:mga0qj67_98026_c1_942_1847 285
97 3300050510 nmdc:mga06r32_1490_c1 nmdc:mga06r32_1490_c1_7018_7923 285
98 3300050511 nmdc:mga08y16_33512_c1 nmdc:mga08y16_33512_c1_2192_3097 285
99 3300050516 nmdc:mga0sz30_35740_c1 nmdc:mga0sz30_35740_c1_757_1674 285
100 3300053119 Ga0500595_037471 Ga0500595_037471_92_1039 285
101 3300027364 Ga0209967_1002458 Ga0209967_10024582 286
102 3300027364 Ga0209967_1015492 Ga0209967_10154921 286
103 3300005329 Ga0070683_100033424 Ga0070683_1000334244 287
104 3300005330 Ga0070690_100155395 Ga0070690_1001553952 287
105 3300005434 Ga0070709_10233124 Ga0070709_102331242 287
106 3300006237 Ga0097621_100001458 Ga0097621_10000145811 287
107 3300006358 Ga0068871_100003552 Ga0068871_1000035524 287
108 3300006846 Ga0075430_100020234 Ga0075430_1000202343 287
109 3300006847 Ga0075431_100016523 Ga0075431_1000165238 287
110 3300006880 Ga0075429_100051350 Ga0075429_1000513502 287
111 3300014969 Ga0157376_10022150 Ga0157376_100221503 287
112 3300025944 Ga0207661_10064713 Ga0207661_100647132 287
113 3300035088 Ga0373940_0028840 Ga0373940_0028840_61_927 287
114 3300035241 Ga0373961_0003018 Ga0373961_0003018_1141_2007 287
115 3300035691 Ga0373931_0027874 Ga0373931_0027874_1722_2588 287
116 3300035724 Ga0373933_0097771 Ga0373933_0097771_231_1112 287
117 3300036401 Ga0373937_0027157 Ga0373937_0027157_1453_2334 287
118 3300039437 Ga0436365_1780498 Ga0436365_1780498_2417_3316 287
119 3300041512 Ga0451853_3286882 Ga0451853_3286882_178_1044 287
120 3300046663 Ga0495635_0039757 Ga0495635_0039757_1421_2302 287
121 3300047317 Ga0495604_0172445 Ga0495604_0172445_493_1374 287
122 3300050508 nmdc:mga09592_72985_c1 nmdc:mga09592_72985_c1_724_1599 287
123 3300050510 nmdc:mga06r32_8156_c1 nmdc:mga06r32_8156_c1_2650_3525 287
124 3300005329 Ga0070683_100216330 Ga0070683_1002163302 288
125 3300005435 Ga0070714_100018190 Ga0070714_1000181902 288
126 3300005535 Ga0070684_100220623 Ga0070684_1002206232 288
127 3300009545 Ga0105237_10066260 Ga0105237_100662604 288
128 3300009551 Ga0105238_10291716 Ga0105238_102917162 288
129 3300025924 Ga0207694_10254982 Ga0207694_102549822 288
130 3300025944 Ga0207661_10071565 Ga0207661_100715652 288
131 3300025906 Ga0207699_10096167 Ga0207699_100961672 289
132 3300035114 Ga0373939_0027719 Ga0373939_0027719_594_1502 289
133 3300035242 Ga0373962_0000899 Ga0373962_0000899_1241_2149 289
134 3300035691 Ga0373931_0008809 Ga0373931_0008809_751_1659 289
135 3300048916 Ga0496113_0099506 Ga0496113_0099506_840_1742 289
136 3300006042 Ga0075368_10085796 Ga0075368_100857962 290
137 3300027866 Ga0209813_10059840 Ga0209813_100598401 290
138 3300053177 Ga0500636_0007380 Ga0500636_0007380_394_1278 290
139 3300037853 Ga0436364_1306448 Ga0436364_1306448_105_980 291
140 3300005444 Ga0070694_100020732 Ga0070694_1000207322 292
141 3300047320 Ga0495672_0057463 Ga0495672_0057463_735_1637 292
142 3300048904 Ga0496101_0003618 Ga0496101_0003618_3216_4106 292
143 3300048905 Ga0496102_0001206 Ga0496102_0001206_10767_11657 292
144 3300048907 Ga0496104_0001937 Ga0496104_0001937_11045_11935 292
145 3300048908 Ga0496105_0078472 Ga0496105_0078472_1514_2404 292
146 3300048908 Ga0496105_0230853 Ga0496105_0230853_213_1112 292
147 3300048909 Ga0496106_0005172 Ga0496106_0005172_750_1640 292
148 3300048910 Ga0496107_0000601 Ga0496107_0000601_6702_7592 292
149 3300048911 Ga0496108_0003482 Ga0496108_0003482_1546_2445 292
