F437842

General Info

Members Datasets Scaffolds Average Seq Length
412 297 824 175

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100353233|Ga0307415_1003532332
Length 202
Sequence MSKHTLSILVENKHGVLARVAALISRRGFNIDSLAVGPTEHPEVSRMTIAVSVDEQPLEQITKQLNKLVNVIKIVELEPTQTVQRELLLVKVKADTLTRGQVLETVQLFRAKVVDVAPDAITIEATGNPEKLEAMLRVLEPFGVRELVQSGMVAIGRGSRSISDRTLRPVPVPPPHVQSGPPNSAARPADRGRTAAAVPNQH

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
88 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
89 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
114 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
115 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
118 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
119 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
120 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
231 2508501039 Frankia saprophytica CN3 Isolate Nodule
232 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
233 2517572101 Frankia sp. DC12 Isolate Nodule
234 2527291627 Frankia casuarinae Thr Isolate Nodule
235 2527291629 Frankia sp. BMG5.23 Isolate Nodule
236 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
237 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
238 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
239 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
240 2619618881 Frankia sp. ACN1ag Isolate Unclassified
241 2619619003 Frankia sp. CpI1-P Isolate Nodule
242 2643221548 Streptomyces sp. Root55 Isolate Unclassified
243 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
244 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
245 2643221613 Oerskovia sp. Root22 Isolate Unclassified
246 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
247 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
248 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
249 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
250 2643221721 Oerskovia sp. Root918 Isolate Unclassified
251 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
252 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
253 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
254 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
255 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
256 2687453737 Frankia sp. BMG5.36 Isolate Nodule
257 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
258 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
259 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
260 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
261 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
262 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
263 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
264 2773857924 Frankia sp. CgIS1 Isolate Nodule
265 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
266 2808606394 Promicromonospora sp. C35 Isolate Unclassified
267 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
268 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
269 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
270 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
271 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
272 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
273 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
274 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
275 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
276 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
277 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
278 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
279 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
280 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
281 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
282 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
283 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
284 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
285 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
286 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
287 637000116 Frankia casuarinae CcI3 Isolate Nodule
288 8002775197 Frankia nepalensis CN7 Isolate Nodule
289 8002784119 Frankia sp. AgB1.9 Isolate Nodule
290 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
291 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
292 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
293 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
294 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
295 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
296 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
297 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.07
Metatranscriptomes 2.67
Isolates 16.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 3.16
Nodule 3.16
Rhizoplane 5.34
Rhizosphere 72.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100353233 3300032126 Bacteria 1238
2 JGI24740J21852_10020332 3300001979 Bacteria 2318
