F437997

General Info

Members Datasets Scaffolds Average Seq Length
413 235 826 167

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100236328|Ga0070705_1002363282
Length 192
Sequence VKVASSHATLSHTVSATASDPQGGSRVTAEATAAEAEVWALLAEVPDPEIPVLSIIDLGIVREVRVGADGRLRVAITPTYSGCPATAVIRAMVRSALDAGGFPHAILEEVLSPPWSSDWLTAAGRDKLRAFGIAPPEETVTSPRQLRSSPGVSCPRCASRDTSCVSEFGSTPCKAHYCCRTCGEPFDYFKCL

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
158 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 2.42
Rhizosphere 93.22
Stem 0
Stem Tuber 0
Unclassified 18.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100236328 3300005440 Bacteria 1274
2 JGI24751J29686_10017167 3300002459 Bacteria 1495
3 rootH2_10006480 3300003320 Bacteria 5678
4 rootH2_10027289 3300003320 Bacteria 8525
5 rootH2_10119399 3300003320 Bacteria 1833
6 rootH2_10178227 3300003320 Bacteria 2378
7 rootL2_10206583 3300003322 Bacteria 1985
8 Ga0065704_10146936 3300005289 Bacteria 1463
9 Ga0065707_10146965 3300005295 Bacteria 1702
10 Ga0070658_10512154 3300005327 Bacteria 1037
11 Ga0070683_100202619 3300005329 Unclassified 1884
12 Ga0070670_100087435 3300005331 Bacteria 2678
13 Ga0070670_100099051 3300005331 Bacteria 2508
14 Ga0070670_100283327 3300005331 Unclassified 1447
15 Ga0070670_100299353 3300005331 Bacteria 1407
16 Ga0070670_100545414 3300005331 Bacteria 1034
17 Ga0070670_100781637 3300005331 Bacteria 861
18 Ga0070670_100823582 3300005331 Bacteria 839
19 Ga0070670_101324355 3300005331 Unclassified 659
20 Ga0068869_100279343 3300005334 Archaea 1342
21 Ga0068869_101110843 3300005334 Bacteria 692
22 Ga0068869_101329014 3300005334 Bacteria 635
23 Ga0068869_101546364 3300005334 Bacteria 590
24 Ga0068869_101698977 3300005334 Unclassified 563
25 Ga0070666_10250383 3300005335 Bacteria 1254
26 Ga0068868_100273863 3300005338 Unclassified 1427
27 Ga0068868_100496670 3300005338 Bacteria 1068
28 Ga0070691_10027677 3300005341 Bacteria 2646
29 Ga0070687_100021540 3300005343 Bacteria 3032
30 Ga0070687_100094723 3300005343 Unclassified 1659
31 Ga0070661_100118016 3300005344 Bacteria 1985
32 Ga0070675_100519810 3300005354 Bacteria 1074
33 Ga0070675_100543709 3300005354 Unclassified 1050
34 Ga0070675_101684074 3300005354 Unclassified 585
35 Ga0070674_100259320 3300005356 Bacteria 1369
36 Ga0070673_100018637 3300005364 Bacteria 4964
37 Ga0070688_100120343 3300005365 Unclassified 1757
38 Ga0070688_100125310 3300005365 Unclassified 1726
39 Ga0070688_100231087 3300005365 Bacteria 1308
40 Ga0070688_100454806 3300005365 Bacteria 958
41 Ga0070659_100683904 3300005366 Bacteria 886
42 Ga0070667_100009523 3300005367 Bacteria 8054
43 Ga0070667_100031829 3300005367 Bacteria 4397
44 Ga0070709_10283899 3300005434 Bacteria 1204
45 Ga0070701_10308849 3300005438 Unclassified 975
46 Ga0070700_100097698 3300005441 Bacteria 1929
47 Ga0070662_100294876 3300005457 Unclassified 1316
48 Ga0068867_100180509 3300005459 Bacteria 1678
49 Ga0070685_10099187 3300005466 Bacteria 1776
50 Ga0070707_100237276 3300005468 Bacteria 1775
51 Ga0070698_100001837 3300005471 Bacteria 23656
52 Ga0070698_100019228 3300005471 Bacteria 7176
53 Ga0070699_100098094 3300005518 Bacteria 2567
54 Ga0070699_100510659 3300005518 Bacteria 1092
55 Ga0070684_100077200 3300005535 Unclassified 2941
56 Ga0068853_100158148 3300005539 Bacteria 2043
57 Ga0068853_100180720 3300005539 Unclassified 1913
58 Ga0068853_100875819 3300005539 Bacteria 862
59 Ga0070672_100116038 3300005543 Bacteria 2187
60 Ga0070686_100298214 3300005544 Unclassified 1194
61 Ga0070696_100378933 3300005546 Bacteria 1102
62 Ga0070704_100704445 3300005549 Unclassified 896
63 Ga0068855_100420501 3300005563 Bacteria 1462
64 Ga0068855_101061787 3300005563 Bacteria 848
65 Ga0070664_100043111 3300005564 Bacteria 3807
66 Ga0070664_100809580 3300005564 Bacteria 876
67 Ga0068857_100048758 3300005577 Bacteria 3758
68 Ga0068857_100289850 3300005577 Bacteria 1507
69 Ga0068857_100906131 3300005577 Unclassified 846