150 3300048911 Ga0496108_0007425 Ga0496108_0007425_6401_7291 292
151 3300048912 Ga0496109_0003972 Ga0496109_0003972_9003_9893 292
152 3300048912 Ga0496109_0052660 Ga0496109_0052660_314_1213 292
153 3300048913 Ga0496110_0001677 Ga0496110_0001677_2780_3679 292
154 3300048914 Ga0496111_0000535 Ga0496111_0000535_14204_15103 292
155 3300048914 Ga0496111_0059084 Ga0496111_0059084_1006_1896 292
156 3300048915 Ga0496112_0016516 Ga0496112_0016516_879_1769 292
157 3300048915 Ga0496112_0032487 Ga0496112_0032487_2031_2930 292
158 3300048916 Ga0496113_0004152 Ga0496113_0004152_1796_2686 292
159 3300049572 Ga0501036_0121245 Ga0501036_0121245_342_1232 292
160 3300049578 Ga0501042_0273624 Ga0501042_0273624_75_965 292
161 3300049588 Ga0501072_0111890 Ga0501072_0111890_1178_2068 292
162 3300049590 Ga0501074_0052200 Ga0501074_0052200_12_902 292
163 3300049591 Ga0501075_0057873 Ga0501075_0057873_341_1231 292
164 3300054114 Ga0501084_0070622 Ga0501084_0070622_396_1286 292
165 3300005435 Ga0070714_100099169 Ga0070714_1000991692 293
166 3300005435 Ga0070714_100371312 Ga0070714_1003713121 293
167 3300005436 Ga0070713_100143123 Ga0070713_1001431232 293
168 3300006028 Ga0070717_10062267 Ga0070717_100622674 293
169 3300006038 Ga0075365_10055329 Ga0075365_100553292 293
170 3300006175 Ga0070712_100196953 Ga0070712_1001969532 293
171 3300006178 Ga0075367_10025758 Ga0075367_100257582 293
172 3300009553 Ga0105249_10121507 Ga0105249_101215072 293
173 3300010375 Ga0105239_10173981 Ga0105239_101739812 293
174 3300025918 Ga0207662_10010784 Ga0207662_100107842 293
175 3300025929 Ga0207664_10143376 Ga0207664_101433761 293
176 3300025932 Ga0207690_10011454 Ga0207690_100114542 293
177 3300025933 Ga0207706_10004983 Ga0207706_100049834 293
178 3300025940 Ga0207691_10014634 Ga0207691_100146343 293
179 3300028379 Ga0268266_10159430 Ga0268266_101594303 293
180 3300035692 Ga0373935_0145958 Ga0373935_0145958_192_1106 293
181 3300048905 Ga0496102_0482253 Ga0496102_0482253_63_977 293
182 3300048907 Ga0496104_0003403 Ga0496104_0003403_4368_5282 293
183 3300048907 Ga0496104_0015391 Ga0496104_0015391_2888_3802 293
184 3300048908 Ga0496105_0007102 Ga0496105_0007102_3439_4353 293
185 3300048908 Ga0496105_0098706 Ga0496105_0098706_286_1200 293
186 3300048913 Ga0496110_0143589 Ga0496110_0143589_966_1880 293
187 3300048917 Ga0496114_0088495 Ga0496114_0088495_1004_1918 293
188 3300048918 Ga0496115_0129169 Ga0496115_0129169_1065_1979 293
189 3300049572 Ga0501036_0095536 Ga0501036_0095536_124_1134 293
190 3300049823 Ga0501044_0081667 Ga0501044_0081667_1482_2492 293
191 3300050494 nmdc:mga06z11_34168_c1 nmdc:mga06z11_34168_c1_441_1355 293
192 3300005937 Ga0081455_10035536 Ga0081455_100355362 294
193 3300048090 Ga0495615_0043429 Ga0495615_0043429_16_900 294
194 3300005295 Ga0065707_10238411 Ga0065707_102384111 295
195 3300005466 Ga0070685_10024687 Ga0070685_100246873 295
196 3300006042 Ga0075368_10074568 Ga0075368_100745682 295
197 3300006353 Ga0075370_10149984 Ga0075370_101499842 295
198 3300009098 Ga0105245_10184396 Ga0105245_101843962 295
199 3300025918 Ga0207662_10171018 Ga0207662_101710182 295
200 3300025941 Ga0207711_10462516 Ga0207711_104625161 295
201 3300027671 Ga0209588_1020732 Ga0209588_10207322 295
202 3300031241 Ga0265325_10085725 Ga0265325_100857252 295
203 3300031247 Ga0265340_10047863 Ga0265340_100478632 295
