F437993

General Info

Members Datasets Scaffolds Average Seq Length
413 281 826 148

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_101226295|Ga0070659_1012262951
Length 172
Sequence MRRSRHASSRWCAARRADVTTSSPFSERGSTQAVEEGRTLSPKFDANGLVTCVATDAANGDVLMVAHMNAEALARTIETGEAWYYSRSRRALWRKGESSGHVQRVLELRIDCDQDAVWIKVEQAGAGACHTGRRSCFYRAVPLGRAPDASLTLGFVEAERAFDPAKVYRKTD

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
270 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
275 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2791355199
281 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.99
Nodule 0.24
Rhizoplane 5.57
Rhizosphere 80.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_101226295 3300005366 Bacteria 664
2 LJQas_1003658 3300000549 Bacteria 2042
3 JGI25404J52841_10049432 3300003659 Bacteria 885
4 Ga0070676_10123074 3300005328 Bacteria 1631
5 Ga0070670_100210244 3300005331 Bacteria 1691
6 Ga0070670_100393521 3300005331 Bacteria 1222
7 Ga0070689_100235134 3300005340 Bacteria 1507
8 Ga0070689_100787289 3300005340 Bacteria 835
9 Ga0070687_100035259 3300005343 Bacteria 2483
10 Ga0070669_100474272 3300005353 Bacteria 1034
11 Ga0070669_100906902 3300005353 Bacteria 753
12 Ga0070675_100085888 3300005354 Bacteria 2629
13 Ga0070674_100046225 3300005356 Bacteria 2977
14 Ga0070673_100855844 3300005364 Bacteria 841
15 Ga0070688_100211127 3300005365 Bacteria 1363
16 Ga0070688_100488477 3300005365 Bacteria 927
17 Ga0070709_10413310 3300005434 Bacteria 1010
18 Ga0070714_100079095 3300005435 Bacteria 2858
19 Ga0070710_10317473 3300005437 Bacteria 1022
20 Ga0070700_100147395 3300005441 Bacteria 1606
21 Ga0070708_100389212 3300005445 Bacteria 1315
22 Ga0070678_100037739 3300005456 Bacteria 3395
23 Ga0070662_100014414 3300005457 Bacteria 5282
24 Ga0070685_10064838 3300005466 Bacteria 2149
25 Ga0070706_101249624 3300005467 Bacteria 682
26 Ga0070707_100186497 3300005468 Bacteria 2022
27 Ga0070684_101343624 3300005535 Bacteria 673
28 Ga0070697_100057741 3300005536 Bacteria 3157
29 Ga0070672_100013768 3300005543 Bacteria 5719
30 Ga0070704_100627315 3300005549 Bacteria 947
31 Ga0070664_100097714 3300005564 Bacteria 2550
32 Ga0070664_100475877 3300005564 Bacteria 1149
33 Ga0070664_101638115 3300005564 Bacteria 610
34 Ga0068857_101024563 3300005577 Bacteria 795
35 Ga0068857_101947274 3300005577 Bacteria 576
36 Ga0070702_100564782 3300005615 Bacteria 847
37 Ga0068852_100841833 3300005616 Bacteria 933
38 Ga0068859_101376583 3300005617 Bacteria 778
39 Ga0068866_10695751 3300005718 Bacteria 697
40 Ga0068861_101622289 3300005719 Bacteria 638
41 Ga0068870_10422094 3300005840 Bacteria 873
42 Ga0068863_100935903 3300005841 Bacteria 868
43 Ga0068863_100967717 3300005841 Bacteria 853
44 Ga0068863_101720145 3300005841 Bacteria 637
45 Ga0068858_100035260 3300005842 Bacteria 4641
46 Ga0068862_101077751 3300005844 Bacteria 798
47 Ga0081455_10003765 3300005937 Bacteria 17311
48 Ga0081538_10004959 3300005981 Bacteria 12125
49 Ga0081540_1007807 3300005983 Bacteria 7570
50 Ga0081540_1027904 3300005983 Bacteria 3186
51 Ga0081540_1039007 3300005983 Bacteria 2495
52 Ga0081539_10044298 3300005985 Bacteria 2570
53 Ga0075365_10335312 3300006038 Bacteria 1065
54 Ga0075363_100024515 3300006048 Bacteria 3067
55 Ga0075363_100118086 3300006048 Bacteria 1479
56 Ga0075363_100329655 3300006048 Bacteria 889
57 Ga0075364_10012821 3300006051 Bacteria 5141
58 Ga0070712_100273522 3300006175 Bacteria 1358
59 Ga0075362_10021015 3300006177 Bacteria 2734
60 Ga0075367_10041625 3300006178 Bacteria 2686
61 Ga0075367_10128437 3300006178 Bacteria 1566
62 Ga0075367_10227877 3300006178 Bacteria 1167
63 Ga0075369_10289696 3300006186 Bacteria 763
64 Ga0075366_10009172 3300006195 Bacteria 5517
65 Ga0075366_10620130 3300006195 Bacteria 671
66 Ga0075428_100003465 3300006844 Bacteria 17265
67 Ga0075428_100279428 3300006844 Bacteria 1797
68 Ga0075430_100021400 3300006846 Bacteria 5498