70 Ga0068857_100915799 3300005577 Bacteria 841
71 Ga0068857_101106211 3300005577 Bacteria 765
72 Ga0068857_101433401 3300005577 Bacteria 672
73 Ga0068854_100623137 3300005578 Bacteria 923
74 Ga0068854_101478413 3300005578 Bacteria 616
75 Ga0068856_100263846 3300005614 Bacteria 1738
76 Ga0070702_100362569 3300005615 Bacteria 1024
77 Ga0068852_100006842 3300005616 Bacteria 8283
78 Ga0068852_100040266 3300005616 Bacteria 3941
79 Ga0068852_100069270 3300005616 Bacteria 3091
80 Ga0068852_100072317 3300005616 Bacteria 3030
81 Ga0068852_100089782 3300005616 Bacteria 2747
82 Ga0068859_100052234 3300005617 Bacteria 4109
83 Ga0068859_100360807 3300005617 Unclassified 1548
84 Ga0068859_100687380 3300005617 Bacteria 1114
85 Ga0068859_101811505 3300005617 Bacteria 674
86 Ga0068864_100088337 3300005618 Bacteria 2730
87 Ga0068864_100137703 3300005618 Bacteria 2199
88 Ga0068864_100693669 3300005618 Bacteria 994
89 Ga0068864_100704673 3300005618 Bacteria 986
90 Ga0068864_100879795 3300005618 Bacteria 884
91 Ga0068864_101265584 3300005618 Unclassified 737
92 Ga0068864_101875976 3300005618 Unclassified 605
93 Ga0068861_100029015 3300005719 Bacteria 4042
94 Ga0068851_10016278 3300005834 Bacteria 3557
95 Ga0068863_100176195 3300005841 Bacteria 2052
96 Ga0068858_100476909 3300005842 Bacteria 1204
97 Ga0068860_100002273 3300005843 Bacteria 20185
98 Ga0068860_100032916 3300005843 Bacteria 4978
99 Ga0068860_100078335 3300005843 Bacteria 3143
100 Ga0068862_100223103 3300005844 Unclassified 1707
101 Ga0068862_100251059 3300005844 Unclassified 1612
102 Ga0081539_10000714 3300005985 Bacteria 66625
103 Ga0075364_10024699 3300006051 Bacteria 3818
104 Ga0070716_101357244 3300006173 Unclassified 576
105 Ga0070712_100018080 3300006175 Bacteria 4572
106 Ga0075427_10006358 3300006194 Bacteria 1709
107 Ga0075366_10008014 3300006195 Bacteria 5853
108 Ga0068871_100144080 3300006358 Bacteria 2027
109 Ga0068871_101368276 3300006358 Bacteria 667
110 Ga0075428_100020317 3300006844 Bacteria 7355
111 Ga0075428_100048742 3300006844 Unclassified 4649
112 Ga0075430_100094786 3300006846 Bacteria 2495
113 Ga0075430_100118101 3300006846 Bacteria 2211
114 Ga0075431_100013305 3300006847 Bacteria 8315
115 Ga0075431_100436836 3300006847 Bacteria 1306
116 Ga0075429_100005468 3300006880 Bacteria 10941
117 Ga0075429_100038858 3300006880 Bacteria 4143
118 Ga0075429_100457839 3300006880 Bacteria 1118
119 Ga0068865_100408432 3300006881 Bacteria 1114
120 Ga0068865_100950800 3300006881 Bacteria 750
121 Ga0097620_100052233 3300006931 Bacteria 4109
122 Ga0097620_100360810 3300006931 Unclassified 1548
123 Ga0097620_100687436 3300006931 Bacteria 1114
124 Ga0097620_101811466 3300006931 Bacteria 674
125 Ga0105240_10003432 3300009093 Bacteria 24627
126 Ga0105240_10021639 3300009093 Bacteria 8550
127 Ga0105240_10021850 3300009093 Bacteria 8502
128 Ga0105240_10026958 3300009093 Bacteria 7532
129 Ga0105240_10031691 3300009093 Bacteria 6851
130 Ga0105247_10001649 3300009101 Bacteria 15780
131 Ga0105247_10568625 3300009101 Unclassified 836
132 Ga0114129_10106842 3300009147 Unclassified 3866
133 Ga0114129_10903766 3300009147 Bacteria 1119
134 Ga0105243_10780832 3300009148 Unclassified 939
135 Ga0105241_10603887 3300009174 Bacteria 991
136 Ga0105237_10001993 3300009545 Bacteria 25973
137 Ga0105237_10016613 3300009545 Bacteria 7645
138 Ga0105238_10031002 3300009551 Bacteria 5443
139 Ga0105238_10112861 3300009551 Unclassified 2697
140 Ga0105249_10001666 3300009553 Bacteria 19481
141 Ga0105249_10009544 3300009553 Bacteria 8501
142 Ga0105249_10012047 3300009553 Bacteria 7613
143 Ga0105249_10135279 3300009553 Unclassified 2358
144 Ga0105239_10000488 3300010375 Bacteria 57554
145 Ga0105239_10005650 3300010375 Bacteria 14618
146 Ga0105239_10558204 3300010375 Unclassified 1304
147 Ga0105246_10314856 3300011119 Bacteria 1269
148 Ga0105246_10643337 3300011119 Bacteria 922
149 Ga0105246_10693658 3300011119 Unclassified 891