204 3300031247 Ga0265340_10069985 Ga0265340_100699852 295
205 3300031344 Ga0265316_10378672 Ga0265316_103786721 295
206 3300048911 Ga0496108_0214621 Ga0496108_0214621_365_1270 295
207 3300049569 Ga0501032_0173952 Ga0501032_0173952_250_1149 295
208 3300049571 Ga0501034_0141766 Ga0501034_0141766_759_1658 295
209 3300049572 Ga0501036_0058089 Ga0501036_0058089_875_1774 295
210 3300049572 Ga0501036_0157022 Ga0501036_0157022_55_954 295
211 3300049572 Ga0501036_0554669 Ga0501036_0554669_27_926 295
212 3300049573 Ga0501037_0035778 Ga0501037_0035778_2142_3041 295
213 3300049573 Ga0501037_0397449 Ga0501037_0397449_34_933 295
214 3300049574 Ga0501038_0033874 Ga0501038_0033874_1987_2886 295
215 3300049575 Ga0501039_0106202 Ga0501039_0106202_849_1760 295
216 3300049576 Ga0501040_0228289 Ga0501040_0228289_33_932 295
217 3300049579 Ga0501043_0047680 Ga0501043_0047680_2435_3334 295
218 3300049579 Ga0501043_0229976 Ga0501043_0229976_370_1269 295
219 3300049580 Ga0501046_0014619 Ga0501046_0014619_4148_5047 295
220 3300049581 Ga0501047_0218040 Ga0501047_0218040_34_933 295
221 3300049581 Ga0501047_0233383 Ga0501047_0233383_666_1565 295
222 3300049581 Ga0501047_0358786 Ga0501047_0358786_34_933 295
223 3300049584 Ga0501068_0055034 Ga0501068_0055034_755_1654 295
224 3300049584 Ga0501068_0291549 Ga0501068_0291549_111_1010 295
225 3300049586 Ga0501070_0046008 Ga0501070_0046008_699_1598 295
226 3300049588 Ga0501072_0014777 Ga0501072_0014777_4104_5015 295
227 3300049589 Ga0501073_0199746 Ga0501073_0199746_240_1151 295
228 3300049590 Ga0501074_0148012 Ga0501074_0148012_561_1460 295
229 3300049592 Ga0501076_0052082 Ga0501076_0052082_2154_3053 295
230 3300049592 Ga0501076_0078296 Ga0501076_0078296_1542_2453 295
231 3300049593 Ga0501077_0077941 Ga0501077_0077941_907_1818 295
232 3300049742 Ga0501080_0027061 Ga0501080_0027061_1871_2770 295
233 3300049743 Ga0501081_0213836 Ga0501081_0213836_219_1130 295
234 3300049822 Ga0501035_0079886 Ga0501035_0079886_1341_2240 295
235 3300049823 Ga0501044_0067303 Ga0501044_0067303_1237_2136 295
236 3300049823 Ga0501044_0403286 Ga0501044_0403286_44_943 295
237 3300049824 Ga0501045_0271970 Ga0501045_0271970_275_1174 295
238 3300049824 Ga0501045_0291890 Ga0501045_0291890_169_1080 295
239 3300050489 nmdc:mga03683_15662_c1 nmdc:mga03683_15662_c1_1687_2595 295
240 3300053119 Ga0500595_003170 Ga0500595_003170_4141_5049 295
241 3300054114 Ga0501084_0175710 Ga0501084_0175710_710_1621 295
242 3300006048 Ga0075363_100032480 Ga0075363_1000324802 296
243 3300006051 Ga0075364_10119456 Ga0075364_101194562 296
244 3300006178 Ga0075367_10031813 Ga0075367_100318133 296
245 3300006353 Ga0075370_10003119 Ga0075370_100031197 296
246 3300007076 Ga0075435_100340148 Ga0075435_1003401481 296
247 3300007265 Ga0099794_10082263 Ga0099794_100822631 296
248 3300007788 Ga0099795_10020051 Ga0099795_100200512 296
249 3300035111 Ga0373923_0064400 Ga0373923_0064400_280_1194 296
250 3300035113 Ga0373936_0001176 Ga0373936_0001176_1246_2160 296
251 3300035113 Ga0373936_0032741 Ga0373936_0032741_358_1272 296
252 3300035118 Ga0373954_0071417 Ga0373954_0071417_104_1018 296
253 3300035170 Ga0373943_0049516 Ga0373943_0049516_551_1465 296
254 3300035171 Ga0373946_0024048 Ga0373946_0024048_1264_2178 296
255 3300035692 Ga0373935_0001908 Ga0373935_0001908_7086_8000 296
256 3300035695 Ga0373927_0017410 Ga0373927_0017410_542_1456 296
