F437976

General Info

Members Datasets Scaffolds Average Seq Length
413 204 412 69

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100001607|Ga0070670_1000016076
Length 64
Sequence MMIGGALLAVGALVWLGGRLNLPLGRLPGDIRIERENFRFYLPLTTCLLLSVLVSVVVWALRRR

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
152 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
159 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
160 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
164 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
165 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
168 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
201 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.24
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 1.45
Rhizosphere 92.49
Stem 0
Stem Tuber 0
Unclassified 3.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1046166 3300001904 Bacteria 670
2 rootH1_10056854 3300003316 Bacteria 5947
3 rootL2_10115587 3300003322 Bacteria 2547
4 rootL2_10317676 3300003322 Bacteria 1194
5 rootH1_10032311 3300003323 Bacteria 34322
6 rootH1_10250515 3300003323 Bacteria 2930
7 Ga0065714_10074232 3300005288 Bacteria 3066
8 Ga0065704_10339059 3300005289 Bacteria 826
9 Ga0065712_10001405 3300005290 Bacteria 5967
10 Ga0065707_10105163 3300005295 Bacteria 2658
11 Ga0070658_10241968 3300005327 Bacteria 1529
12 Ga0070683_100000569 3300005329 Bacteria 26292
13 Ga0070683_100083679 3300005329 Bacteria 2989
14 Ga0070690_100051384 3300005330 Bacteria 2631
15 Ga0070690_100068643 3300005330 Bacteria 2300
16 Ga0070690_100404827 3300005330 Bacteria 1003
17 Ga0070670_100001607 3300005331 Bacteria 18259
18 Ga0070670_100056886 3300005331 Bacteria 3358
19 Ga0070670_100161389 3300005331 Bacteria 1942
20 Ga0070670_100198246 3300005331 Unclassified 1744
21 Ga0070670_100362233 3300005331 Bacteria 1275
22 Ga0070670_101250422 3300005331 Unclassified 679
23 Ga0068869_100017621 3300005334 Bacteria 4846
24 Ga0068869_100132163 3300005334 Bacteria 1919
25 Ga0070666_10010452 3300005335 Bacteria 5808
26 Ga0070666_10120789 3300005335 Bacteria 1817
27 Ga0068868_100045020 3300005338 Bacteria 3451
28 Ga0068868_100090989 3300005338 Bacteria 2458
29 Ga0068868_100303067 3300005338 Bacteria 1357
30 Ga0070660_100298350 3300005339 Bacteria 1321
31 Ga0070660_101688484 3300005339 Bacteria 539
32 Ga0070689_100005141 3300005340 Bacteria 8898
33 Ga0070689_100035678 3300005340 Bacteria 3800
34 Ga0070689_100883655 3300005340 Bacteria 790
35 Ga0070689_101902019 3300005340 Bacteria 543
36 Ga0070691_10289319 3300005341 Bacteria 891
37 Ga0070687_100158463 3300005343 Bacteria 1336
38 Ga0070661_100688530 3300005344 Bacteria 832
39 Ga0070661_101242514 3300005344 Bacteria 624
40 Ga0070668_100049385 3300005347 Bacteria 3237
41 Ga0070669_100014222 3300005353 Bacteria 5663
42 Ga0070669_100455454 3300005353 Unclassified 1055
43 Ga0070669_100472432 3300005353 Bacteria 1036
44 Ga0070675_100016681 3300005354 Bacteria 5828
45 Ga0070675_100401578 3300005354 Bacteria 1223
46 Ga0070675_101119632 3300005354 Bacteria 724
47 Ga0070675_101681993 3300005354 Unclassified 585
48 Ga0070671_100205003 3300005355 Unclassified 1672
49 Ga0070671_100853510 3300005355 Unclassified 794
50 Ga0070674_100291632 3300005356 Bacteria 1297
51 Ga0070674_100342768 3300005356 Bacteria 1204
52 Ga0070674_101006800 3300005356 Bacteria 731
53 Ga0070673_100073466 3300005364 Bacteria 2753
54 Ga0070673_100229784 3300005364 Bacteria 1609
55 Ga0070673_100874480 3300005364 Bacteria 832
56 Ga0070673_100915487 3300005364 Bacteria 814
57 Ga0070688_100034288 3300005365 Bacteria 3073
58 Ga0070688_100430837 3300005365 Bacteria 982
59 Ga0070659_100580493 3300005366 Bacteria 962
60 Ga0070667_100065711 3300005367 Bacteria 3080
61 Ga0070667_100148432 3300005367 Bacteria 2058
62 Ga0070667_100476327 3300005367 Bacteria 1143
63 Ga0070713_101249205 3300005436 Bacteria 719
64 Ga0070694_100274929 3300005444 Bacteria 1282
65 Ga0070663_100318396 3300005455 Bacteria 1250
66 Ga0070663_101731054 3300005455 Bacteria 559
67 Ga0070678_100204279 3300005456 Bacteria 1633
68 Ga0070678_100220334 3300005456 Bacteria 1577
69 Ga0070662_100004551 3300005457 Bacteria 8782
70 Ga0070662_100303844 3300005457 Bacteria 1297
71 Ga0070681_11229673 3300005458 Bacteria 671
72 Ga0068867_100142486 3300005459 Bacteria 1875
73 Ga0068867_102364113 3300005459 Bacteria 505
74 Ga0070685_10002124 3300005466 Bacteria 10236
75 Ga0070685_10379171 3300005466 Bacteria 974
76 Ga0070685_10708666 3300005466 Bacteria 734
77 Ga0070707_101873111 3300005468 Bacteria 567
78 Ga0070698_100000061 3300005471 Bacteria 78637
79 Ga0070699_100446528 3300005518 Bacteria 1172
80 Ga0070684_100007643 3300005535 Bacteria 8427
81 Ga0070684_100015118 3300005535 Bacteria 6275
82 Ga0068853_100190842 3300005539 Bacteria 1861
83 Ga0068853_100253441 3300005539 Bacteria 1616
84 Ga0068853_100388309 3300005539 Bacteria 1305
85 Ga0068853_102035927 3300005539 Bacteria 557
86 Ga0070672_100044494 3300005543 Bacteria 3429
87 Ga0070672_100059564 3300005543 Bacteria 3005
88 Ga0070672_101351170 3300005543 Bacteria 637
89 Ga0070672_102064881 3300005543 Bacteria 513
90 Ga0070686_100021793 3300005544 Bacteria 3813
91 Ga0070686_100197521 3300005544 Bacteria 1440
92 Ga0070693_100024366 3300005547 Bacteria 3245
93 Ga0070665_100010845 3300005548 Bacteria 9217
94 Ga0068855_100000548 3300005563 Bacteria 46125
95 Ga0068855_100002500 3300005563 Bacteria 22644
96 Ga0068855_100037991 3300005563 Bacteria 5723
97 Ga0068855_101995189 3300005563 Unclassified 586
98 Ga0070664_100058857 3300005564 Bacteria 3268
99 Ga0070664_100097233 3300005564 Bacteria 2556
100 Ga0068857_100003780 3300005577 Bacteria 12727