69 Ga0075431_100000053 3300006847 Bacteria 62977
70 Ga0075431_100591325 3300006847 Bacteria 1094
71 Ga0075434_100049791 3300006871 Bacteria 4161
72 Ga0075429_100046226 3300006880 Bacteria 3788
73 Ga0075436_100510661 3300006914 Bacteria 880
74 Ga0097620_101376693 3300006931 Bacteria 778
75 Ga0075435_100177511 3300007076 Bacteria 1799
76 Ga0099795_10001567 3300007788 Bacteria 5035
77 Ga0099795_10353744 3300007788 Bacteria 658
78 Ga0099795_10516867 3300007788 Bacteria 559
79 Ga0105240_10517491 3300009093 Bacteria 1325
80 Ga0105240_12146354 3300009093 Bacteria 579
81 Ga0111539_10005010 3300009094 Bacteria 17222
82 Ga0111539_10360484 3300009094 Bacteria 1692
83 Ga0105245_10064302 3300009098 Bacteria 3315
84 Ga0114129_10000237 3300009147 Bacteria 61463
85 Ga0105243_10657022 3300009148 Bacteria 1017
86 Ga0105243_11385998 3300009148 Bacteria 723
87 Ga0105241_10016431 3300009174 Bacteria 5428
88 Ga0105237_10216251 3300009545 Bacteria 1916
89 Ga0105249_10184232 3300009553 Bacteria 2033
90 Ga0105249_10524184 3300009553 Bacteria 1233
91 Ga0099796_10000148 3300010159 Bacteria 10406
92 Ga0105239_10608532 3300010375 Bacteria 1247
93 Ga0157374_12378240 3300013296 Bacteria 557
94 Ga0157378_10426336 3300013297 Bacteria 1312
95 Ga0157375_11215541 3300013308 Bacteria 884
96 Ga0157375_11235848 3300013308 Bacteria 877
97 Ga0163163_10028429 3300014325 Bacteria 5369
98 Ga0157380_10245052 3300014326 Bacteria 1618
99 Ga0157380_10700734 3300014326 Bacteria 1017
100 Ga0157377_10624739 3300014745 Bacteria 772
101 Ga0157376_10172928 3300014969 Bacteria 1968
102 Ga0157376_10182500 3300014969 Bacteria 1919
103 Ga0213876_10217466 3300021384 Bacteria 1016
104 Ga0213875_10000117 3300021388 Bacteria 89143
105 Ga0207697_10229771 3300025315 Bacteria 819
106 Ga0207682_10001644 3300025893 Bacteria 10243
107 Ga0207642_10373467 3300025899 Bacteria 847
108 Ga0207699_10625255 3300025906 Bacteria 785
109 Ga0207684_10408879 3300025910 Bacteria 1166
110 Ga0207684_11259352 3300025910 Bacteria 610
111 Ga0207693_10395404 3300025915 Bacteria 1081
112 Ga0207660_10355347 3300025917 Bacteria 1175
113 Ga0207662_10158487 3300025918 Bacteria 1444
114 Ga0207662_10501477 3300025918 Bacteria 836
115 Ga0207649_10529150 3300025920 Bacteria 900
116 Ga0207646_10151043 3300025922 Bacteria 2095
117 Ga0207681_10039441 3300025923 Bacteria 3136
118 Ga0207659_10358046 3300025926 Bacteria 1212
119 Ga0207687_10054578 3300025927 Bacteria 2796
120 Ga0207664_10201406 3300025929 Bacteria 1718
121 Ga0207706_10165964 3300025933 Bacteria 1940
122 Ga0207670_11310044 3300025936 Bacteria 614
123 Ga0207669_10291143 3300025937 Bacteria 1236
124 Ga0207665_10100246 3300025939 Bacteria 2021
125 Ga0207691_10045323 3300025940 Bacteria 4043
126 Ga0207661_10040544 3300025944 Bacteria 3661
127 Ga0207661_10492138 3300025944 Bacteria 1120
128 Ga0207679_10132122 3300025945 Bacteria 2004
129 Ga0207679_10435721 3300025945 Bacteria 1160
130 Ga0207651_10160672 3300025960 Bacteria 1761
131 Ga0207651_10384847 3300025960 Bacteria 1190
132 Ga0207712_10613581 3300025961 Bacteria 942
133 Ga0207640_10184423 3300025981 Bacteria 1567
134 Ga0207658_10083023 3300025986 Bacteria 2462
135 Ga0207708_10040472 3300026075 Bacteria 3553
136 Ga0207641_10561513 3300026088 Bacteria 1114
137 Ga0207648_10023096 3300026089 Bacteria 5578
138 Ga0207648_10525759 3300026089 Bacteria 1084
139 Ga0207675_100302450 3300026118 Bacteria 1558
140 Ga0207683_10004995 3300026121 Bacteria 11395
141 Ga0207683_10555704 3300026121 Bacteria 1061
142 Ga0209179_1009744 3300027512 Bacteria 1656
143 Ga0209813_10262337 3300027866 Bacteria 660
144 Ga0207428_10834125 3300027907 Bacteria 654
145 Ga0268266_10231263 3300028379 Bacteria 1703
146 Ga0268264_10651219 3300028381 Bacteria 1042
147 Ga0265318_10069922 3300028577 Bacteria 1301
148 Ga0265330_10107876 3300031235 Bacteria 1190
149 Ga0265328_10016097 3300031239 Bacteria 2916