257 3300035724 Ga0373933_0002487 Ga0373933_0002487_3241_4155 296
258 3300035725 Ga0373947_0002855 Ga0373947_0002855_9140_10054 296
259 3300035725 Ga0373947_0072176 Ga0373947_0072176_1027_1941 296
260 3300036401 Ga0373937_0000098 Ga0373937_0000098_74923_75837 296
261 3300036401 Ga0373937_0449799 Ga0373937_0449799_97_1011 296
262 3300037068 Ga0373925_0000075 Ga0373925_0000075_13607_14521 296
263 3300044694 Ga0466963_0164696 Ga0466963_0164696_562_1461 296
264 3300045976 Ga0466967_0068553 Ga0466967_0068553_1439_2338 296
265 3300046454 Ga0495592_0000060 Ga0495592_0000060_9521_10435 296
266 3300046459 Ga0495629_0017051 Ga0495629_0017051_1963_2877 296
267 3300046462 Ga0495651_0000181 Ga0495651_0000181_36428_37342 296
268 3300046463 Ga0495653_0000740 Ga0495653_0000740_14490_15404 296
269 3300046476 Ga0495662_0004671 Ga0495662_0004671_3730_4644 296
270 3300046477 Ga0495664_0000003 Ga0495664_0000003_73298_74212 296
271 3300046511 Ga0495608_0000011 Ga0495608_0000011_19302_20216 296
272 3300046514 Ga0495618_0000044 Ga0495618_0000044_85131_86045 296
273 3300046516 Ga0495628_0000001 Ga0495628_0000001_562699_563613 296
274 3300046517 Ga0495630_0002317 Ga0495630_0002317_1323_2237 296
275 3300046529 Ga0495652_0000002 Ga0495652_0000002_777233_778147 296
276 3300046529 Ga0495652_0220665 Ga0495652_0220665_67_981 296
277 3300046533 Ga0495640_0000002 Ga0495640_0000002_17562_18476 296
278 3300046536 Ga0495587_0000001 Ga0495587_0000001_89968_90882 296
279 3300046543 Ga0495645_0000002 Ga0495645_0000002_562712_563626 296
280 3300046559 Ga0495667_0000039 Ga0495667_0000039_120857_121771 296
281 3300046642 Ga0495634_0000010 Ga0495634_0000010_78869_79783 296
282 3300046663 Ga0495635_0000001 Ga0495635_0000001_75792_76706 296
283 3300046675 Ga0495657_0000042 Ga0495657_0000042_104378_105292 296
284 3300046678 Ga0495599_0000013 Ga0495599_0000013_88000_88914 296
285 3300046679 Ga0495623_0000024 Ga0495623_0000024_90758_91672 296
286 3300046680 Ga0495646_0000009 Ga0495646_0000009_90801_91715 296
287 3300046683 Ga0495658_0045197 Ga0495658_0045197_1372_2286 296
288 3300046690 Ga0495624_0044630 Ga0495624_0044630_863_1777 296
289 3300046809 Ga0495600_0000209 Ga0495600_0000209_13792_14706 296
290 3300046809 Ga0495600_0274278 Ga0495600_0274278_19_933 296
291 3300047315 Ga0495581_0046497 Ga0495581_0046497_1308_2222 296
292 3300047317 Ga0495604_0000069 Ga0495604_0000069_64714_65628 296
293 3300047319 Ga0495674_0000002 Ga0495674_0000002_562700_563614 296
294 3300047322 Ga0495680_0000328 Ga0495680_0000328_42820_43734 296
295 3300047322 Ga0495680_0180267 Ga0495680_0180267_32_946 296
296 3300047444 Ga0495675_0000245 Ga0495675_0000245_13594_14508 296
297 3300047471 Ga0495684_0000016 Ga0495684_0000016_154416_155330 296
298 3300047471 Ga0495684_0261919 Ga0495684_0261919_174_1088 296
299 3300047673 Ga0495593_0000555 Ga0495593_0000555_9501_10415 296
300 3300048088 Ga0495602_0000024 Ga0495602_0000024_125633_126547 296
301 3300048918 Ga0496115_0247997 Ga0496115_0247997_17_925 296
302 3300049569 Ga0501032_0056592 Ga0501032_0056592_1208_2218 296
303 3300049571 Ga0501034_0048101 Ga0501034_0048101_1141_2154 296
304 3300049576 Ga0501040_0094181 Ga0501040_0094181_316_1206 296
305 3300049577 Ga0501041_0272850 Ga0501041_0272850_61_951 296
306 3300049591 Ga0501075_0057695 Ga0501075_0057695_165_1055 296
307 3300049592 Ga0501076_0013656 Ga0501076_0013656_2971_3861 296