101 Ga0068857_100161867 3300005577 Bacteria 2031
102 Ga0068857_100328485 3300005577 Bacteria 1413
103 Ga0068857_101549116 3300005577 Unclassified 646
104 Ga0068854_100019492 3300005578 Bacteria 4573
105 Ga0068854_100056479 3300005578 Bacteria 2829
106 Ga0068854_101161135 3300005578 Bacteria 690
107 Ga0068856_100000031 3300005614 Bacteria 126668
108 Ga0068856_100005116 3300005614 Bacteria 12960
109 Ga0068856_100145920 3300005614 Bacteria 2374
110 Ga0068856_102294182 3300005614 Bacteria 548
111 Ga0070702_100411921 3300005615 Bacteria 970
112 Ga0068852_100001717 3300005616 Bacteria 14926
113 Ga0068852_100078138 3300005616 Bacteria 2927
114 Ga0068852_100308405 3300005616 Bacteria 1534
115 Ga0068852_100327585 3300005616 Bacteria 1489
116 Ga0068852_100552148 3300005616 Unclassified 1152
117 Ga0068852_101657518 3300005616 Bacteria 662
118 Ga0068852_102388049 3300005616 Unclassified 549
119 Ga0068859_100037638 3300005617 Bacteria 4855
120 Ga0068859_100250254 3300005617 Bacteria 1862
121 Ga0068859_100411381 3300005617 Bacteria 1449
122 Ga0068859_100552844 3300005617 Bacteria 1245
123 Ga0068864_100011914 3300005618 Bacteria 7182
124 Ga0068864_100046834 3300005618 Bacteria 3711
125 Ga0068864_100572580 3300005618 Bacteria 1094
126 Ga0068864_100772157 3300005618 Bacteria 943
127 Ga0068864_100904694 3300005618 Unclassified 872
128 Ga0068864_101071118 3300005618 Bacteria 801
129 Ga0068864_101768581 3300005618 Bacteria 623
130 Ga0068866_10004875 3300005718 Bacteria 5510
131 Ga0068861_100043378 3300005719 Bacteria 3376
132 Ga0068861_100052584 3300005719 Bacteria 3096
133 Ga0068861_100231947 3300005719 Bacteria 1566
134 Ga0068861_100640110 3300005719 Bacteria 981
135 Ga0068851_10032326 3300005834 Unclassified 2604
136 Ga0068851_10064918 3300005834 Bacteria 1877
137 Ga0068870_10005184 3300005840 Bacteria 5677
138 Ga0068870_10038068 3300005840 Bacteria 2482
139 Ga0068870_10562976 3300005840 Unclassified 769
140 Ga0068863_102532756 3300005841 Bacteria 522
141 Ga0068860_100026036 3300005843 Bacteria 5643
142 Ga0068860_100051790 3300005843 Bacteria 3905
143 Ga0068860_100058786 3300005843 Bacteria 3656
144 Ga0068860_100099140 3300005843 Bacteria 2779
145 Ga0068862_100013377 3300005844 Bacteria 6790
146 Ga0068862_100445564 3300005844 Bacteria 1220
147 Ga0068862_100743332 3300005844 Bacteria 954
148 Ga0070712_100177031 3300006175 Bacteria 1659
149 Ga0075366_10022862 3300006195 Bacteria 3640
150 Ga0068871_100008975 3300006358 Bacteria 7217
151 Ga0068871_100269010 3300006358 Bacteria 1488
152 Ga0068871_100633897 3300006358 Bacteria 974
153 Ga0075434_100992730 3300006871 Bacteria 854
154 Ga0075429_100009151 3300006880 Bacteria 8599
155 Ga0075429_100750467 3300006880 Bacteria 855
156 Ga0068865_100015453 3300006881 Bacteria 4868
157 Ga0068865_100564112 3300006881 Bacteria 958
158 Ga0068865_101137801 3300006881 Bacteria 689
159 Ga0097620_100037639 3300006931 Bacteria 4855
160 Ga0097620_100250244 3300006931 Bacteria 1862
161 Ga0097620_100411401 3300006931 Bacteria 1449
162 Ga0097620_100552824 3300006931 Bacteria 1245
163 Ga0105240_10008990 3300009093 Bacteria 14197
164 Ga0105240_10009858 3300009093 Bacteria 13484
165 Ga0105240_10422635 3300009093 Unclassified 1497
166 Ga0105240_10765218 3300009093 Bacteria 1049
167 Ga0111539_10244923 3300009094 Bacteria 2087
168 Ga0105247_10013506 3300009101 Bacteria 4897
169 Ga0114129_10019832 3300009147 Bacteria 9569
170 Ga0114129_10094343 3300009147 Bacteria 4144
171 Ga0105241_10020978 3300009174 Bacteria 4828
172 Ga0105241_10123984 3300009174 Bacteria 2084
173 Ga0105241_10662358 3300009174 Bacteria 949
174 Ga0105241_12404034 3300009174 Bacteria 526
175 Ga0105242_10157643 3300009176 Bacteria 1984
176 Ga0105242_10212875 3300009176 Unclassified 1723
177 Ga0105242_12089716 3300009176 Bacteria 610
178 Ga0105248_10474835 3300009177 Unclassified 1410
179 Ga0105237_10028845 3300009545 Bacteria 5647
180 Ga0105237_10460241 3300009545 Bacteria 1278
181 Ga0105237_10818494 3300009545 Bacteria 938
182 Ga0105237_10875517 3300009545 Bacteria 905
183 Ga0105238_10111860 3300009551 Bacteria 2711
184 Ga0105249_10009016 3300009553 Bacteria 8717
185 Ga0105249_10032709 3300009553 Bacteria 4706
186 Ga0105249_10102201 3300009553 Unclassified 2697
187 Ga0105249_10136556 3300009553 Bacteria 2347
188 Ga0105239_10001747 3300010375 Bacteria 28630
189 Ga0105239_10023446 3300010375 Bacteria 6797
190 Ga0105239_10987175 3300010375 Bacteria 968
191 Ga0105239_11482965 3300010375 Bacteria 784
192 Ga0105239_12389575 3300010375 Bacteria 615
193 Ga0105246_10743060 3300011119 Bacteria 864
194 Ga0157373_10125447 3300013100 Bacteria 1805
195 Ga0157373_10589683 3300013100 Bacteria 808
196 Ga0157371_10243305 3300013102 Bacteria 1294
197 Ga0157371_10341866 3300013102 Unclassified 1088
198 Ga0157371_10606533 3300013102 Unclassified 814
199 Ga0157370_10003043 3300013104 Bacteria 19879
200 Ga0157370_10222506 3300013104 Bacteria 1748
201 Ga0157370_10342444 3300013104 Bacteria 1378
202 Ga0157369_10013114 3300013105 Bacteria 9379
203 Ga0157369_10073203 3300013105 Bacteria 3676
204 Ga0157369_10517549 3300013105 Bacteria 1234
205 Ga0157369_10872976 3300013105 Bacteria 923
206 Ga0157374_10248632 3300013296 Unclassified 1749
207 Ga0157378_10217947 3300013297 Bacteria 1813
208 Ga0157378_10386962 3300013297 Bacteria 1375
209 Ga0163162_10000446 3300013306 Bacteria 38191
210 Ga0163162_10096185 3300013306 Bacteria 3049
211 Ga0163162_10128079 3300013306 Bacteria 2646
212 Ga0163162_10317890 3300013306 Bacteria 1689
213 Ga0157372_10000231 3300013307 Bacteria 62248
214 Ga0157372_10163153 3300013307 Bacteria 2576
215 Ga0157372_10174611 3300013307 Bacteria 2487