150 Ga0265320_10028300 3300031240 Bacteria 2911
151 Ga0265329_10049179 3300031242 Bacteria 1344
152 Ga0265329_10270550 3300031242 Bacteria 570
153 Ga0265339_10086772 3300031249 Bacteria 1646
154 Ga0265331_10028736 3300031250 Bacteria 2779
155 Ga0265316_10374837 3300031344 Bacteria 1027
156 Ga0307513_10141459 3300031456 Bacteria 2332
157 Ga0307509_10533191 3300031507 Bacteria 854
158 Ga0307408_101329910 3300031548 Bacteria 674
159 Ga0265313_10062367 3300031595 Bacteria 1741
160 Ga0265313_10094146 3300031595 Bacteria 1339
161 Ga0307508_10000021 3300031616 Bacteria 183823
162 Ga0265314_10057915 3300031711 Bacteria 2657
163 Ga0265342_10019289 3300031712 Bacteria 4398
164 Ga0265342_10130171 3300031712 Bacteria 1411
165 Ga0307405_10204291 3300031731 Bacteria 1437
166 Ga0307413_10134866 3300031824 Bacteria 1696
167 Ga0307410_10447257 3300031852 Bacteria 1053
168 Ga0307406_10424804 3300031901 Bacteria 1060
169 Ga0307409_100177132 3300031995 Bacteria 1883
170 Ga0307416_101548786 3300032002 Bacteria 768
171 Ga0307411_10644924 3300032005 Bacteria 916
172 Ga0307415_100568794 3300032126 Bacteria 1003
173 Ga0307415_101035913 3300032126 Bacteria 765
174 Ga0373928_0135409 3300035084 Bacteria 671
175 Ga0373923_0202064 3300035111 Bacteria 919
176 Ga0373923_0282516 3300035111 Bacteria 782
177 Ga0373936_0009414 3300035113 Bacteria 3683
178 Ga0373954_0099464 3300035118 Bacteria 1402
179 Ga0373946_0005979 3300035171 Bacteria 4412
180 Ga0373946_0472351 3300035171 Bacteria 641
181 Ga0373942_0090693 3300035207 Bacteria 921
182 Ga0373931_0264994 3300035691 Bacteria 1050
183 Ga0373931_0591567 3300035691 Bacteria 724
184 Ga0373927_0001314 3300035695 Bacteria 18769
185 Ga0373927_0053315 3300035695 Bacteria 2616
186 Ga0373933_0001657 3300035724 Bacteria 12952
187 Ga0373933_0857665 3300035724 Bacteria 598
188 Ga0373947_0014848 3300035725 Bacteria 4469
189 Ga0373937_0035531 3300036401 Bacteria 4537
190 Ga0373925_0006671 3300037068 Bacteria 8469
191 Ga0373925_0187764 3300037068 Bacteria 1639
192 Ga0395899_0028227 3300037312 Bacteria 4226
193 Ga0395900_0037063 3300037418 Bacteria 5028
194 Ga0395900_0584775 3300037418 Bacteria 1058
195 Ga0395900_1165844 3300037418 Bacteria 686
196 Ga0395898_0043857 3300037466 Bacteria 4406
197 Ga0395905_1277586 3300037471 Bacteria 638
198 Ga0436364_0410618 3300037853 Bacteria 84995
199 Ga0436364_0507763 3300037853 Bacteria 906
200 Ga0395901_0071394 3300038443 Bacteria 3618
201 Ga0395901_0576537 3300038443 Bacteria 1137
202 Ga0395901_0769746 3300038443 Bacteria 954
203 Ga0436365_0381143 3300039437 Bacteria 1053
204 Ga0436365_0908038 3300039437 Bacteria 794
205 Ga0436365_1218444 3300039437 Bacteria 1905
206 Ga0436365_1292215 3300039437 Bacteria 865
207 Ga0436360_0633247 3300039438 Bacteria 1015
208 Ga0436363_1033110 3300039450 Bacteria 527
209 Ga0436363_1365341 3300039450 Bacteria 848
210 Ga0451789_1345995 3300041443 Bacteria 670
211 Ga0451807_2507308 3300041486 Bacteria 587
212 Ga0451837_1409921 3300041494 Bacteria 1238
213 Ga0495592_0603674 3300046454 Bacteria 669
214 Ga0495603_0085256 3300046455 Bacteria 1849
215 Ga0495629_0004330 3300046459 Bacteria 10642
216 Ga0495629_0931020 3300046459 Bacteria 568
217 Ga0495641_0041537 3300046461 Bacteria 2136
218 Ga0495651_0282878 3300046462 Bacteria 1120
219 Ga0495653_0036342 3300046463 Bacteria 3880
220 Ga0495580_0006344 3300046472 Bacteria 9647
221 Ga0495582_0005475 3300046473 Bacteria 7075
222 Ga0495639_0000750 3300046475 Bacteria 14821
223 Ga0495662_0002275 3300046476 Bacteria 9684
224 Ga0495594_0005644 3300046499 Bacteria 6435
225 Ga0495608_0143486 3300046511 Bacteria 1523
226 Ga0495628_0033673 3300046516 Bacteria 4127
227 Ga0495628_0210269 3300046516 Bacteria 1464
228 Ga0495630_0361831 3300046517 Bacteria 1111
229 Ga0495644_0004775 3300046523 Bacteria 5323
230 Ga0495666_0022190 3300046526 Bacteria 3143
231 Ga0495654_0366583 3300046530 Bacteria 577