150 Ga0157373_10264806 3300013100 Unclassified 1216
151 Ga0157370_10019217 3300013104 Bacteria 6862
152 Ga0157370_10108898 3300013104 Bacteria 2590
153 Ga0157369_10016504 3300013105 Bacteria 8305
154 Ga0157369_10046481 3300013105 Bacteria 4717
155 Ga0157374_10219079 3300013296 Unclassified 1867
156 Ga0157378_10019780 3300013297 Bacteria 5922
157 Ga0157378_10275938 3300013297 Unclassified 1619
158 Ga0163162_10014344 3300013306 Bacteria 7743
159 Ga0157372_10033265 3300013307 Bacteria 5660
160 Ga0157372_10049589 3300013307 Bacteria 4669
161 Ga0157372_10293104 3300013307 Unclassified 1892
162 Ga0157372_10581015 3300013307 Bacteria 1306
163 Ga0157372_10780390 3300013307 Bacteria 1111
164 Ga0157375_10276764 3300013308 Bacteria 1841
165 Ga0163163_10437418 3300014325 Bacteria 1367
166 Ga0163163_10786542 3300014325 Bacteria 1015
167 Ga0163163_11516127 3300014325 Unclassified 732
168 Ga0157380_10005494 3300014326 Bacteria 8858
169 Ga0157380_10186692 3300014326 Bacteria 1827
170 Ga0157377_10024171 3300014745 Bacteria 3228
171 Ga0157379_10149422 3300014968 Bacteria 2107
172 Ga0157379_10209413 3300014968 Unclassified 1765
173 Ga0157379_10385515 3300014968 Bacteria 1286
174 Ga0163161_10229476 3300017792 Bacteria 1440
175 Ga0163161_10426514 3300017792 Unclassified 1068
176 Ga0163161_11143750 3300017792 Bacteria 671
177 Ga0213876_10067078 3300021384 Bacteria 1895
178 Ga0207656_10067597 3300025321 Bacteria 1582
179 Ga0207710_10000732 3300025900 Bacteria 18146
180 Ga0207688_10018202 3300025901 Unclassified 3824
181 Ga0207680_10175803 3300025903 Unclassified 1445
182 Ga0207647_10006031 3300025904 Bacteria 8835
183 Ga0207643_10042925 3300025908 Bacteria 2550
184 Ga0207654_10892728 3300025911 Bacteria 644
185 Ga0207695_10001383 3300025913 Bacteria 41051
186 Ga0207695_10002258 3300025913 Bacteria 28855
187 Ga0207695_10044020 3300025913 Bacteria 4752
188 Ga0207695_10111718 3300025913 Unclassified 2712
189 Ga0207671_10012897 3300025914 Bacteria 6691
190 Ga0207693_10024381 3300025915 Bacteria 4800
191 Ga0207662_10072984 3300025918 Bacteria 2081
192 Ga0207657_10890757 3300025919 Unclassified 686
193 Ga0207649_10209787 3300025920 Bacteria 1381
194 Ga0207649_10265497 3300025920 Bacteria 1242
195 Ga0207646_10548168 3300025922 Bacteria 1040
196 Ga0207681_10106489 3300025923 Bacteria 2032
197 Ga0207681_11155653 3300025923 Bacteria 650
198 Ga0207694_10088938 3300025924 Unclassified 2435
199 Ga0207650_10134796 3300025925 Bacteria 1936
200 Ga0207650_10202399 3300025925 Bacteria 1591
201 Ga0207650_10310935 3300025925 Bacteria 1289
202 Ga0207650_10512893 3300025925 Bacteria 1003
203 Ga0207687_10413303 3300025927 Bacteria 1112
204 Ga0207687_10725656 3300025927 Bacteria 844
205 Ga0207644_10052592 3300025931 Bacteria 2928
206 Ga0207709_11025751 3300025935 Unclassified 675
207 Ga0207670_10606408 3300025936 Unclassified 899
208 Ga0207704_10333591 3300025938 Bacteria 1175
209 Ga0207665_10116225 3300025939 Bacteria 1885
210 Ga0207691_10185267 3300025940 Bacteria 1817
211 Ga0207689_10070836 3300025942 Unclassified 2864
212 Ga0207689_10194339 3300025942 Bacteria 1674
213 Ga0207689_11341508 3300025942 Unclassified 600
214 Ga0207661_10038535 3300025944 Bacteria 3747
215 Ga0207661_10307119 3300025944 Unclassified 1423
216 Ga0207679_10084204 3300025945 Unclassified 2440
217 Ga0207667_10001839 3300025949 Bacteria 26648
218 Ga0207667_10548136 3300025949 Bacteria 1170
219 Ga0207667_11091337 3300025949 Unclassified 782
220 Ga0207651_10037182 3300025960 Bacteria 3187
221 Ga0207712_10011056 3300025961 Bacteria 5746
222 Ga0207712_10014745 3300025961 Bacteria 5032
223 Ga0207712_10191443 3300025961 Bacteria 1615
224 Ga0207712_10201369 3300025961 Unclassified 1579
225 Ga0207712_10435477 3300025961 Unclassified 1109
226 Ga0207658_10003271 3300025986 Bacteria 11512
227 Ga0207658_10040901 3300025986 Bacteria 3354
228 Ga0207658_10964965 3300025986 Bacteria 777
229 Ga0207677_10013323 3300026023 Bacteria 4761