216 Ga0157372_10191152 3300013307 Unclassified 2371
217 Ga0157372_10939034 3300013307 Bacteria 1003
218 Ga0157372_11770433 3300013307 Bacteria 710
219 Ga0157372_12092465 3300013307 Bacteria 650
220 Ga0157372_12802633 3300013307 Bacteria 559
221 Ga0157375_10018567 3300013308 Bacteria 6308
222 Ga0157375_10205560 3300013308 Bacteria 2125
223 Ga0157375_10253110 3300013308 Bacteria 1922
224 Ga0157375_10344007 3300013308 Unclassified 1657
225 Ga0157375_11090238 3300013308 Bacteria 934
226 Ga0157375_12072652 3300013308 Bacteria 677
227 Ga0157375_13683489 3300013308 Bacteria 510
228 Ga0157380_10193535 3300014326 Bacteria 1798
229 Ga0157377_10031232 3300014745 Bacteria 2892
230 Ga0157377_11742163 3300014745 Bacteria 504
231 Ga0157379_10318627 3300014968 Bacteria 1419
232 Ga0157376_10019098 3300014969 Bacteria 5274
233 Ga0157376_10845858 3300014969 Bacteria 930
234 Ga0163161_10003969 3300017792 Bacteria 10370
235 Ga0163161_10024625 3300017792 Bacteria 4253
236 Ga0163161_10317507 3300017792 Bacteria 1231
237 Ga0163161_10664499 3300017792 Unclassified 864
238 Ga0206354_11661726 3300020081 Bacteria 897
239 Ga0209646_1000637 3300025246 Bacteria 13245
240 Ga0207697_10034102 3300025315 Bacteria 2084
241 Ga0207682_10078531 3300025893 Bacteria 1410
242 Ga0207642_10022528 3300025899 Bacteria 2500
243 Ga0207710_10028753 3300025900 Bacteria 2414
244 Ga0207680_10049895 3300025903 Bacteria 2494
245 Ga0207680_10071829 3300025903 Bacteria 2146
246 Ga0207680_10373327 3300025903 Bacteria 1004
247 Ga0207647_10005456 3300025904 Bacteria 9319
248 Ga0207647_10164682 3300025904 Bacteria 1292
249 Ga0207685_10325885 3300025905 Bacteria 767
250 Ga0207645_10000356 3300025907 Bacteria 37874
251 Ga0207645_10039712 3300025907 Bacteria 3015
252 Ga0207643_10000864 3300025908 Bacteria 18281
253 Ga0207643_10125716 3300025908 Unclassified 1522
254 Ga0207705_10055419 3300025909 Bacteria 2858
255 Ga0207654_10179898 3300025911 Bacteria 1379
256 Ga0207707_10621230 3300025912 Bacteria 913
257 Ga0207695_10000686 3300025913 Bacteria 66411
258 Ga0207695_10094981 3300025913 Unclassified 2987
259 Ga0207695_10527967 3300025913 Unclassified 1062
260 Ga0207671_10166955 3300025914 Bacteria 1707
261 Ga0207657_11304470 3300025919 Bacteria 548
262 Ga0207649_10487085 3300025920 Bacteria 936
263 Ga0207652_10002842 3300025921 Bacteria 14517
264 Ga0207646_10911177 3300025922 Unclassified 780
265 Ga0207681_10196233 3300025923 Bacteria 1547
266 Ga0207681_10221815 3300025923 Bacteria 1463
267 Ga0207681_10505163 3300025923 Bacteria 990
268 Ga0207650_10002122 3300025925 Bacteria 13860
269 Ga0207650_10012433 3300025925 Bacteria 5877
270 Ga0207650_10028613 3300025925 Bacteria 3998
271 Ga0207650_10100850 3300025925 Bacteria 2222
272 Ga0207650_10567971 3300025925 Bacteria 952
273 Ga0207650_10886833 3300025925 Bacteria 757
274 Ga0207659_10557885 3300025926 Bacteria 974
275 Ga0207659_11293721 3300025926 Bacteria 626
276 Ga0207644_10120236 3300025931 Unclassified 1999
277 Ga0207690_11276009 3300025932 Bacteria 614
278 Ga0207706_10003189 3300025933 Bacteria 15740
279 Ga0207706_10070944 3300025933 Bacteria 3064
280 Ga0207686_10386712 3300025934 Bacteria 1062
281 Ga0207670_10001455 3300025936 Bacteria 12422
282 Ga0207670_11092293 3300025936 Bacteria 673
283 Ga0207669_10084702 3300025937 Unclassified 2044
284 Ga0207669_10356731 3300025937 Bacteria 1131
285 Ga0207704_10089921 3300025938 Bacteria 2013
286 Ga0207691_10002055 3300025940 Bacteria 19671
287 Ga0207689_10011163 3300025942 Bacteria 7708
288 Ga0207689_10021820 3300025942 Bacteria 5384
289 Ga0207689_10177026 3300025942 Bacteria 1759
290 Ga0207661_10069964 3300025944 Bacteria 2863
291 Ga0207661_10355074 3300025944 Unclassified 1323
292 Ga0207679_10040960 3300025945 Bacteria 3319
293 Ga0207679_10074949 3300025945 Bacteria 2566
294 Ga0207667_10000100 3300025949 Bacteria 138482
295 Ga0207667_10004787 3300025949 Bacteria 16547
296 Ga0207667_10005867 3300025949 Bacteria 14952
297 Ga0207667_11165023 3300025949 Unclassified 752
298 Ga0207651_10076117 3300025960 Bacteria 2398
299 Ga0207651_10310228 3300025960 Unclassified 1315
300 Ga0207651_10641417 3300025960 Unclassified 932
301 Ga0207712_10496183 3300025961 Bacteria 1043
302 Ga0207712_11754413 3300025961 Bacteria 556
303 Ga0207712_12041958 3300025961 Bacteria 513
304 Ga0207668_10461994 3300025972 Bacteria 1085
305 Ga0207668_10636836 3300025972 Unclassified 932
306 Ga0207640_10117229 3300025981 Bacteria 1900
307 Ga0207640_10486447 3300025981 Bacteria 1025
308 Ga0207658_10071750 3300025986 Bacteria 2623
309 Ga0207658_10198001 3300025986 Bacteria 1675
310 Ga0207658_10636518 3300025986 Unclassified 960
311 Ga0207677_10148114 3300026023 Bacteria 1807
312 Ga0207677_10155445 3300026023 Bacteria 1770
313 Ga0207639_10469645 3300026041 Unclassified 1145
314 Ga0207639_11110925 3300026041 Unclassified 741
315 Ga0207708_10305418 3300026075 Bacteria 1295
316 Ga0207708_11989817 3300026075 Bacteria 509
317 Ga0207702_10000071 3300026078 Bacteria 114394
318 Ga0207702_10082430 3300026078 Bacteria 2796
319 Ga0207702_10139740 3300026078 Bacteria 2190
320 Ga0207702_11968205 3300026078 Bacteria 575
321 Ga0207641_10446039 3300026088 Bacteria 1250
322 Ga0207648_10000372 3300026089 Bacteria 49262
323 Ga0207648_10414795 3300026089 Bacteria 1222
324 Ga0207676_10239815 3300026095 Unclassified 1626
325 Ga0207676_10442281 3300026095 Bacteria 1224
326 Ga0207676_11250665 3300026095 Bacteria 736
327 Ga0207674_10007452 3300026116 Bacteria 12753
328 Ga0207674_10063208 3300026116 Unclassified 3737
329 Ga0207674_10145252 3300026116 Bacteria 2330
330 Ga0207674_11118027 3300026116 Bacteria 757
331 Ga0207674_11150325 3300026116 Bacteria 745