308 3300049593 Ga0501077_0005408 Ga0501077_0005408_2803_3693 296
309 3300049741 Ga0501079_0009679 Ga0501079_0009679_3045_3935 296
310 3300049743 Ga0501081_0012691 Ga0501081_0012691_4297_5187 296
311 3300049824 Ga0501045_0292629 Ga0501045_0292629_28_945 296
312 3300050491 nmdc:mga00v17_146439_c1 nmdc:mga00v17_146439_c1_183_1109 296
313 3300050494 nmdc:mga06z11_174360_c1 nmdc:mga06z11_174360_c1_158_1084 296
314 3300050512 nmdc:mga0n895_109601_c1 nmdc:mga0n895_109601_c1_1305_2219 296
315 3300050514 nmdc:mga08x19_41107_c1 nmdc:mga08x19_41107_c1_1761_2906 296
316 3300053077 Ga0495601_0000001 Ga0495601_0000001_468713_469627 296
317 3300053078 Ga0495612_0000017 Ga0495612_0000017_60498_61412 296
318 3300053084 Ga0495595_0000010 Ga0495595_0000010_87976_88890 296
319 3300053085 Ga0495619_0000004 Ga0495619_0000004_468750_469664 296
320 3300054114 Ga0501084_0026027 Ga0501084_0026027_3239_4129 296
321 3300060353 Ga0501082_0009645 Ga0501082_0009645_1164_2054 296
322 3300061734 Ga0530510_0188081 Ga0530510_0188081_341_1231 296
323 3300006844 Ga0075428_100014981 Ga0075428_1000149819 297
324 3300006847 Ga0075431_100000602 Ga0075431_10000060229 297
325 3300006852 Ga0075433_10056353 Ga0075433_100563532 297
326 3300006871 Ga0075434_100004499 Ga0075434_10000449910 297
327 3300006880 Ga0075429_100005381 Ga0075429_1000053814 297
328 3300007076 Ga0075435_100033979 Ga0075435_1000339792 297
329 3300009094 Ga0111539_10000725 Ga0111539_1000072522 297
330 3300009094 Ga0111539_10013525 Ga0111539_100135258 297
331 3300009147 Ga0114129_10000227 Ga0114129_1000022749 297
332 3300027907 Ga0207428_10005218 Ga0207428_100052187 297
333 3300027907 Ga0207428_10044183 Ga0207428_100441835 297
334 3300031238 Ga0265332_10003990 Ga0265332_100039908 297
335 3300031247 Ga0265340_10004026 Ga0265340_100040263 297
336 3300031249 Ga0265339_10001909 Ga0265339_100019093 297
337 3300031456 Ga0307513_10035639 Ga0307513_100356391 297
338 3300031691 Ga0316579_10013494 Ga0316579_100134942 297
339 3300031711 Ga0265314_10037086 Ga0265314_100370862 297
340 3300031712 Ga0265342_10007249 Ga0265342_100072499 297
341 3300046460 Ga0495638_0007272 Ga0495638_0007272_2069_2962 297
342 3300046518 Ga0495631_0057306 Ga0495631_0057306_50_943 297
343 3300047320 Ga0495672_0125275 Ga0495672_0125275_91_984 297
344 3300049571 Ga0501034_0025281 Ga0501034_0025281_1087_2031 297
345 3300049571 Ga0501034_0252506 Ga0501034_0252506_576_1484 297
346 3300049589 Ga0501073_0129221 Ga0501073_0129221_182_1099 297
347 3300049744 Ga0501083_0112482 Ga0501083_0112482_638_1546 297
348 3300049823 Ga0501044_0192418 Ga0501044_0192418_294_1187 297
349 3300050507 nmdc:mga05p37_76_c1 nmdc:mga05p37_76_c1_85346_86239 297
350 3300050508 nmdc:mga09592_29272_c1 nmdc:mga09592_29272_c1_2587_3480 297
351 3300050509 nmdc:mga0qj67_3805_c1 nmdc:mga0qj67_3805_c1_4341_5234 297
352 3300050510 nmdc:mga06r32_134_c1 nmdc:mga06r32_134_c1_27638_28531 297
353 3300050511 nmdc:mga08y16_961_c1 nmdc:mga08y16_961_c1_21517_22410 297
354 3300050512 nmdc:mga0n895_9151_c1 nmdc:mga0n895_9151_c1_4196_5104 297
355 3300050513 nmdc:mga0rr50_359833_c1 nmdc:mga0rr50_359833_c1_205_1113 297
356 3300050515 nmdc:mga0a205_580_c2 nmdc:mga0a205_580_c2_24798_25706 297
357 3300053096 Ga0500641_0004194 Ga0500641_0004194_2657_3550 297
358 3300053108 Ga0500562_025676 Ga0500562_025676_616_1509 297