230 Ga0207703_10085743 3300026035 Unclassified 2636
231 Ga0207703_10366678 3300026035 Bacteria 1329
232 Ga0207703_10913345 3300026035 Bacteria 841
233 Ga0207639_10153626 3300026041 Bacteria 1931
234 Ga0207639_10685176 3300026041 Bacteria 950
235 Ga0207702_10344037 3300026078 Bacteria 1425
236 Ga0207702_11281674 3300026078 Bacteria 727
237 Ga0207641_10023061 3300026088 Bacteria 5128
238 Ga0207641_10081910 3300026088 Bacteria 2803
239 Ga0207641_10522250 3300026088 Bacteria 1155
240 Ga0207648_10399707 3300026089 Bacteria 1245
241 Ga0207648_10488402 3300026089 Bacteria 1125
242 Ga0207676_10068634 3300026095 Bacteria 2836
243 Ga0207676_10361835 3300026095 Unclassified 1345
244 Ga0207676_10782249 3300026095 Unclassified 930
245 Ga0207676_11526977 3300026095 Bacteria 665
246 Ga0207676_11636438 3300026095 Unclassified 642
247 Ga0207674_10020961 3300026116 Bacteria 7050
248 Ga0207674_10057270 3300026116 Unclassified 3951
249 Ga0207674_10280344 3300026116 Bacteria 1615
250 Ga0207674_10509205 3300026116 Bacteria 1163
251 Ga0207675_100019649 3300026118 Bacteria 6305
252 Ga0207698_10012100 3300026142 Bacteria 5630
253 Ga0209968_1030138 3300027526 Unclassified 905
254 Ga0207428_10151849 3300027907 Bacteria 1763
255 Ga0268265_10120816 3300028380 Unclassified 2158
256 Ga0268265_10202725 3300028380 Unclassified 1722
257 Ga0268264_10001931 3300028381 Bacteria 18678
258 Ga0268264_10010044 3300028381 Bacteria 7836
259 Ga0268264_10446579 3300028381 Unclassified 1252
260 Ga0307515_10000001 3300028794 Bacteria 4259510
261 Ga0265340_10047763 3300031247 Unclassified 2083
262 Ga0265327_10000115 3300031251 Bacteria 173854
263 Ga0316576_10358196 3300031727 Bacteria 1085
264 Ga0307410_10003993 3300031852 Bacteria 7529
265 Ga0307406_10064872 3300031901 Bacteria 2371
266 Ga0307407_10003343 3300031903 Bacteria 6556
267 Ga0307412_10018194 3300031911 Bacteria 4223
268 Ga0307412_10193794 3300031911 Unclassified 1538
269 Ga0307409_100002805 3300031995 Bacteria 9213
270 Ga0307409_100971878 3300031995 Bacteria 866
271 Ga0307416_100054198 3300032002 Unclassified 3222
272 Ga0307414_10274206 3300032004 Bacteria 1414
273 Ga0307411_10044679 3300032005 Bacteria 2844
274 Ga0307415_100024763 3300032126 Bacteria 3754
275 Ga0373937_0437347 3300036401 Unclassified 1242
276 Ga0316584_0046025 3300036712 Bacteria 3258
277 Ga0316584_0114457 3300036712 Bacteria 2018
278 Ga0395899_0000037 3300037312 Bacteria 280224
279 Ga0395900_0006346 3300037418 Bacteria 12331
280 Ga0436364_1415519 3300037853 Bacteria 4758
281 Ga0436365_0838673 3300039437 Bacteria 1540
282 Ga0436365_0946112 3300039437 Bacteria 1144
283 Ga0436365_1871358 3300039437 Bacteria 979
284 Ga0436361_1088555 3300039447 Bacteria 1854
285 Ga0436362_0854317 3300039453 Bacteria 1735
286 Ga0451798_0897735 3300041458 Bacteria 568
287 Ga0439448_0181513 3300042005 Bacteria 736
288 Ga0450920_005240 3300042122 Bacteria 2298
289 Ga0450910_062009 3300042147 Bacteria 632
290 Ga0466969_0006813 3300044656 Bacteria 6078
291 Ga0453683_0083111 3300044673 Unclassified 2006
292 Ga0451576_0168063 3300045051 Bacteria 2289
293 Ga0495627_092630 3300046453 Bacteria 868
294 Ga0495590_0094375 3300046457 Bacteria 1060
295 Ga0495650_0011666 3300046471 Bacteria 4791
296 Ga0495584_0026232 3300046491 Bacteria 2952
297 Ga0495584_0121246 3300046491 Bacteria 1324
298 Ga0495596_0049812 3300046500 Bacteria 1642
299 Ga0495607_0280897 3300046501 Bacteria 790
300 Ga0495631_0377363 3300046518 Bacteria 603
301 Ga0495637_0140805 3300046520 Unclassified 915
302 Ga0495637_0175601 3300046520 Bacteria 797
303 Ga0495643_0075471 3300046522 Bacteria 1764
304 Ga0495643_0345971 3300046522 Bacteria 667
305 Ga0495663_0022998 3300046525 Bacteria 1803
306 Ga0495597_0382281 3300046542 Unclassified 537
307 Ga0495633_0266825 3300046558 Unclassified 780
308 Ga0495668_0190357 3300046616 Bacteria 1124
309 Ga0495611_0028170 3300046648 Unclassified 2459
310 Ga0495659_0009421 3300046664 Bacteria 3116