332 Ga0207675_100034818 3300026118 Bacteria 4696
333 Ga0207675_100646336 3300026118 Bacteria 1064
334 Ga0207675_100945954 3300026118 Bacteria 879
335 Ga0207683_10001338 3300026121 Bacteria 22249
336 Ga0207683_10016498 3300026121 Bacteria 6286
337 Ga0207698_10001532 3300026142 Bacteria 13470
338 Ga0207698_10024352 3300026142 Bacteria 4247
339 Ga0207698_10218313 3300026142 Unclassified 1721
340 Ga0207698_10280859 3300026142 Bacteria 1540
341 Ga0207698_10436235 3300026142 Bacteria 1261
342 Ga0207698_10900232 3300026142 Bacteria 892
343 Ga0268266_10079735 3300028379 Bacteria 2851
344 Ga0268265_11024148 3300028380 Bacteria 816
345 Ga0268264_10018210 3300028381 Bacteria 5745
346 Ga0268264_10032264 3300028381 Bacteria 4296
347 Ga0268264_10076170 3300028381 Bacteria 2853
348 Ga0268264_10914394 3300028381 Unclassified 881
349 Ga0316181_1165475 3300030744 Bacteria 855
350 Ga0316182_1216286 3300030745 Bacteria 586
351 Ga0307513_10277253 3300031456 Bacteria 1456
352 Ga0307513_10281258 3300031456 Bacteria 1441
353 Ga0307408_100000164 3300031548 Bacteria 73855
354 Ga0307516_10408212 3300031730 Bacteria 1017
355 Ga0307416_102936612 3300032002 Unclassified 570
356 Ga0439436_0032520 3300041404 Bacteria 1512
357 Ga0439466_0111365 3300041411 Unclassified 849
358 Ga0451793_1056124 3300041452 Bacteria 648
359 Ga0451800_0810061 3300041459 Bacteria 703
360 Ga0451800_1220908 3300041459 Unclassified 707
361 Ga0451802_1394932 3300041460 Unclassified 1594
362 Ga0451807_1050901 3300041486 Bacteria 1373
363 Ga0451841_0528053 3300041498 Unclassified 727
364 Ga0451841_0815977 3300041498 Unclassified 1743
365 Ga0451847_0092574 3300041503 Bacteria 873
366 Ga0451847_0215079 3300041503 Unclassified 814
367 Ga0451849_0252164 3300041505 Bacteria 852
368 Ga0451853_2515415 3300041512 Bacteria 784
369 Ga0439442_006321 3300042002 Bacteria 2378
370 Ga0439445_0200454 3300042004 Bacteria 589
371 Ga0439432_124239 3300042006 Bacteria 763
372 Ga0439449_0285728 3300042007 Bacteria 622
373 Ga0439457_000047 3300042014 Bacteria 25585
374 Ga0439462_0065581 3300042015 Unclassified 984
375 Ga0450898_062601 3300042134 Unclassified 734
376 Ga0439434_0160654 3300042435 Bacteria 746
377 Ga0439435_0035963 3300042436 Unclassified 1367
378 Ga0466972_0182028 3300044658 Bacteria 985
379 Ga0466965_0493742 3300044683 Unclassified 686
380 Ga0466964_0636583 3300044706 Unclassified 588
381 Ga0466964_0664540 3300044706 Unclassified 577
382 Ga0466968_0027356 3300044735 Bacteria 2347
383 Ga0466957_0207076 3300044842 Bacteria 1290
384 Ga0495627_005234 3300046453 Bacteria 5263
385 Ga0495629_0673819 3300046459 Bacteria 688
386 Ga0495594_0748638 3300046499 Bacteria 552
387 Ga0495633_0001128 3300046558 Bacteria 21471
388 Ga0496114_0179814 3300048917 Bacteria 1847
389 Ga0501034_0033240 3300049571 Bacteria 5235
390 Ga0501037_0731053 3300049573 Bacteria 657
391 Ga0501039_1374457 3300049575 Unclassified 544
392 Ga0501043_0251581 3300049579 Bacteria 1361
393 Ga0501047_0027634 3300049581 Bacteria 5466
394 Ga0501047_0507558 3300049581 Bacteria 1032
395 Ga0501073_0512567 3300049589 Bacteria 829
396 Ga0501235_062304 3300049669 Viruses 875
397 Ga0501257_032979 3300049686 Unclassified 1254
398 Ga0501044_0023525 3300049823 Bacteria 6553
399 Ga0501044_0054664 3300049823 Bacteria 4103
400 Ga0501044_0971313 3300049823 Bacteria 722
401 nmdc:mga0k408_454399_c1 3300050493 Bacteria 761
402 nmdc:mga05p37_14343_c1 3300050507 Bacteria 7889
403 nmdc:mga09592_1071_c1 3300050508 Bacteria 21759
404 nmdc:mga09592_627065_c1 3300050508 Bacteria 919
405 Ga0500581_116855 3300053089 Unclassified 1293
406 Ga0500651_0082434 3300053093 Bacteria 1991
407 Ga0500651_0484792 3300053093 Unclassified 684
408 Ga0500556_0048863 3300053104 Unclassified 1523
409 Ga0500589_263957 3300053147 Unclassified 626
410 Ga0500622_0029072 3300053156 Bacteria 2908
411 Ga0500639_365084 3300053163 Bacteria 503
412 Ga0466962_0314022 3300061719 Bacteria 777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10875517 Ga0105237_108755173 50
2 3300005330 Ga0070690_100051384 Ga0070690_1000513843 51
3 3300005331 Ga0070670_100198246 Ga0070670_1001982462 51
4 3300005334 Ga0068869_100017621 Ga0068869_1000176213 51
5 3300005335 Ga0070666_10120789 Ga0070666_101207892 51
6 3300005338 Ga0068868_100303067 Ga0068868_1003030672 51
7 3300005340 Ga0070689_100883655 Ga0070689_1008836551 51
8 3300005344 Ga0070661_101242514 Ga0070661_1012425142 51
9 3300005356 Ga0070674_100291632 Ga0070674_1002916321 51
10 3300005456 Ga0070678_100204279 Ga0070678_1002042792 51
11 3300005457 Ga0070662_100004551 Ga0070662_1000045513 51
12 3300005539 Ga0068853_102035927 Ga0068853_1020359272 51
13 3300005544 Ga0070686_100021793 Ga0070686_1000217933 51
14 3300005547 Ga0070693_100024366 Ga0070693_1000243662 51
15 3300005614 Ga0068856_102294182 Ga0068856_1022941821 51
16 3300005615 Ga0070702_100411921 Ga0070702_1004119212 51
17 3300005616 Ga0068852_100308405 Ga0068852_1003084052 51
18 3300005618 Ga0068864_100772157 Ga0068864_1007721572 51
19 3300005834 Ga0068851_10064918 Ga0068851_100649182 51
20 3300005840 Ga0068870_10038068 Ga0068870_100380681 51
21 3300006358 Ga0068871_100269010 Ga0068871_1002690101 51
22 3300006871 Ga0075434_100992730 Ga0075434_1009927302 51
23 3300006881 Ga0068865_100564112 Ga0068865_1005641122 51
24 3300009093 Ga0105240_10765218 Ga0105240_107652182 51
25 3300009176 Ga0105242_10157643 Ga0105242_101576433 51
26 3300009177 Ga0105248_10474835 Ga0105248_104748352 51
27 3300010375 Ga0105239_10987175 Ga0105239_109871752 51
28 3300013105 Ga0157369_10517549 Ga0157369_105175492 51
29 3300013297 Ga0157378_10217947 Ga0157378_102179472 51
30 3300013306 Ga0163162_10096185 Ga0163162_100961852 51