232 Ga0495665_0044110 3300046531 Bacteria 2370
233 Ga0495640_0007861 3300046533 Bacteria 8385
234 Ga0495586_0319752 3300046535 Bacteria 890
235 Ga0495587_0425725 3300046536 Bacteria 736
236 Ga0495667_0348498 3300046559 Bacteria 936
237 Ga0495634_0001188 3300046642 Bacteria 24100
238 Ga0495625_0678333 3300046660 Bacteria 611
239 Ga0495635_0051580 3300046663 Bacteria 2834
240 Ga0495588_0188400 3300046674 Bacteria 1090
241 Ga0495599_0577402 3300046678 Bacteria 656
242 Ga0495646_0070861 3300046680 Bacteria 2052
243 Ga0495658_0005872 3300046683 Bacteria 6026
244 Ga0495613_0129838 3300046689 Bacteria 1805
245 Ga0495613_0195594 3300046689 Bacteria 1428
246 Ga0495624_0021125 3300046690 Bacteria 4322
247 Ga0495671_0078168 3300046692 Bacteria 1622
248 Ga0495600_0402079 3300046809 Bacteria 852
249 Ga0495581_0000567 3300047315 Bacteria 19221
250 Ga0495604_0230119 3300047317 Bacteria 1272
251 Ga0495674_0050770 3300047319 Bacteria 3659
252 Ga0495672_0175412 3300047320 Bacteria 1089
253 Ga0495676_0136503 3300047321 Bacteria 1763
254 Ga0495685_043275 3300047447 Bacteria 1537
255 Ga0495593_0013868 3300047673 Bacteria 4590
256 Ga0495593_0132216 3300047673 Bacteria 1266
257 Ga0495602_0155798 3300048088 Bacteria 1789
258 Ga0495614_0034476 3300048089 Bacteria 2176
259 Ga0496101_0498732 3300048904 Bacteria 962
260 Ga0496102_0023430 3300048905 Bacteria 5484
261 Ga0496103_0271208 3300048906 Bacteria 1091
262 Ga0496105_0390245 3300048908 Bacteria 1107
263 Ga0496105_0726371 3300048908 Bacteria 760
264 Ga0496106_0294961 3300048909 Bacteria 1300
265 Ga0496106_0409570 3300048909 Bacteria 1090
266 Ga0496107_0196976 3300048910 Bacteria 1497
267 Ga0496107_0426319 3300048910 Bacteria 986
268 Ga0496108_0384191 3300048911 Bacteria 1226
269 Ga0496108_0431887 3300048911 Bacteria 1150
270 Ga0496109_0050539 3300048912 Bacteria 3786
271 Ga0496110_0040514 3300048913 Bacteria 4059
272 Ga0496110_0703374 3300048913 Bacteria 912
273 Ga0496111_0240589 3300048914 Bacteria 1344
274 Ga0496112_0007967 3300048915 Bacteria 9447
275 Ga0496113_0006909 3300048916 Bacteria 7246
276 Ga0496114_0234033 3300048917 Bacteria 1614
277 Ga0496115_0021569 3300048918 Bacteria 4977
278 Ga0496115_0043560 3300048918 Bacteria 3580
279 Ga0496115_0266791 3300048918 Bacteria 1407
280 Ga0496118_0109870 3300048921 Bacteria 1834
281 Ga0496120_0299732 3300048923 Bacteria 737
282 Ga0496121_0003065 3300048924 Bacteria 24225
283 Ga0496126_0044419 3300048929 Bacteria 4092
284 Ga0496126_0448906 3300048929 Bacteria 1038
285 Ga0496126_0847173 3300048929 Bacteria 697
286 Ga0496126_1077314 3300048929 Bacteria 598
287 Ga0501031_0647381 3300049568 Bacteria 679
288 Ga0501032_0004449 3300049569 Bacteria 10567
289 Ga0501032_0382828 3300049569 Bacteria 905
290 Ga0501033_0001618 3300049570 Bacteria 19786
291 Ga0501033_0155758 3300049570 Bacteria 1646
292 Ga0501033_0549733 3300049570 Bacteria 795
293 Ga0501034_0000061 3300049571 Bacteria 195178
294 Ga0501034_0264024 3300049571 Bacteria 1664
295 Ga0501034_0470687 3300049571 Bacteria 1172
296 Ga0501034_1529934 3300049571 Bacteria 541
297 Ga0501036_0000054 3300049572 Bacteria 74190
298 Ga0501036_0102209 3300049572 Bacteria 2425
299 Ga0501036_0555085 3300049572 Bacteria 954
300 Ga0501036_1381868 3300049572 Bacteria 571
301 Ga0501036_1630181 3300049572 Bacteria 521
302 Ga0501037_0000093 3300049573 Bacteria 83246
303 Ga0501037_0152040 3300049573 Bacteria 1654
304 Ga0501038_0000066 3300049574 Bacteria 86216
305 Ga0501038_0154674 3300049574 Bacteria 1868
306 Ga0501038_0358680 3300049574 Bacteria 1134
307 Ga0501038_0614268 3300049574 Bacteria 821
308 Ga0501039_0019038 3300049575 Bacteria 5267
309 Ga0501039_0039396 3300049575 Bacteria 3650
310 Ga0501039_1072172 3300049575 Bacteria 625
311 Ga0501040_0182724 3300049576 Bacteria 1487
312 Ga0501041_0042022 3300049577 Bacteria 2777
313 Ga0501041_0308346 3300049577 Bacteria 998
314 Ga0501042_0026073 3300049578 Bacteria 4109