311 Ga0495669_0133445 3300046684 Bacteria 1170
312 Ga0495649_0141355 3300046694 Bacteria 1267
313 Ga0495589_0072964 3300046794 Unclassified 1676
314 Ga0495589_0167812 3300046794 Bacteria 1044
315 Ga0495672_0008179 3300047320 Bacteria 7758
316 Ga0495685_166759 3300047447 Bacteria 712
317 Ga0495686_0013866 3300047472 Bacteria 5578
318 Ga0495686_0015766 3300047472 Bacteria 5147
319 Ga0495626_0185286 3300048091 Bacteria 861
320 Ga0496101_0796529 3300048904 Bacteria 745
321 Ga0496102_0037024 3300048905 Bacteria 4400
322 Ga0496103_0165652 3300048906 Bacteria 1418
323 Ga0496109_0194598 3300048912 Unclassified 1906
324 Ga0496110_0000565 3300048913 Bacteria 25344
325 Ga0496110_0747729 3300048913 Bacteria 881
326 Ga0496111_0000075 3300048914 Bacteria 41061
327 Ga0496113_0285903 3300048916 Bacteria 1319
328 Ga0496115_0304734 3300048918 Bacteria 1305
329 Ga0496118_0068112 3300048921 Bacteria 2587
330 Ga0501031_0026186 3300049568 Bacteria 3804
331 Ga0501031_0037391 3300049568 Bacteria 3167
332 Ga0501032_0001383 3300049569 Bacteria 19257
333 Ga0501032_0026753 3300049569 Bacteria 3965
334 Ga0501032_0108953 3300049569 Bacteria 1834
335 Ga0501034_0035694 3300049571 Bacteria 5039
336 Ga0501034_0595303 3300049571 Bacteria 1012
337 Ga0501034_1055786 3300049571 Bacteria 694
338 Ga0501036_0001323 3300049572 Bacteria 19023
339 Ga0501036_0010318 3300049572 Bacteria 7708
340 Ga0501037_0229943 3300049573 Bacteria 1302
341 Ga0501037_0314378 3300049573 Bacteria 1085
342 Ga0501038_0004606 3300049574 Bacteria 12825
343 Ga0501038_0011280 3300049574 Bacteria 8159
344 Ga0501038_0023395 3300049574 Bacteria 5524
345 Ga0501039_0001406 3300049575 Bacteria 17703
346 Ga0501040_0034294 3300049576 Bacteria 3439
347 Ga0501041_0456247 3300049577 Bacteria 812
348 Ga0501042_0007611 3300049578 Bacteria 7107
349 Ga0501042_0072469 3300049578 Bacteria 2465
350 Ga0501042_0290871 3300049578 Bacteria 1180
351 Ga0501043_0024212 3300049579 Bacteria 4763
352 Ga0501043_0170202 3300049579 Bacteria 1699
353 Ga0501046_0001757 3300049580 Bacteria 20707
354 Ga0501046_0081730 3300049580 Bacteria 2495
355 Ga0501047_0301385 3300049581 Bacteria 1445
356 Ga0501048_0017159 3300049582 Bacteria 5336
357 Ga0501067_0045321 3300049583 Bacteria 2442
358 Ga0501068_0033813 3300049584 Bacteria 3047
359 Ga0501068_0133102 3300049584 Bacteria 1555
360 Ga0501069_0006616 3300049585 Bacteria 6063
361 Ga0501069_0138590 3300049585 Bacteria 1395
362 Ga0501070_0007346 3300049586 Bacteria 9356
363 Ga0501070_0266032 3300049586 Bacteria 1401
364 Ga0501071_0000363 3300049587 Bacteria 22256
365 Ga0501071_0864318 3300049587 Bacteria 698
366 Ga0501072_0033601 3300049588 Bacteria 4020
367 Ga0501072_0095698 3300049588 Bacteria 2360
368 Ga0501072_0332219 3300049588 Bacteria 1208
369 Ga0501073_0039647 3300049589 Bacteria 3335
370 Ga0501073_0655561 3300049589 Bacteria 724
371 Ga0501074_0002925 3300049590 Bacteria 11992
372 Ga0501075_0080649 3300049591 Bacteria 2463
373 Ga0501076_0003858 3300049592 Bacteria 10557
374 Ga0501076_0300980 3300049592 Bacteria 1315
375 Ga0501076_0403633 3300049592 Bacteria 1124
376 Ga0501209_162661 3300049656 Bacteria 676
377 Ga0501079_0079988 3300049741 Bacteria 2527
378 Ga0501079_0108324 3300049741 Bacteria 2157
379 Ga0501080_0020299 3300049742 Bacteria 6148
380 Ga0501080_0105100 3300049742 Bacteria 2618
381 Ga0501080_0106393 3300049742 Bacteria 2600
382 Ga0501080_0129516 3300049742 Bacteria 2336
383 Ga0501080_0231500 3300049742 Bacteria 1689
384 Ga0501081_0017702 3300049743 Bacteria 4722
385 Ga0501081_0727018 3300049743 Bacteria 746
386 Ga0501083_0006365 3300049744 Bacteria 8367
387 Ga0501083_0566168 3300049744 Unclassified 739
388 Ga0501035_0005022 3300049822 Bacteria 12531
389 Ga0501035_0311901 3300049822 Bacteria 1323
390 Ga0501035_1152495 3300049822 Bacteria 603
391 Ga0501044_0012362 3300049823 Bacteria 9240
392 Ga0501044_0105404 3300049823 Bacteria 2832
393 Ga0501044_0169437 3300049823 Bacteria 2156