31 3300013307 Ga0157372_10174611 Ga0157372_101746112 51
32 3300013308 Ga0157375_10018567 Ga0157375_100185674 51
33 3300014968 Ga0157379_10318627 Ga0157379_103186272 51
34 3300014969 Ga0157376_10019098 Ga0157376_100190984 51
35 3300017792 Ga0163161_10024625 Ga0163161_100246254 51
36 3300025903 Ga0207680_10049895 Ga0207680_100498952 51
37 3300025925 Ga0207650_10100850 Ga0207650_101008502 51
38 3300025933 Ga0207706_10003189 Ga0207706_100031895 51
39 3300025937 Ga0207669_10084702 Ga0207669_100847022 51
40 3300025942 Ga0207689_10021820 Ga0207689_100218203 51
41 3300025945 Ga0207679_10074949 Ga0207679_100749493 51
42 3300025960 Ga0207651_10076117 Ga0207651_100761172 51
43 3300026023 Ga0207677_10148114 Ga0207677_101481143 51
44 3300026089 Ga0207648_10414795 Ga0207648_104147952 51
45 3300026121 Ga0207683_10016498 Ga0207683_100164985 51
46 3300026142 Ga0207698_10280859 Ga0207698_102808592 51
47 3300048917 Ga0496114_0179814 Ga0496114_0179814_464_688 51
48 3300005327 Ga0070658_10241968 Ga0070658_102419682 52
49 3300005339 Ga0070660_100298350 Ga0070660_1002983503 52
50 3300005577 Ga0068857_100328485 Ga0068857_1003284852 52
51 3300006358 Ga0068871_100633897 Ga0068871_1006338972 52
52 3300013307 Ga0157372_11770433 Ga0157372_117704332 52
53 3300025909 Ga0207705_10055419 Ga0207705_100554193 52
54 3300026075 Ga0207708_11989817 Ga0207708_119898172 52
55 3300026078 Ga0207702_11968205 Ga0207702_119682051 52
56 3300026116 Ga0207674_11118027 Ga0207674_111180272 52
57 3300049589 Ga0501073_0512567 Ga0501073_0512567_435_659 52
58 3300005288 Ga0065714_10074232 Ga0065714_100742322 53
59 3300005290 Ga0065712_10001405 Ga0065712_100014052 53
60 3300005331 Ga0070670_100001607 Ga0070670_1000016076 53
61 3300005331 Ga0070670_100056886 Ga0070670_1000568863 53
62 3300005331 Ga0070670_101250422 Ga0070670_1012504222 53
63 3300005340 Ga0070689_100005141 Ga0070689_1000051413 53
64 3300005343 Ga0070687_100158463 Ga0070687_1001584632 53
65 3300005353 Ga0070669_100455454 Ga0070669_1004554542 53
66 3300005354 Ga0070675_100016681 Ga0070675_1000166813 53
67 3300005364 Ga0070673_100915487 Ga0070673_1009154871 53
68 3300005365 Ga0070688_100430837 Ga0070688_1004308372 53
69 3300005466 Ga0070685_10002124 Ga0070685_100021244 53
70 3300005466 Ga0070685_10379171 Ga0070685_103791711 53
71 3300005564 Ga0070664_100097233 Ga0070664_1000972335 53
72 3300005617 Ga0068859_100037638 Ga0068859_1000376382 53
73 3300005618 Ga0068864_100011914 Ga0068864_1000119141 53
74 3300005618 Ga0068864_100572580 Ga0068864_1005725802 53
75 3300005840 Ga0068870_10562976 Ga0068870_105629762 53
76 3300005843 Ga0068860_100099140 Ga0068860_1000991403 53
77 3300006931 Ga0097620_100037639 Ga0097620_1000376392 53
78 3300009101 Ga0105247_10013506 Ga0105247_100135064 53
79 3300009553 Ga0105249_10009016 Ga0105249_100090165 53
80 3300009553 Ga0105249_10136556 Ga0105249_101365562 53
81 3300011119 Ga0105246_10743060 Ga0105246_107430601 53
82 3300013308 Ga0157375_10205560 Ga0157375_102055601 53
83 3300014326 Ga0157380_10193535 Ga0157380_101935352 53
84 3300025900 Ga0207710_10028753 Ga0207710_100287532 53
85 3300025908 Ga0207643_10000864 Ga0207643_1000086417 53
86 3300025923 Ga0207681_10196233 Ga0207681_101962332 53
87 3300025925 Ga0207650_10012433 Ga0207650_100124335 53
88 3300025925 Ga0207650_10028613 Ga0207650_100286133 53
89 3300025925 Ga0207650_10567971 Ga0207650_105679712 53
90 3300025936 Ga0207670_10001455 Ga0207670_100014557 53
91 3300026075 Ga0207708_10305418 Ga0207708_103054182 53
92 3300026088 Ga0207641_10446039 Ga0207641_104460393 53
93 3300026095 Ga0207676_11250665 Ga0207676_112506652 53
94 3300026118 Ga0207675_100646336 Ga0207675_1006463362 53
95 3300005330 Ga0070690_100404827 Ga0070690_1004048272 54
96 3300005354 Ga0070675_101681993 Ga0070675_1016819931 54
97 3300041486 Ga0451807_1050901 Ga0451807_1050901_1089_1313 54
98 3300005614 Ga0068856_100000031 Ga0068856_100000031106 55
99 3300009147 Ga0114129_10094343 Ga0114129_100943433 55
100 3300026078 Ga0207702_10000071 Ga0207702_10000071107 55
101 3300006880 Ga0075429_100009151 Ga0075429_1000091513 56
102 3300013308 Ga0157375_13683489 Ga0157375_136834892 56
103 3300014745 Ga0157377_11742163 Ga0157377_117421632 56
104 3300025926 Ga0207659_11293721 Ga0207659_112937212 56
105 3300042436 Ga0439435_0035963 Ga0439435_0035963_561_785 56
106 3300049571 Ga0501034_0033240 Ga0501034_0033240_4368_4592 56
107 3300049573 Ga0501037_0731053 Ga0501037_0731053_422_646 56
108 3300049823 Ga0501044_0054664 Ga0501044_0054664_1462_1686 56
109 3300050508 nmdc:mga09592_1071_c1 nmdc:mga09592_1071_c1_18450_18674 56
110 3300013308 Ga0157375_10253110 Ga0157375_102531103 57
111 3300025942 Ga0207689_10177026 Ga0207689_101770262 57
112 3300041411 Ga0439466_0111365 Ga0439466_0111365_497_721 57
113 3300042002 Ga0439442_006321 Ga0439442_006321_1596_1820 57
114 3300042004 Ga0439445_0200454 Ga0439445_0200454_86_310 57
115 3300042006 Ga0439432_124239 Ga0439432_124239_344_568 57
116 3300042007 Ga0439449_0285728 Ga0439449_0285728_295_519 57
117 3300042134 Ga0450898_062601 Ga0450898_062601_260_484 57
118 3300042435 Ga0439434_0160654 Ga0439434_0160654_191_415 57
119 3300005295 Ga0065707_10105163 Ga0065707_101051632 58
120 3300005330 Ga0070690_100068643 Ga0070690_1000686433 58
121 3300005364 Ga0070673_100229784 Ga0070673_1002297842 58
122 3300005468 Ga0070707_101873111 Ga0070707_1018731112 58
123 3300005539 Ga0068853_100388309 Ga0068853_1003883091 58
124 3300005618 Ga0068864_100904694 Ga0068864_1009046941 58
125 3300005719 Ga0068861_100043378 Ga0068861_1000433784 58
126 3300005844 Ga0068862_100743332 Ga0068862_1007433322 58
127 3300006881 Ga0068865_101137801 Ga0068865_1011378011 58
128 3300009176 Ga0105242_12089716 Ga0105242_120897162 58