359 3300053117 Ga0500593_110529 Ga0500593_110529_184_1089 297
360 3300053146 Ga0500588_0026153 Ga0500588_0026153_477_1370 297
361 3300053153 Ga0500616_0004397 Ga0500616_0004397_6596_7528 297
362 3300054114 Ga0501084_0383858 Ga0501084_0383858_182_1090 297
363 3300060353 Ga0501082_0137714 Ga0501082_0137714_167_1075 297
364 3300005290 Ga0065712_10142110 Ga0065712_101421102 299
365 3300005331 Ga0070670_100367656 Ga0070670_1003676562 299
366 3300005353 Ga0070669_100342027 Ga0070669_1003420271 299
367 3300005356 Ga0070674_100052471 Ga0070674_1000524712 299
368 3300005356 Ga0070674_100246062 Ga0070674_1002460621 299
369 3300005365 Ga0070688_100038185 Ga0070688_1000381852 299
370 3300005445 Ga0070708_100133875 Ga0070708_1001338753 299
371 3300005456 Ga0070678_100276793 Ga0070678_1002767931 299
372 3300005457 Ga0070662_100092740 Ga0070662_1000927402 299
373 3300005459 Ga0068867_100181075 Ga0068867_1001810752 299
374 3300005466 Ga0070685_10065427 Ga0070685_100654272 299
375 3300005539 Ga0068853_100289532 Ga0068853_1002895322 299
376 3300005577 Ga0068857_100103689 Ga0068857_1001036892 299
377 3300005617 Ga0068859_100422355 Ga0068859_1004223552 299
378 3300005618 Ga0068864_100055703 Ga0068864_1000557032 299
379 3300005844 Ga0068862_100206072 Ga0068862_1002060722 299
380 3300006163 Ga0070715_10038460 Ga0070715_100384602 299
381 3300006880 Ga0075429_100388617 Ga0075429_1003886172 299
382 3300006931 Ga0097620_100422337 Ga0097620_1004223371 299
383 3300009148 Ga0105243_10075972 Ga0105243_100759722 299
384 3300013307 Ga0157372_10544207 Ga0157372_105442072 299
385 3300017792 Ga0163161_10130449 Ga0163161_101304492 299
386 3300025893 Ga0207682_10009429 Ga0207682_100094294 299
387 3300025901 Ga0207688_10016460 Ga0207688_100164603 299
388 3300025908 Ga0207643_10051055 Ga0207643_100510552 299
389 3300025923 Ga0207681_10190434 Ga0207681_101904341 299
390 3300025926 Ga0207659_10150000 Ga0207659_101500001 299
391 3300025933 Ga0207706_10012032 Ga0207706_100120329 299
392 3300025935 Ga0207709_10052039 Ga0207709_100520393 299
393 3300025935 Ga0207709_10125475 Ga0207709_101254752 299
394 3300025936 Ga0207670_10051072 Ga0207670_100510722 299
395 3300025937 Ga0207669_10083516 Ga0207669_100835162 299
396 3300025940 Ga0207691_10072859 Ga0207691_100728594 299
397 3300026023 Ga0207677_10288587 Ga0207677_102885872 299
398 3300026041 Ga0207639_10154803 Ga0207639_101548032 299
399 3300026089 Ga0207648_10095256 Ga0207648_100952563 299
400 3300026095 Ga0207676_10689717 Ga0207676_106897171 299
401 3300037853 Ga0436364_1260934 Ga0436364_1260934_247_1149 299
402 3300041408 Ga0439453_0000873 Ga0439453_0000873_1642_2541 299
403 3300042156 Ga0439446_0038782 Ga0439446_0038782_223_1125 299
404 3300046474 Ga0495605_0089714 Ga0495605_0089714_51_950 299
405 3300054114 Ga0501084_0077923 Ga0501084_0077923_1815_2714 299
406 3300060353 Ga0501082_0000510 Ga0501082_0000510_31818_32717 299
407 3300039437 Ga0436365_0480378 Ga0436365_0480378_1175_2077 300
408 3300003203 JGI25406J46586_10047703 JGI25406J46586_100477032 303
409 3300005985 Ga0081539_10009942 Ga0081539_100099428 303
410 3300031235 Ga0265330_10093552 Ga0265330_100935522 303
411 3300031249 Ga0265339_10124982 Ga0265339_101249822 303
412 3300031344 Ga0265316_10180803 Ga0265316_101808031 303
413 3300031595 Ga0265313_10072078 Ga0265313_100720782 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