394 Ga0501045_0012264 3300049824 Bacteria 6036
395 Ga0501045_0065377 3300049824 Bacteria 2670
396 nmdc:mga0k408_18693_c1 3300050493 Bacteria 3871
397 nmdc:mga0k408_371817_c1 3300050493 Bacteria 852
398 nmdc:mga05p37_164945_c1 3300050507 Bacteria 2704
399 nmdc:mga09592_453716_c1 3300050508 Unclassified 1106
400 nmdc:mga09592_46535_c1 3300050508 Bacteria 3655
401 nmdc:mga09592_93118_c1 3300050508 Bacteria 2577
402 nmdc:mga0qj67_56661_c1 3300050509 Bacteria 3107
403 nmdc:mga06r32_552045_c1 3300050510 Bacteria 1126
404 nmdc:mga06r32_65500_c1 3300050510 Bacteria 3504
405 Ga0500568_0011889 3300053139 Bacteria 4019
406 Ga0500616_0240448 3300053153 Bacteria 779
407 Ga0501084_0303716 3300054114 Bacteria 1348
408 Ga0501084_0838020 3300054114 Bacteria 774
409 Ga0501084_1038378 3300054114 Bacteria 688
410 Ga0501082_0023582 3300060353 Bacteria 5308
411 Ga0501082_0026969 3300060353 Bacteria 4949
412 Ga0530510_0248167 3300061734 Bacteria 1326
413 8055039736 8055037949 Bacteria 3337834
414 Ga0070705_100236328
415 JGI24751J29686_10017167
416 rootH2_10006480
417 rootH2_10027289
418 rootH2_10119399
419 rootH2_10178227
420 rootL2_10206583
421 Ga0065704_10146936
422 Ga0065707_10146965
423 Ga0070658_10512154
424 Ga0070683_100202619
425 Ga0070670_100087435
426 Ga0070670_100099051
427 Ga0070670_100283327
428 Ga0070670_100299353
429 Ga0070670_100545414
430 Ga0070670_100781637
431 Ga0070670_100823582
432 Ga0070670_101324355
433 Ga0068869_100279343
434 Ga0068869_101110843
435 Ga0068869_101329014
436 Ga0068869_101546364
437 Ga0068869_101698977
438 Ga0070666_10250383
439 Ga0068868_100273863
440 Ga0068868_100496670
441 Ga0070691_10027677
442 Ga0070687_100021540
443 Ga0070687_100094723
444 Ga0070661_100118016
445 Ga0070675_100519810
446 Ga0070675_100543709
447 Ga0070675_101684074
448 Ga0070674_100259320
449 Ga0070673_100018637
450 Ga0070688_100120343
451 Ga0070688_100125310
452 Ga0070688_100231087
453 Ga0070688_100454806
454 Ga0070659_100683904
455 Ga0070667_100009523
456 Ga0070667_100031829
457 Ga0070709_10283899
458 Ga0070701_10308849
459 Ga0070700_100097698
460 Ga0070662_100294876
461 Ga0068867_100180509
462 Ga0070685_10099187
463 Ga0070707_100237276
464 Ga0070698_100001837
465 Ga0070698_100019228
466 Ga0070699_100098094
467 Ga0070699_100510659
468 Ga0070684_100077200
469 Ga0068853_100158148
470 Ga0068853_100180720
471 Ga0068853_100875819
472 Ga0070672_100116038
473 Ga0070686_100298214
474 Ga0070696_100378933
475 Ga0070704_100704445
476 Ga0068855_100420501
477 Ga0068855_101061787
478 Ga0070664_100043111
479 Ga0070664_100809580
480 Ga0068857_100048758
481 Ga0068857_100289850
482 Ga0068857_100906131
483 Ga0068857_100915799
484 Ga0068857_101106211
485 Ga0068857_101433401
486 Ga0068854_100623137
487 Ga0068854_101478413
488 Ga0068856_100263846
489 Ga0070702_100362569
490 Ga0068852_100006842
491 Ga0068852_100040266
492 Ga0068852_100069270
493 Ga0068852_100072317
494 Ga0068852_100089782
495 Ga0068859_100052234
496 Ga0068859_100360807
497 Ga0068859_100687380
498 Ga0068859_101811505
499 Ga0068864_100088337
500 Ga0068864_100137703
501 Ga0068864_100693669
502 Ga0068864_100704673
503 Ga0068864_100879795
504 Ga0068864_101265584
505 Ga0068864_101875976
506 Ga0068861_100029015
507 Ga0068851_10016278
508 Ga0068863_100176195
509 Ga0068858_100476909
510 Ga0068860_100002273
511 Ga0068860_100032916
512 Ga0068860_100078335
513 Ga0068862_100223103
514 Ga0068862_100251059
515 Ga0081539_10000714
516 Ga0075364_10024699
517 Ga0070716_101357244
518 Ga0070712_100018080
519 Ga0075427_10006358
520 Ga0075366_10008014
521 Ga0068871_100144080
522 Ga0068871_101368276
523 Ga0075428_100020317
524 Ga0075428_100048742
525 Ga0075430_100094786
526 Ga0075430_100118101
527 Ga0075431_100013305
528 Ga0075431_100436836
529 Ga0075429_100005468
530 Ga0075429_100038858
531 Ga0075429_100457839
532 Ga0068865_100408432
533 Ga0068865_100950800
534 Ga0097620_100052233
535 Ga0097620_100360810
536 Ga0097620_100687436
537 Ga0097620_101811466