129 3300013306 Ga0163162_10317890 Ga0163162_103178903 58
130 3300013308 Ga0157375_11090238 Ga0157375_110902382 58
131 3300017792 Ga0163161_10003969 Ga0163161_100039693 58
132 3300025315 Ga0207697_10034102 Ga0207697_100341022 58
133 3300025936 Ga0207670_11092293 Ga0207670_110922932 58
134 3300025960 Ga0207651_10310228 Ga0207651_103102282 58
135 3300025981 Ga0207640_10486447 Ga0207640_104864471 58
136 3300026118 Ga0207675_100034818 Ga0207675_1000348182 58
137 3300053163 Ga0500639_365084 Ga0500639_365084_77_304 58
138 3300005355 Ga0070671_100853510 Ga0070671_1008535102 59
139 3300005616 Ga0068852_100552148 Ga0068852_1005521481 59
140 3300025903 Ga0207680_10071829 Ga0207680_100718292 59
141 3300026142 Ga0207698_10218313 Ga0207698_102183132 59
142 3300003323 rootH1_10250515 rootH1_102505153 60
143 3300005455 Ga0070663_100318396 Ga0070663_1003183962 60
144 3300005458 Ga0070681_11229673 Ga0070681_112296732 60
145 3300006880 Ga0075429_100750467 Ga0075429_1007504672 60
146 3300009094 Ga0111539_10244923 Ga0111539_102449232 60
147 3300017792 Ga0163161_10664499 Ga0163161_106644992 60
148 3300025907 Ga0207645_10039712 Ga0207645_100397123 60
149 3300025913 Ga0207695_10094981 Ga0207695_100949811 60
150 3300025925 Ga0207650_10002122 Ga0207650_1000212212 60
151 3300046459 Ga0495629_0673819 Ga0495629_0673819_382_597 60
152 3300050508 nmdc:mga09592_627065_c1 nmdc:mga09592_627065_c1_625_837 60
153 iso_pu_bacteria 2738541278 2738725545 60
154 3300005543 Ga0070672_101351170 Ga0070672_1013511701 61
155 3300041452 Ga0451793_1056124 Ga0451793_1056124_315_539 62
156 3300041498 Ga0451841_0528053 Ga0451841_0528053_439_663 62
157 3300041512 Ga0451853_2515415 Ga0451853_2515415_260_484 62
158 3300046453 Ga0495627_005234 Ga0495627_005234_4889_5113 62
159 3300046558 Ga0495633_0001128 Ga0495633_0001128_16987_17211 62
160 3300053093 Ga0500651_0082434 Ga0500651_0082434_760_984 62
161 3300003322 rootL2_10115587 rootL2_101155873 63
162 3300003322 rootL2_10317676 rootL2_103176762 63
163 3300005329 Ga0070683_100083679 Ga0070683_1000836793 63
164 3300005331 Ga0070670_100161389 Ga0070670_1001613892 63
165 3300005331 Ga0070670_100362233 Ga0070670_1003622333 63
166 3300005334 Ga0068869_100132163 Ga0068869_1001321633 63
167 3300005335 Ga0070666_10010452 Ga0070666_100104522 63
168 3300005338 Ga0068868_100045020 Ga0068868_1000450203 63
169 3300005338 Ga0068868_100090989 Ga0068868_1000909892 63
170 3300005340 Ga0070689_101902019 Ga0070689_1019020192 63
171 3300005344 Ga0070661_100688530 Ga0070661_1006885302 63
172 3300005347 Ga0070668_100049385 Ga0070668_1000493855 63
173 3300005353 Ga0070669_100014222 Ga0070669_1000142221 63
174 3300005354 Ga0070675_100401578 Ga0070675_1004015782 63
175 3300005354 Ga0070675_101119632 Ga0070675_1011196322 63
176 3300005355 Ga0070671_100205003 Ga0070671_1002050032 63
177 3300005356 Ga0070674_100342768 Ga0070674_1003427682 63
178 3300005356 Ga0070674_101006800 Ga0070674_1010068002 63
179 3300005364 Ga0070673_100073466 Ga0070673_1000734662 63
180 3300005364 Ga0070673_100874480 Ga0070673_1008744802 63
181 3300005367 Ga0070667_100065711 Ga0070667_1000657112 63
182 3300005367 Ga0070667_100476327 Ga0070667_1004763272 63
183 3300005436 Ga0070713_101249205 Ga0070713_1012492051 63
184 3300005455 Ga0070663_101731054 Ga0070663_1017310542 63
185 3300005456 Ga0070678_100220334 Ga0070678_1002203342 63
186 3300005457 Ga0070662_100303844 Ga0070662_1003038442 63
187 3300005459 Ga0068867_102364113 Ga0068867_1023641131 63
188 3300005466 Ga0070685_10708666 Ga0070685_107086662 63
189 3300005535 Ga0070684_100007643 Ga0070684_1000076436 63
190 3300005543 Ga0070672_100044494 Ga0070672_1000444942 63
191 3300005543 Ga0070672_100059564 Ga0070672_1000595642 63
192 3300005548 Ga0070665_100010845 Ga0070665_1000108453 63
193 3300005564 Ga0070664_100058857 Ga0070664_1000588573 63
194 3300005577 Ga0068857_101549116 Ga0068857_1015491162 63
195 3300005578 Ga0068854_100056479 Ga0068854_1000564793 63
196 3300005616 Ga0068852_100078138 Ga0068852_1000781384 63
197 3300005617 Ga0068859_100552844 Ga0068859_1005528442 63
198 3300005618 Ga0068864_101071118 Ga0068864_1010711182 63
199 3300005718 Ga0068866_10004875 Ga0068866_100048755 63
200 3300005719 Ga0068861_100052584 Ga0068861_1000525843 63
201 3300005834 Ga0068851_10032326 Ga0068851_100323263 63
202 3300005840 Ga0068870_10005184 Ga0068870_100051846 63
203 3300005841 Ga0068863_102532756 Ga0068863_1025327562 63
204 3300005843 Ga0068860_100058786 Ga0068860_1000587862 63
205 3300005844 Ga0068862_100445564 Ga0068862_1004455642 63
206 3300006175 Ga0070712_100177031 Ga0070712_1001770312 63
207 3300006358 Ga0068871_100008975 Ga0068871_1000089757 63
208 3300006881 Ga0068865_100015453 Ga0068865_1000154532 63
209 3300006931 Ga0097620_100552824 Ga0097620_1005528242 63
210 3300009174 Ga0105241_10662358 Ga0105241_106623581 63
211 3300009545 Ga0105237_10028845 Ga0105237_100288455 63
212 3300009553 Ga0105249_10102201 Ga0105249_101022013 63
213 3300010375 Ga0105239_11482965 Ga0105239_114829651 63
214 3300013297 Ga0157378_10386962 Ga0157378_103869622 63
215 3300013306 Ga0163162_10128079 Ga0163162_101280793 63
216 3300013307 Ga0157372_10939034 Ga0157372_109390342 63
217 3300014745 Ga0157377_10031232 Ga0157377_100312322 63
218 3300014969 Ga0157376_10845858 Ga0157376_108458582 63
219 3300017792 Ga0163161_10317507 Ga0163161_103175072 63
220 3300025893 Ga0207682_10078531 Ga0207682_100785312 63
221 3300025899 Ga0207642_10022528 Ga0207642_100225282 63
222 3300025903 Ga0207680_10373327 Ga0207680_103733272 63
223 3300025904 Ga0207647_10164682 Ga0207647_101646822 63
224 3300025905 Ga0207685_10325885 Ga0207685_103258852 63