315 Ga0501042_0484414 3300049578 Bacteria 898
316 Ga0501043_0000325 3300049579 Bacteria 43003
317 Ga0501043_0005165 3300049579 Bacteria 10563
318 Ga0501043_0514036 3300049579 Bacteria 893
319 Ga0501043_0574237 3300049579 Bacteria 835
320 Ga0501043_0626861 3300049579 Bacteria 792
321 Ga0501046_0005977 3300049580 Bacteria 10832
322 Ga0501046_0010906 3300049580 Bacteria 7788
323 Ga0501046_0188009 3300049580 Bacteria 1542
324 Ga0501046_0266797 3300049580 Bacteria 1256
325 Ga0501047_0000621 3300049581 Bacteria 37465
326 Ga0501047_0189262 3300049581 Bacteria 1922
327 Ga0501047_0339167 3300049581 Bacteria 1341
328 Ga0501048_0001552 3300049582 Bacteria 17450
329 Ga0501048_1344646 3300049582 Bacteria 513
330 Ga0501067_0000118 3300049583 Bacteria 44933
331 Ga0501067_0177469 3300049583 Bacteria 1186
332 Ga0501067_0593392 3300049583 Bacteria 621
333 Ga0501068_0000133 3300049584 Bacteria 33616
334 Ga0501070_0002284 3300049586 Bacteria 16847
335 Ga0501070_0143353 3300049586 Bacteria 1972
336 Ga0501070_0470828 3300049586 Bacteria 1011
337 Ga0501070_0612560 3300049586 Bacteria 867
338 Ga0501071_0294575 3300049587 Bacteria 1229
339 Ga0501071_1035281 3300049587 Bacteria 634
340 Ga0501072_0007487 3300049588 Bacteria 8285
341 Ga0501072_0014489 3300049588 Bacteria 6043
342 Ga0501072_0065326 3300049588 Bacteria 2869
343 Ga0501073_0002382 3300049589 Bacteria 14070
344 Ga0501074_0001116 3300049590 Bacteria 17526
345 Ga0501074_0404405 3300049590 Bacteria 968
346 Ga0501075_0146685 3300049591 Bacteria 1798
347 Ga0501076_0139347 3300049592 Bacteria 1970
348 Ga0501079_0016271 3300049741 Bacteria 5684
349 Ga0501079_0064005 3300049741 Bacteria 2837
350 Ga0501080_0001100 3300049742 Bacteria 22276
351 Ga0501080_0153892 3300049742 Bacteria 2124
352 Ga0501080_0804090 3300049742 Bacteria 824
353 Ga0501083_0000331 3300049744 Bacteria 29941
354 Ga0501083_0124864 3300049744 Bacteria 1687
355 Ga0501083_0443262 3300049744 Bacteria 845
356 Ga0501035_0000099 3300049822 Bacteria 108224
357 Ga0501035_0570070 3300049822 Bacteria 925
358 Ga0501044_0000367 3300049823 Bacteria 56521
359 Ga0501044_0024349 3300049823 Bacteria 6429
360 Ga0501044_0197425 3300049823 Bacteria 1971
361 Ga0501044_0328002 3300049823 Bacteria 1454
362 Ga0501044_0537123 3300049823 Bacteria 1068
363 Ga0501045_0214555 3300049824 Bacteria 1433
364 nmdc:mga03n38_243805_c1 3300050490 Bacteria 947
365 nmdc:mga00v17_9993_c1 3300050491 Bacteria 5162
366 nmdc:mga0yw44_50093_c1 3300050492 Bacteria 2524
367 nmdc:mga0k408_106216_c1 3300050493 Bacteria 1658
368 nmdc:mga0k408_5677_c1 3300050493 Bacteria 6633
369 nmdc:mga06z11_23153_c1 3300050494 Bacteria 2913
370 nmdc:mga06z11_487324_c1 3300050494 Bacteria 746
371 nmdc:mga04h51_294377_c1 3300050495 Bacteria 660
372 nmdc:mga04h51_38133_c1 3300050495 Bacteria 1554
373 nmdc:mga05p37_555_c1 3300050507 Bacteria 41098
374 nmdc:mga09592_43343_c1 3300050508 Bacteria 3788
375 nmdc:mga06r32_566_c1 3300050510 Bacteria 32215
376 nmdc:mga08y16_1218431_c1 3300050511 Bacteria 723
377 nmdc:mga08y16_134_c1 3300050511 Bacteria 64270
378 nmdc:mga08y16_361508_c1 3300050511 Bacteria 1490
379 nmdc:mga08y16_561426_c1 3300050511 Bacteria 1154
380 nmdc:mga0n895_424892_c1 3300050512 Bacteria 1343
381 nmdc:mga0rr50_216548_c1 3300050513 Bacteria 1580
382 nmdc:mga08x19_1221174_c1 3300050514 Bacteria 533
383 Ga0495601_0132682 3300053077 Bacteria 1623
384 Ga0495612_0014771 3300053078 Bacteria 3134
385 Ga0495612_0271118 3300053078 Bacteria 757
386 Ga0495595_0128059 3300053084 Bacteria 1239
387 Ga0495619_0068953 3300053085 Bacteria 2363
388 Ga0495619_0313973 3300053085 Bacteria 1085
389 Ga0500578_0162097 3300053086 Bacteria 1387
390 Ga0500578_0632746 3300053086 Bacteria 584
391 Ga0500651_0015295 3300053093 Bacteria 4708
392 Ga0500641_0193359 3300053096 Bacteria 870
393 Ga0500556_0015736 3300053104 Bacteria 2340
394 Ga0500595_000947 3300053119 Bacteria 16362
395 Ga0500642_0434635 3300053130 Bacteria 566