538 Ga0105240_10003432
539 Ga0105240_10021639
540 Ga0105240_10021850
541 Ga0105240_10026958
542 Ga0105240_10031691
543 Ga0105247_10001649
544 Ga0105247_10568625
545 Ga0114129_10106842
546 Ga0114129_10903766
547 Ga0105243_10780832
548 Ga0105241_10603887
549 Ga0105237_10001993
550 Ga0105237_10016613
551 Ga0105238_10031002
552 Ga0105238_10112861
553 Ga0105249_10001666
554 Ga0105249_10009544
555 Ga0105249_10012047
556 Ga0105249_10135279
557 Ga0105239_10000488
558 Ga0105239_10005650
559 Ga0105239_10558204
560 Ga0105246_10314856
561 Ga0105246_10643337
562 Ga0105246_10693658
563 Ga0157373_10264806
564 Ga0157370_10019217
565 Ga0157370_10108898
566 Ga0157369_10016504
567 Ga0157369_10046481
568 Ga0157374_10219079
569 Ga0157378_10019780
570 Ga0157378_10275938
571 Ga0163162_10014344
572 Ga0157372_10033265
573 Ga0157372_10049589
574 Ga0157372_10293104
575 Ga0157372_10581015
576 Ga0157372_10780390
577 Ga0157375_10276764
578 Ga0163163_10437418
579 Ga0163163_10786542
580 Ga0163163_11516127
581 Ga0157380_10005494
582 Ga0157380_10186692
583 Ga0157377_10024171
584 Ga0157379_10149422
585 Ga0157379_10209413
586 Ga0157379_10385515
587 Ga0163161_10229476
588 Ga0163161_10426514
589 Ga0163161_11143750
590 Ga0213876_10067078
591 Ga0207656_10067597
592 Ga0207710_10000732
593 Ga0207688_10018202
594 Ga0207680_10175803
595 Ga0207647_10006031
596 Ga0207643_10042925
597 Ga0207654_10892728
598 Ga0207695_10001383
599 Ga0207695_10002258
600 Ga0207695_10044020
601 Ga0207695_10111718
602 Ga0207671_10012897
603 Ga0207693_10024381
604 Ga0207662_10072984
605 Ga0207657_10890757
606 Ga0207649_10209787
607 Ga0207649_10265497
608 Ga0207646_10548168
609 Ga0207681_10106489
610 Ga0207681_11155653
611 Ga0207694_10088938
612 Ga0207650_10134796
613 Ga0207650_10202399
614 Ga0207650_10310935
615 Ga0207650_10512893
616 Ga0207687_10413303
617 Ga0207687_10725656
618 Ga0207644_10052592
619 Ga0207709_11025751
620 Ga0207670_10606408
621 Ga0207704_10333591
622 Ga0207665_10116225
623 Ga0207691_10185267
624 Ga0207689_10070836
625 Ga0207689_10194339
626 Ga0207689_11341508
627 Ga0207661_10038535
628 Ga0207661_10307119
629 Ga0207679_10084204
630 Ga0207667_10001839
631 Ga0207667_10548136
632 Ga0207667_11091337
633 Ga0207651_10037182
634 Ga0207712_10011056
635 Ga0207712_10014745
636 Ga0207712_10191443
637 Ga0207712_10201369
638 Ga0207712_10435477
639 Ga0207658_10003271
640 Ga0207658_10040901
641 Ga0207658_10964965
642 Ga0207677_10013323
643 Ga0207703_10085743
644 Ga0207703_10366678
645 Ga0207703_10913345
646 Ga0207639_10153626
647 Ga0207639_10685176
648 Ga0207702_10344037
649 Ga0207702_11281674
650 Ga0207641_10023061
651 Ga0207641_10081910
652 Ga0207641_10522250
653 Ga0207648_10399707
654 Ga0207648_10488402
655 Ga0207676_10068634
656 Ga0207676_10361835
657 Ga0207676_10782249
658 Ga0207676_11526977
659 Ga0207676_11636438
660 Ga0207674_10020961
661 Ga0207674_10057270
662 Ga0207674_10280344
663 Ga0207674_10509205
664 Ga0207675_100019649
665 Ga0207698_10012100
666 Ga0209968_1030138
667 Ga0207428_10151849
668 Ga0268265_10120816
669 Ga0268265_10202725
670 Ga0268264_10001931
671 Ga0268264_10010044
672 Ga0268264_10446579
673 Ga0307515_10000001
674 Ga0265340_10047763
675 Ga0265327_10000115
676 Ga0316576_10358196
677 Ga0307410_10003993
678 Ga0307406_10064872
679 Ga0307407_10003343
680 Ga0307412_10018194
681 Ga0307412_10193794
682 Ga0307409_100002805
683 Ga0307409_100971878
684 Ga0307416_100054198
685 Ga0307414_10274206
686 Ga0307411_10044679
687 Ga0307415_100024763
688 Ga0373937_0437347
689 Ga0316584_0046025
690 Ga0316584_0114457
691 Ga0395899_0000037
692 Ga0395900_0006346
693 Ga0436364_1415519
694 Ga0436365_0838673
695 Ga0436365_0946112
696 Ga0436365_1871358
697 Ga0436361_1088555
698 Ga0436362_0854317
699 Ga0451798_0897735
700 Ga0439448_0181513
701 Ga0450920_005240
702 Ga0450910_062009
703 Ga0466969_0006813
704 Ga0453683_0083111
705 Ga0451576_0168063
706 Ga0495627_092630
707 Ga0495590_0094375
708 Ga0495650_0011666
709 Ga0495584_0026232