225 3300025907 Ga0207645_10000356 Ga0207645_100003567 63
226 3300025908 Ga0207643_10125716 Ga0207643_101257162 63
227 3300025923 Ga0207681_10221815 Ga0207681_102218152 63
228 3300025925 Ga0207650_10886833 Ga0207650_108868332 63
229 3300025926 Ga0207659_10557885 Ga0207659_105578852 63
230 3300025931 Ga0207644_10120236 Ga0207644_101202363 63
231 3300025933 Ga0207706_10070944 Ga0207706_100709443 63
232 3300025937 Ga0207669_10356731 Ga0207669_103567312 63
233 3300025938 Ga0207704_10089921 Ga0207704_100899212 63
234 3300025940 Ga0207691_10002055 Ga0207691_100020552 63
235 3300025942 Ga0207689_10011163 Ga0207689_100111632 63
236 3300025944 Ga0207661_10355074 Ga0207661_103550743 63
237 3300025945 Ga0207679_10040960 Ga0207679_100409603 63
238 3300025960 Ga0207651_10641417 Ga0207651_106414172 63
239 3300025961 Ga0207712_12041958 Ga0207712_120419581 63
240 3300025972 Ga0207668_10461994 Ga0207668_104619942 63
241 3300025986 Ga0207658_10071750 Ga0207658_100717502 63
242 3300026023 Ga0207677_10155445 Ga0207677_101554452 63
243 3300026041 Ga0207639_11110925 Ga0207639_111109253 63
244 3300026089 Ga0207648_10000372 Ga0207648_1000037237 63
245 3300026116 Ga0207674_10145252 Ga0207674_101452522 63
246 3300026121 Ga0207683_10001338 Ga0207683_100013386 63
247 3300028379 Ga0268266_10079735 Ga0268266_100797352 63
248 3300028381 Ga0268264_10032264 Ga0268264_100322641 63
249 3300031730 Ga0307516_10408212 Ga0307516_104082122 63
250 3300044658 Ga0466972_0182028 Ga0466972_0182028_81_302 63
251 3300044706 Ga0466964_0636583 Ga0466964_0636583_351_572 63
252 3300001904 JGI24736J21556_1046166 JGI24736J21556_10461662 64
253 3300003316 rootH1_10056854 rootH1_100568548 64
254 3300003323 rootH1_10032311 rootH1_1003231116 64
255 3300005289 Ga0065704_10339059 Ga0065704_103390592 64
256 3300005329 Ga0070683_100000569 Ga0070683_1000005696 64
257 3300005339 Ga0070660_101688484 Ga0070660_1016884841 64
258 3300005340 Ga0070689_100035678 Ga0070689_1000356782 64
259 3300005341 Ga0070691_10289319 Ga0070691_102893191 64
260 3300005353 Ga0070669_100472432 Ga0070669_1004724322 64
261 3300005365 Ga0070688_100034288 Ga0070688_1000342882 64
262 3300005366 Ga0070659_100580493 Ga0070659_1005804932 64
263 3300005367 Ga0070667_100148432 Ga0070667_1001484322 64
264 3300005444 Ga0070694_100274929 Ga0070694_1002749292 64
265 3300005459 Ga0068867_100142486 Ga0068867_1001424862 64
266 3300005471 Ga0070698_100000061 Ga0070698_10000006111 64
267 3300005518 Ga0070699_100446528 Ga0070699_1004465281 64
268 3300005535 Ga0070684_100015118 Ga0070684_1000151187 64
269 3300005539 Ga0068853_100190842 Ga0068853_1001908423 64
270 3300005539 Ga0068853_100253441 Ga0068853_1002534412 64
271 3300005543 Ga0070672_102064881 Ga0070672_1020648812 64
272 3300005544 Ga0070686_100197521 Ga0070686_1001975212 64
273 3300005563 Ga0068855_100000548 Ga0068855_1000005488 64
274 3300005563 Ga0068855_100002500 Ga0068855_1000025004 64
275 3300005563 Ga0068855_100037991 Ga0068855_1000379917 64
276 3300005563 Ga0068855_101995189 Ga0068855_1019951891 64
277 3300005577 Ga0068857_100003780 Ga0068857_10000378013 64
278 3300005577 Ga0068857_100161867 Ga0068857_1001618673 64
279 3300005578 Ga0068854_100019492 Ga0068854_1000194922 64
280 3300005578 Ga0068854_101161135 Ga0068854_1011611352 64
281 3300005614 Ga0068856_100005116 Ga0068856_1000051164 64
282 3300005614 Ga0068856_100145920 Ga0068856_1001459203 64
283 3300005616 Ga0068852_100001717 Ga0068852_1000017177 64
284 3300005616 Ga0068852_100327585 Ga0068852_1003275853 64
285 3300005616 Ga0068852_101657518 Ga0068852_1016575182 64
286 3300005616 Ga0068852_102388049 Ga0068852_1023880492 64
287 3300005617 Ga0068859_100250254 Ga0068859_1002502543 64
288 3300005617 Ga0068859_100411381 Ga0068859_1004113812 64
289 3300005618 Ga0068864_100046834 Ga0068864_1000468345 64
290 3300005618 Ga0068864_101768581 Ga0068864_1017685812 64
291 3300005719 Ga0068861_100231947 Ga0068861_1002319472 64
292 3300005719 Ga0068861_100640110 Ga0068861_1006401102 64
293 3300005843 Ga0068860_100026036 Ga0068860_1000260365 64
294 3300005843 Ga0068860_100051790 Ga0068860_1000517904 64
295 3300005844 Ga0068862_100013377 Ga0068862_1000133774 64
296 3300006195 Ga0075366_10022862 Ga0075366_100228622 64
297 3300006931 Ga0097620_100250244 Ga0097620_1002502443 64
298 3300006931 Ga0097620_100411401 Ga0097620_1004114012 64
299 3300009093 Ga0105240_10008990 Ga0105240_100089909 64
300 3300009093 Ga0105240_10009858 Ga0105240_100098589 64
301 3300009093 Ga0105240_10422635 Ga0105240_104226353 64
302 3300009147 Ga0114129_10019832 Ga0114129_100198326 64
303 3300009174 Ga0105241_10020978 Ga0105241_100209782 64
304 3300009174 Ga0105241_10123984 Ga0105241_101239843 64
305 3300009174 Ga0105241_12404034 Ga0105241_124040342 64
306 3300009176 Ga0105242_10212875 Ga0105242_102128752 64
307 3300009545 Ga0105237_10460241 Ga0105237_104602413 64
308 3300009545 Ga0105237_10818494 Ga0105237_108184942 64
309 3300009551 Ga0105238_10111860 Ga0105238_101118602 64
310 3300009553 Ga0105249_10032709 Ga0105249_100327092 64
311 3300010375 Ga0105239_10001747 Ga0105239_1000174713 64
312 3300010375 Ga0105239_10023446 Ga0105239_100234463 64
313 3300010375 Ga0105239_12389575 Ga0105239_123895752 64
314 3300013100 Ga0157373_10125447 Ga0157373_101254471 64
315 3300013100 Ga0157373_10589683 Ga0157373_105896832 64
316 3300013102 Ga0157371_10243305 Ga0157371_102433053 64
317 3300013102 Ga0157371_10341866 Ga0157371_103418662 64
318 3300013102 Ga0157371_10606533 Ga0157371_106065332 64
319 3300013104 Ga0157370_10003043 Ga0157370_100030437 64
320 3300013104 Ga0157370_10222506 Ga0157370_102225063 64
321 3300013104 Ga0157370_10342444 Ga0157370_103424442 64