396 Ga0500568_0089446 3300053139 Bacteria 1163
397 Ga0500603_207571 3300053150 Bacteria 623
398 Ga0500604_0046200 3300053151 Bacteria 1331
399 Ga0500604_0146033 3300053151 Bacteria 801
400 Ga0501084_0020657 3300054114 Bacteria 5492
401 Ga0501084_0022536 3300054114 Bacteria 5256
402 Ga0501084_1119915 3300054114 Bacteria 661
403 Ga0590071_068308 3300059421 Bacteria 874
404 Ga0501082_0000098 3300060353 Bacteria 67010
405 Ga0501082_0060808 3300060353 Bacteria 3252
406 Ga0501082_0161897 3300060353 Bacteria 1945
407 Ga0501082_0536211 3300060353 Bacteria 1023
408 Ga0501082_0650570 3300060353 Bacteria 922
409 Ga0501082_0714765 3300060353 Bacteria 877
410 Ga0501082_1273584 3300060353 Bacteria 642
411 Ga0530510_0160605 3300061734 Bacteria 1662
412 2793082739
413 8006964640 8006964411 Bacteria 8966052
414 Ga0070659_101226295
415 LJQas_1003658
416 JGI25404J52841_10049432
417 Ga0070676_10123074
418 Ga0070670_100210244
419 Ga0070670_100393521
420 Ga0070689_100235134
421 Ga0070689_100787289
422 Ga0070687_100035259
423 Ga0070669_100474272
424 Ga0070669_100906902
425 Ga0070675_100085888
426 Ga0070674_100046225
427 Ga0070673_100855844
428 Ga0070688_100211127
429 Ga0070688_100488477
430 Ga0070709_10413310
431 Ga0070714_100079095
432 Ga0070710_10317473
433 Ga0070700_100147395
434 Ga0070708_100389212
435 Ga0070678_100037739
436 Ga0070662_100014414
437 Ga0070685_10064838
438 Ga0070706_101249624
439 Ga0070707_100186497
440 Ga0070684_101343624
441 Ga0070697_100057741
442 Ga0070672_100013768
443 Ga0070704_100627315
444 Ga0070664_100097714
445 Ga0070664_100475877
446 Ga0070664_101638115
447 Ga0068857_101024563
448 Ga0068857_101947274
449 Ga0070702_100564782
450 Ga0068852_100841833
451 Ga0068859_101376583
452 Ga0068866_10695751
453 Ga0068861_101622289
454 Ga0068870_10422094
455 Ga0068863_100935903
456 Ga0068863_100967717
457 Ga0068863_101720145
458 Ga0068858_100035260
459 Ga0068862_101077751
460 Ga0081455_10003765
461 Ga0081538_10004959
462 Ga0081540_1007807
463 Ga0081540_1027904
464 Ga0081540_1039007
465 Ga0081539_10044298
466 Ga0075365_10335312
467 Ga0075363_100024515
468 Ga0075363_100118086
469 Ga0075363_100329655
470 Ga0075364_10012821
471 Ga0070712_100273522
472 Ga0075362_10021015
473 Ga0075367_10041625
474 Ga0075367_10128437
475 Ga0075367_10227877
476 Ga0075369_10289696
477 Ga0075366_10009172
478 Ga0075366_10620130
479 Ga0075428_100003465
480 Ga0075428_100279428
481 Ga0075430_100021400
482 Ga0075431_100000053
483 Ga0075431_100591325
484 Ga0075434_100049791
485 Ga0075429_100046226
486 Ga0075436_100510661
487 Ga0097620_101376693
488 Ga0075435_100177511
489 Ga0099795_10001567
490 Ga0099795_10353744
491 Ga0099795_10516867
492 Ga0105240_10517491
493 Ga0105240_12146354
494 Ga0111539_10005010
495 Ga0111539_10360484
496 Ga0105245_10064302
497 Ga0114129_10000237
498 Ga0105243_10657022
499 Ga0105243_11385998
500 Ga0105241_10016431
501 Ga0105237_10216251
502 Ga0105249_10184232
503 Ga0105249_10524184
504 Ga0099796_10000148
505 Ga0105239_10608532
506 Ga0157374_12378240
507 Ga0157378_10426336
508 Ga0157375_11215541
509 Ga0157375_11235848
510 Ga0163163_10028429
511 Ga0157380_10245052
512 Ga0157380_10700734
513 Ga0157377_10624739
514 Ga0157376_10172928
515 Ga0157376_10182500
516 Ga0213876_10217466
517 Ga0213875_10000117
518 Ga0207697_10229771
519 Ga0207682_10001644
520 Ga0207642_10373467
521 Ga0207699_10625255
522 Ga0207684_10408879
523 Ga0207684_11259352
524 Ga0207693_10395404
525 Ga0207660_10355347
526 Ga0207662_10158487
527 Ga0207662_10501477
528 Ga0207649_10529150
529 Ga0207646_10151043
530 Ga0207681_10039441
531 Ga0207659_10358046
532 Ga0207687_10054578
533 Ga0207664_10201406
534 Ga0207706_10165964
535 Ga0207670_11310044
536 Ga0207669_10291143
537 Ga0207665_10100246
538 Ga0207691_10045323
539 Ga0207661_10040544
540 Ga0207661_10492138
541 Ga0207679_10132122
542 Ga0207679_10435721
543 Ga0207651_10160672
544 Ga0207651_10384847