710 Ga0495584_0121246
711 Ga0495596_0049812
712 Ga0495607_0280897
713 Ga0495631_0377363
714 Ga0495637_0140805
715 Ga0495637_0175601
716 Ga0495643_0075471
717 Ga0495643_0345971
718 Ga0495663_0022998
719 Ga0495597_0382281
720 Ga0495633_0266825
721 Ga0495668_0190357
722 Ga0495611_0028170
723 Ga0495659_0009421
724 Ga0495669_0133445
725 Ga0495649_0141355
726 Ga0495589_0072964
727 Ga0495589_0167812
728 Ga0495672_0008179
729 Ga0495685_166759
730 Ga0495686_0013866
731 Ga0495686_0015766
732 Ga0495626_0185286
733 Ga0496101_0796529
734 Ga0496102_0037024
735 Ga0496103_0165652
736 Ga0496109_0194598
737 Ga0496110_0000565
738 Ga0496110_0747729
739 Ga0496111_0000075
740 Ga0496113_0285903
741 Ga0496115_0304734
742 Ga0496118_0068112
743 Ga0501031_0026186
744 Ga0501031_0037391
745 Ga0501032_0001383
746 Ga0501032_0026753
747 Ga0501032_0108953
748 Ga0501034_0035694
749 Ga0501034_0595303
750 Ga0501034_1055786
751 Ga0501036_0001323
752 Ga0501036_0010318
753 Ga0501037_0229943
754 Ga0501037_0314378
755 Ga0501038_0004606
756 Ga0501038_0011280
757 Ga0501038_0023395
758 Ga0501039_0001406
759 Ga0501040_0034294
760 Ga0501041_0456247
761 Ga0501042_0007611
762 Ga0501042_0072469
763 Ga0501042_0290871
764 Ga0501043_0024212
765 Ga0501043_0170202
766 Ga0501046_0001757
767 Ga0501046_0081730
768 Ga0501047_0301385
769 Ga0501048_0017159
770 Ga0501067_0045321
771 Ga0501068_0033813
772 Ga0501068_0133102
773 Ga0501069_0006616
774 Ga0501069_0138590
775 Ga0501070_0007346
776 Ga0501070_0266032
777 Ga0501071_0000363
778 Ga0501071_0864318
779 Ga0501072_0033601
780 Ga0501072_0095698
781 Ga0501072_0332219
782 Ga0501073_0039647
783 Ga0501073_0655561
784 Ga0501074_0002925
785 Ga0501075_0080649
786 Ga0501076_0003858
787 Ga0501076_0300980
788 Ga0501076_0403633
789 Ga0501209_162661
790 Ga0501079_0079988
791 Ga0501079_0108324
792 Ga0501080_0020299
793 Ga0501080_0105100
794 Ga0501080_0106393
795 Ga0501080_0129516
796 Ga0501080_0231500
797 Ga0501081_0017702
798 Ga0501081_0727018
799 Ga0501083_0006365
800 Ga0501083_0566168
801 Ga0501035_0005022
802 Ga0501035_0311901
803 Ga0501035_1152495
804 Ga0501044_0012362
805 Ga0501044_0105404
806 Ga0501044_0169437
807 Ga0501045_0012264
808 Ga0501045_0065377
809 nmdc:mga0k408_18693_c1
810 nmdc:mga0k408_371817_c1
811 nmdc:mga05p37_164945_c1
812 nmdc:mga09592_453716_c1
813 nmdc:mga09592_46535_c1
814 nmdc:mga09592_93118_c1
815 nmdc:mga0qj67_56661_c1
816 nmdc:mga06r32_552045_c1
817 nmdc:mga06r32_65500_c1
818 Ga0500568_0011889
819 Ga0500616_0240448
820 Ga0501084_0303716
821 Ga0501084_0838020
822 Ga0501084_1038378
823 Ga0501082_0023582
824 Ga0501082_0026969
825 Ga0530510_0248167
826 8055039736

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

35

101

0.96

PF23451

138

190

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.9139 9 100
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8912 11 100
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.87 9 95
6tbl-assembly1.cif.gz_C crystal structure of mms19(ctd)-ciao1-ciao2b cia targeting complex 0.8337 7 86
6tc0-assembly1.cif.gz_B crystal structure of mms19-ciao1-ciao2b cia targeting complex 0.8329 7 86
ID Description Score Start End Superfamily
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9641 9 101 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9257 18 100 3.30.300.130
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9163 9 101 3.30.300.130
3cq2B00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8893 11 100 3.30.300.130
af_Q8II78_18_117_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8891 8 82 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A7C4U3U0-F1-model_v4 DUF59 domain-containing protein 0.9784 1 97
AF-A0A497XU03-F1-model_v4 Uncharacterized protein DUF59 0.9743 9 82
AF-A0A7C4I9R1-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9741 11 108
AF-A0A3C1R503-F1-model_v4 deleted 0.9708 9 82
AF-A0A521MZN9-F1-model_v4 DUF59 domain-containing protein 0.9688 9 101

Map