322 3300013105 Ga0157369_10013114 Ga0157369_100131146 64
323 3300013105 Ga0157369_10073203 Ga0157369_100732033 64
324 3300013105 Ga0157369_10872976 Ga0157369_108729762 64
325 3300013296 Ga0157374_10248632 Ga0157374_102486322 64
326 3300013306 Ga0163162_10000446 Ga0163162_1000044624 64
327 3300013307 Ga0157372_10000231 Ga0157372_1000023116 64
328 3300013307 Ga0157372_10163153 Ga0157372_101631533 64
329 3300013307 Ga0157372_10191152 Ga0157372_101911522 64
330 3300013307 Ga0157372_12092465 Ga0157372_120924652 64
331 3300013307 Ga0157372_12802633 Ga0157372_128026332 64
332 3300013308 Ga0157375_10344007 Ga0157375_103440072 64
333 3300013308 Ga0157375_12072652 Ga0157375_120726522 64
334 3300020081 Ga0206354_11661726 Ga0206354_116617262 64
335 3300025246 Ga0209646_1000637 Ga0209646_100063714 64
336 3300025904 Ga0207647_10005456 Ga0207647_100054566 64
337 3300025911 Ga0207654_10179898 Ga0207654_101798982 64
338 3300025912 Ga0207707_10621230 Ga0207707_106212302 64
339 3300025913 Ga0207695_10000686 Ga0207695_1000068656 64
340 3300025913 Ga0207695_10527967 Ga0207695_105279673 64
341 3300025914 Ga0207671_10166955 Ga0207671_101669552 64
342 3300025919 Ga0207657_11304470 Ga0207657_113044702 64
343 3300025920 Ga0207649_10487085 Ga0207649_104870852 64
344 3300025921 Ga0207652_10002842 Ga0207652_100028424 64
345 3300025922 Ga0207646_10911177 Ga0207646_109111771 64
346 3300025923 Ga0207681_10505163 Ga0207681_105051632 64
347 3300025932 Ga0207690_11276009 Ga0207690_112760092 64
348 3300025934 Ga0207686_10386712 Ga0207686_103867122 64
349 3300025944 Ga0207661_10069964 Ga0207661_100699642 64
350 3300025949 Ga0207667_10000100 Ga0207667_1000010017 64
351 3300025949 Ga0207667_10004787 Ga0207667_100047879 64
352 3300025949 Ga0207667_10005867 Ga0207667_1000586712 64
353 3300025949 Ga0207667_11165023 Ga0207667_111650232 64
354 3300025961 Ga0207712_10496183 Ga0207712_104961831 64
355 3300025961 Ga0207712_11754413 Ga0207712_117544132 64
356 3300025972 Ga0207668_10636836 Ga0207668_106368362 64
357 3300025981 Ga0207640_10117229 Ga0207640_101172294 64
358 3300025986 Ga0207658_10198001 Ga0207658_101980012 64
359 3300025986 Ga0207658_10636518 Ga0207658_106365182 64
360 3300026041 Ga0207639_10469645 Ga0207639_104696451 64
361 3300026078 Ga0207702_10082430 Ga0207702_100824303 64
362 3300026078 Ga0207702_10139740 Ga0207702_101397402 64
363 3300026095 Ga0207676_10239815 Ga0207676_102398152 64
364 3300026095 Ga0207676_10442281 Ga0207676_104422813 64
365 3300026116 Ga0207674_10007452 Ga0207674_100074524 64
366 3300026116 Ga0207674_10063208 Ga0207674_100632082 64
367 3300026116 Ga0207674_11150325 Ga0207674_111503252 64
368 3300026118 Ga0207675_100945954 Ga0207675_1009459542 64
369 3300026142 Ga0207698_10001532 Ga0207698_100015327 64
370 3300026142 Ga0207698_10024352 Ga0207698_100243524 64
371 3300026142 Ga0207698_10436235 Ga0207698_104362353 64
372 3300026142 Ga0207698_10900232 Ga0207698_109002322 64
373 3300028380 Ga0268265_11024148 Ga0268265_110241482 64
374 3300028381 Ga0268264_10018210 Ga0268264_100182105 64
375 3300028381 Ga0268264_10076170 Ga0268264_100761703 64
376 3300028381 Ga0268264_10914394 Ga0268264_109143942 64
377 3300030744 Ga0316181_1165475 Ga0316181_11654752 64
378 3300030745 Ga0316182_1216286 Ga0316182_12162861 64
379 3300031456 Ga0307513_10277253 Ga0307513_102772532 64
380 3300031456 Ga0307513_10281258 Ga0307513_102812581 64
381 3300031548 Ga0307408_100000164 Ga0307408_10000016466 64
382 3300032002 Ga0307416_102936612 Ga0307416_1029366121 64
383 3300041404 Ga0439436_0032520 Ga0439436_0032520_168_392 64
384 3300041459 Ga0451800_0810061 Ga0451800_0810061_169_393 64
385 3300041459 Ga0451800_1220908 Ga0451800_1220908_439_663 64
386 3300041460 Ga0451802_1394932 Ga0451802_1394932_490_714 64
387 3300041498 Ga0451841_0815977 Ga0451841_0815977_385_609 64
388 3300041503 Ga0451847_0092574 Ga0451847_0092574_325_549 64
389 3300041503 Ga0451847_0215079 Ga0451847_0215079_101_325 64
390 3300041505 Ga0451849_0252164 Ga0451849_0252164_373_597 64
391 3300042014 Ga0439457_000047 Ga0439457_000047_14808_15032 64
392 3300042015 Ga0439462_0065581 Ga0439462_0065581_152_376 64
393 3300044683 Ga0466965_0493742 Ga0466965_0493742_366_590 64
394 3300044706 Ga0466964_0664540 Ga0466964_0664540_213_437 64
395 3300044735 Ga0466968_0027356 Ga0466968_0027356_1767_1991 64
396 3300044842 Ga0466957_0207076 Ga0466957_0207076_537_761 64
397 3300046499 Ga0495594_0748638 Ga0495594_0748638_297_521 64
398 3300049575 Ga0501039_1374457 Ga0501039_1374457_284_508 64
399 3300049579 Ga0501043_0251581 Ga0501043_0251581_332_556 64
400 3300049581 Ga0501047_0027634 Ga0501047_0027634_4681_4905 64
401 3300049581 Ga0501047_0507558 Ga0501047_0507558_439_663 64
402 3300049669 Ga0501235_062304 Ga0501235_062304_429_653 64
403 3300049686 Ga0501257_032979 Ga0501257_032979_979_1203 64
404 3300049823 Ga0501044_0023525 Ga0501044_0023525_5836_6060 64
405 3300049823 Ga0501044_0971313 Ga0501044_0971313_38_262 64
406 3300050493 nmdc:mga0k408_454399_c1 nmdc:mga0k408_454399_c1_328_552 64
407 3300050507 nmdc:mga05p37_14343_c1 nmdc:mga05p37_14343_c1_4036_4260 64
408 3300053089 Ga0500581_116855 Ga0500581_116855_651_875 64
409 3300053093 Ga0500651_0484792 Ga0500651_0484792_324_548 64
410 3300053104 Ga0500556_0048863 Ga0500556_0048863_448_672 64
411 3300053147 Ga0500589_263957 Ga0500589_263957_202_426 64
412 3300053156 Ga0500622_0029072 Ga0500622_0029072_1096_1320 64
413 3300061719 Ga0466962_0314022 Ga0466962_0314022_431_655 64

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11146

DUF2905

Protein of unknown function (DUF2905)

1

61

0.96

Feature Viewer

pLDDT pTM Quality
75.96 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map