545 Ga0207712_10613581
546 Ga0207640_10184423
547 Ga0207658_10083023
548 Ga0207708_10040472
549 Ga0207641_10561513
550 Ga0207648_10023096
551 Ga0207648_10525759
552 Ga0207675_100302450
553 Ga0207683_10004995
554 Ga0207683_10555704
555 Ga0209179_1009744
556 Ga0209813_10262337
557 Ga0207428_10834125
558 Ga0268266_10231263
559 Ga0268264_10651219
560 Ga0265318_10069922
561 Ga0265330_10107876
562 Ga0265328_10016097
563 Ga0265320_10028300
564 Ga0265329_10049179
565 Ga0265329_10270550
566 Ga0265339_10086772
567 Ga0265331_10028736
568 Ga0265316_10374837
569 Ga0307513_10141459
570 Ga0307509_10533191
571 Ga0307408_101329910
572 Ga0265313_10062367
573 Ga0265313_10094146
574 Ga0307508_10000021
575 Ga0265314_10057915
576 Ga0265342_10019289
577 Ga0265342_10130171
578 Ga0307405_10204291
579 Ga0307413_10134866
580 Ga0307410_10447257
581 Ga0307406_10424804
582 Ga0307409_100177132
583 Ga0307416_101548786
584 Ga0307411_10644924
585 Ga0307415_100568794
586 Ga0307415_101035913
587 Ga0373928_0135409
588 Ga0373923_0202064
589 Ga0373923_0282516
590 Ga0373936_0009414
591 Ga0373954_0099464
592 Ga0373946_0005979
593 Ga0373946_0472351
594 Ga0373942_0090693
595 Ga0373931_0264994
596 Ga0373931_0591567
597 Ga0373927_0001314
598 Ga0373927_0053315
599 Ga0373933_0001657
600 Ga0373933_0857665
601 Ga0373947_0014848
602 Ga0373937_0035531
603 Ga0373925_0006671
604 Ga0373925_0187764
605 Ga0395899_0028227
606 Ga0395900_0037063
607 Ga0395900_0584775
608 Ga0395900_1165844
609 Ga0395898_0043857
610 Ga0395905_1277586
611 Ga0436364_0410618
612 Ga0436364_0507763
613 Ga0395901_0071394
614 Ga0395901_0576537
615 Ga0395901_0769746
616 Ga0436365_0381143
617 Ga0436365_0908038
618 Ga0436365_1218444
619 Ga0436365_1292215
620 Ga0436360_0633247
621 Ga0436363_1033110
622 Ga0436363_1365341
623 Ga0451789_1345995
624 Ga0451807_2507308
625 Ga0451837_1409921
626 Ga0495592_0603674
627 Ga0495603_0085256
628 Ga0495629_0004330
629 Ga0495629_0931020
630 Ga0495641_0041537
631 Ga0495651_0282878
632 Ga0495653_0036342
633 Ga0495580_0006344
634 Ga0495582_0005475
635 Ga0495639_0000750
636 Ga0495662_0002275
637 Ga0495594_0005644
638 Ga0495608_0143486
639 Ga0495628_0033673
640 Ga0495628_0210269
641 Ga0495630_0361831
642 Ga0495644_0004775
643 Ga0495666_0022190
644 Ga0495654_0366583
645 Ga0495665_0044110
646 Ga0495640_0007861
647 Ga0495586_0319752
648 Ga0495587_0425725
649 Ga0495667_0348498
650 Ga0495634_0001188
651 Ga0495625_0678333
652 Ga0495635_0051580
653 Ga0495588_0188400
654 Ga0495599_0577402
655 Ga0495646_0070861
656 Ga0495658_0005872
657 Ga0495613_0129838
658 Ga0495613_0195594
659 Ga0495624_0021125
660 Ga0495671_0078168
661 Ga0495600_0402079
662 Ga0495581_0000567
663 Ga0495604_0230119
664 Ga0495674_0050770
665 Ga0495672_0175412
666 Ga0495676_0136503
667 Ga0495685_043275
668 Ga0495593_0013868
669 Ga0495593_0132216
670 Ga0495602_0155798
671 Ga0495614_0034476
672 Ga0496101_0498732
673 Ga0496102_0023430
674 Ga0496103_0271208
675 Ga0496105_0390245
676 Ga0496105_0726371
677 Ga0496106_0294961
678 Ga0496106_0409570
679 Ga0496107_0196976
680 Ga0496107_0426319
681 Ga0496108_0384191
682 Ga0496108_0431887
683 Ga0496109_0050539
684 Ga0496110_0040514
685 Ga0496110_0703374
686 Ga0496111_0240589
687 Ga0496112_0007967
688 Ga0496113_0006909
689 Ga0496114_0234033
690 Ga0496115_0021569
691 Ga0496115_0043560
692 Ga0496115_0266791
693 Ga0496118_0109870
694 Ga0496120_0299732
695 Ga0496121_0003065
696 Ga0496126_0044419
697 Ga0496126_0448906
698 Ga0496126_0847173
699 Ga0496126_1077314
700 Ga0501031_0647381
701 Ga0501032_0004449
702 Ga0501032_0382828
703 Ga0501033_0001618
704 Ga0501033_0155758
705 Ga0501033_0549733
706 Ga0501034_0000061
707 Ga0501034_0264024
708 Ga0501034_0470687
709 Ga0501034_1529934
710 Ga0501036_0000054
711 Ga0501036_0102209
712 Ga0501036_0555085
713 Ga0501036_1381868
714 Ga0501036_1630181
715 Ga0501037_0000093
716 Ga0501037_0152040
717 Ga0501038_0000066
718 Ga0501038_0154674