27

183

0.97

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

27

117

0.93

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

186

307

0.93

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

6

138

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zov-assembly2.cif.gz_B crystal structure of monomeric sarcosine oxidase from bacillus sp. ns-129 0.9599 13 41
4h2n-assembly1.cif.gz_A crystal structure of mhpco, y270f mutant 0.9564 10 41
1vpd-assembly1.cif.gz_A x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] 0.9521 13 302
1kdg-assembly1.cif.gz_B crystal structure of the flavin domain of cellobiose dehydrogenase 0.9456 14 41
3all-assembly1.cif.gz_A crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant y270a 0.9402 10 41
ID Description Score Start End Superfamily
5y8iB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9624 11 170 3.40.50.720
af_F4IAP5_485_617_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9572 172 302 1.10.1040.10
af_A0A1D6LWN3_490_603_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9553 176 281 1.10.1040.10
af_P0A9V8_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9544 14 165 3.40.50.720
af_Q9XTI0_3_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9509 14 170 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6L7NB45-F1-model_v4 NAD(P)-dependent oxidoreductase 0.976 11 303 GO:0016054
GO:0016616
GO:0050661
GO:0051287
AF-A0A158GYG0-F1-model_v4 6-phosphogluconate dehydrogenase, NAD-binding 0.9729 11 300 GO:0016054
GO:0016491
GO:0050661
GO:0051287
AF-A0A327K2K4-F1-model_v4 deleted 0.9713 54 303
AF-A0A6J7IMJ6-F1-model_v4 Unannotated protein 0.9702 12 298 GO:0016491
GO:0050661
GO:0051287
AF-A0A6L7NB45-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9694 11 303 GO:0016054
GO:0016616
GO:0050661
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.97 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map