719 Ga0501038_0358680
720 Ga0501038_0614268
721 Ga0501039_0019038
722 Ga0501039_0039396
723 Ga0501039_1072172
724 Ga0501040_0182724
725 Ga0501041_0042022
726 Ga0501041_0308346
727 Ga0501042_0026073
728 Ga0501042_0484414
729 Ga0501043_0000325
730 Ga0501043_0005165
731 Ga0501043_0514036
732 Ga0501043_0574237
733 Ga0501043_0626861
734 Ga0501046_0005977
735 Ga0501046_0010906
736 Ga0501046_0188009
737 Ga0501046_0266797
738 Ga0501047_0000621
739 Ga0501047_0189262
740 Ga0501047_0339167
741 Ga0501048_0001552
742 Ga0501048_1344646
743 Ga0501067_0000118
744 Ga0501067_0177469
745 Ga0501067_0593392
746 Ga0501068_0000133
747 Ga0501070_0002284
748 Ga0501070_0143353
749 Ga0501070_0470828
750 Ga0501070_0612560
751 Ga0501071_0294575
752 Ga0501071_1035281
753 Ga0501072_0007487
754 Ga0501072_0014489
755 Ga0501072_0065326
756 Ga0501073_0002382
757 Ga0501074_0001116
758 Ga0501074_0404405
759 Ga0501075_0146685
760 Ga0501076_0139347
761 Ga0501079_0016271
762 Ga0501079_0064005
763 Ga0501080_0001100
764 Ga0501080_0153892
765 Ga0501080_0804090
766 Ga0501083_0000331
767 Ga0501083_0124864
768 Ga0501083_0443262
769 Ga0501035_0000099
770 Ga0501035_0570070
771 Ga0501044_0000367
772 Ga0501044_0024349
773 Ga0501044_0197425
774 Ga0501044_0328002
775 Ga0501044_0537123
776 Ga0501045_0214555
777 nmdc:mga03n38_243805_c1
778 nmdc:mga00v17_9993_c1
779 nmdc:mga0yw44_50093_c1
780 nmdc:mga0k408_106216_c1
781 nmdc:mga0k408_5677_c1
782 nmdc:mga06z11_23153_c1
783 nmdc:mga06z11_487324_c1
784 nmdc:mga04h51_294377_c1
785 nmdc:mga04h51_38133_c1
786 nmdc:mga05p37_555_c1
787 nmdc:mga09592_43343_c1
788 nmdc:mga06r32_566_c1
789 nmdc:mga08y16_1218431_c1
790 nmdc:mga08y16_134_c1
791 nmdc:mga08y16_361508_c1
792 nmdc:mga08y16_561426_c1
793 nmdc:mga0n895_424892_c1
794 nmdc:mga0rr50_216548_c1
795 nmdc:mga08x19_1221174_c1
796 Ga0495601_0132682
797 Ga0495612_0014771
798 Ga0495612_0271118
799 Ga0495595_0128059
800 Ga0495619_0068953
801 Ga0495619_0313973
802 Ga0500578_0162097
803 Ga0500578_0632746
804 Ga0500651_0015295
805 Ga0500641_0193359
806 Ga0500556_0015736
807 Ga0500595_000947
808 Ga0500642_0434635
809 Ga0500568_0089446
810 Ga0500603_207571
811 Ga0500604_0046200
812 Ga0500604_0146033
813 Ga0501084_0020657
814 Ga0501084_0022536
815 Ga0501084_1119915
816 Ga0590071_068308
817 Ga0501082_0000098
818 Ga0501082_0060808
819 Ga0501082_0161897
820 Ga0501082_0536211
821 Ga0501082_0650570
822 Ga0501082_0714765
823 Ga0501082_1273584
824 Ga0530510_0160605
825 2793082739
826 8006964640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

64

138

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgn-assembly1.cif.gz_B crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9609 18 116
6j2l-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.9416 23 112
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.9398 23 112
6j22-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9265 23 112
7bgn-assembly1.cif.gz_A crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9116 7 113
ID Description Score Start End Superfamily
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9885 25 104 3.10.20.810
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9829 18 104 3.10.20.810
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9591 22 104 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9064 7 104 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.888 7 104 3.10.20.810
ID Description Score Start End GO Terms
AF-C1A0L2-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9844 18 112 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A7C6MGQ9-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9825 18 112 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A2H1HXQ3-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9812 18 112 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A7K0YNB6-F1-model_v4 deleted 0.9806 18 112
AF-A0A655F4E4-F1-model_v4 deleted 0.9801 19 112

Map