3 JGI24739J22299_10015356 3300001989 Bacteria 2780
4 JGI24739J22299_10019512 3300001989 Bacteria 2426
5 JGI24737J22298_10022388 3300001990 Bacteria 2009
6 JGI24735J21928_10034620 3300002067 Bacteria 1488
7 Ga0007423J48922_100219 3300003285 Bacteria 12900
8 JGI25405J52794_10070529 3300003911 Bacteria 762
9 Ga0065714_10258358 3300005288 Bacteria 761
10 Ga0070658_10935143 3300005327 Bacteria 754
11 Ga0070682_100148698 3300005337 Bacteria 1604
12 Ga0070682_100156706 3300005337 Bacteria 1568
13 Ga0070661_100714698 3300005344 Bacteria 817
14 Ga0070668_100136748 3300005347 Bacteria 1971
15 Ga0070668_100880255 3300005347 Bacteria 799
16 Ga0070668_101053051 3300005347 Bacteria 733
17 Ga0070671_100272856 3300005355 Bacteria 1438
18 Ga0070663_100743482 3300005455 Bacteria 837
19 Ga0070678_100337155 3300005456 Bacteria 1292
20 Ga0070678_100836391 3300005456 Bacteria 838
21 Ga0068867_100167994 3300005459 Bacteria 1735
22 Ga0070684_100255031 3300005535 Bacteria 1603
23 Ga0070686_100721464 3300005544 Bacteria 797
24 Ga0070696_100041026 3300005546 Bacteria 3197
25 Ga0070693_100067251 3300005547 Bacteria 2100
26 Ga0070665_100566313 3300005548 Bacteria 1149
27 Ga0068857_100119332 3300005577 Bacteria 2374
28 Ga0070702_100105510 3300005615 Bacteria 1737
29 Ga0068852_100232228 3300005616 Bacteria 1759
30 Ga0068852_100664758 3300005616 Bacteria 1050
31 Ga0068859_100000103 3300005617 Bacteria 79192
32 Ga0068861_101109967 3300005719 Bacteria 760
33 Ga0068851_10645046 3300005834 Bacteria 648
34 Ga0068863_100004756 3300005841 Bacteria 13378
35 Ga0068858_100538440 3300005842 Bacteria 1130
36 Ga0068862_100000232 3300005844 Bacteria 62130
37 Ga0081455_10005839 3300005937 Bacteria 13388
38 Ga0081538_10248418 3300005981 Bacteria 680
39 Ga0081540_1001174 3300005983 Bacteria 22953
40 Ga0075364_10005914 3300006051 Bacteria 7149
41 Ga0075364_10213208 3300006051 Bacteria 1310
42 Ga0075364_10373910 3300006051 Bacteria 972
43 Ga0070716_101004250 3300006173 Bacteria 660
44 Ga0075370_10126876 3300006353 Bacteria 1487
45 Ga0075428_100006874 3300006844 Bacteria 12637
46 Ga0075429_100034994 3300006880 Bacteria 4365
47 Ga0068865_100701111 3300006881 Bacteria 865
48 Ga0097620_100000103 3300006931 Bacteria 79192
49 Ga0097620_100011001 3300006931 Bacteria 9106
50 Ga0105240_10725872 3300009093 Bacteria 1082
51 Ga0105245_10012832 3300009098 Bacteria 7300
52 Ga0105245_10334794 3300009098 Bacteria 1495
53 Ga0105247_10000014 3300009101 Bacteria 285043
54 Ga0105247_10826712 3300009101 Bacteria 709
55 Ga0105243_10030404 3300009148 Bacteria 4158
56 Ga0105243_11083748 3300009148 Bacteria 808
57 Ga0105248_10000038 3300009177 Bacteria 179916
58 Ga0105248_10001871 3300009177 Bacteria 23331
59 Ga0105249_10034941 3300009553 Bacteria 4557
60 Ga0105249_10279166 3300009553 Bacteria 1667
61 Ga0105249_10441791 3300009553 Bacteria 1338
62 Ga0105249_11408519 3300009553 Bacteria 769
63 Ga0105239_10509382 3300010375 Bacteria 1369
64 Ga0105246_10184109 3300011119 Bacteria 1611
65 Ga0157371_10508902 3300013102 Bacteria 890
66 Ga0157370_10076159 3300013104 Bacteria 3161
67 Ga0157370_10677921 3300013104 Bacteria 941
68 Ga0157369_10605424 3300013105 Bacteria 1131
69 Ga0157369_11773138 3300013105 Bacteria 627
70 Ga0157372_10084698 3300013307 Bacteria 3594
71 Ga0157372_10156843 3300013307 Bacteria 2629
72 Ga0157372_10175713 3300013307 Bacteria 2478
73 Ga0157375_10074256 3300013308 Bacteria 3421
74 Ga0163163_10007686 3300014325 Bacteria 9524
75 Ga0163163_10021193 3300014325 Bacteria 6130
76 Ga0163163_11675971 3300014325 Bacteria 696
77 Ga0157380_10134324 3300014326 Bacteria 2115
78 Ga0157380_10389136 3300014326 Bacteria 1319
79 Ga0157379_10649798 3300014968 Bacteria 987
80 Ga0163161_10117247 3300017792 Bacteria 1997
81 Ga0163161_10288982 3300017792 Bacteria 1288
82 Ga0163161_10500168 3300017792 Bacteria 990
83 Ga0197907_11379459 3300020069 Bacteria 1230
84 Ga0197907_11415599 3300020069 Bacteria 893
85 Ga0206356_11870264 3300020070 Bacteria 1259
86 Ga0206350_11506015 3300020080 Bacteria 1083
87 Ga0213876_10002143 3300021384 Bacteria 11673
88 Ga0224712_10232487 3300022467 Bacteria 847
89 Ga0224712_10425545 3300022467 Bacteria 635
90 Ga0207710_10000031 3300025900 Bacteria 285157
91 Ga0207647_10052808 3300025904 Bacteria 2507
92 Ga0207643_10101172 3300025908 Bacteria 1690
93 Ga0207705_10404084 3300025909 Bacteria 1056
94 Ga0207694_10518755 3300025924 Bacteria 998
95 Ga0207669_10384359 3300025937 Bacteria 1095
96 Ga0207704_10589999 3300025938 Bacteria 908
97 Ga0207691_10236573 3300025940 Bacteria 1580
98 Ga0207711_10000680 3300025941 Bacteria 33744
99 Ga0207711_10005918 3300025941 Bacteria 10330
100 Ga0207661_10454353 3300025944 Bacteria 1167
101 Ga0207712_10193967 3300025961 Bacteria 1605
102 Ga0207712_10575332 3300025961 Bacteria 972
103 Ga0207712_10648103 3300025961 Bacteria 918
104 Ga0207668_10097097 3300025972 Bacteria 2180
105 Ga0207668_10435195 3300025972 Bacteria 1116
106 Ga0207668_10850903 3300025972 Bacteria 810
107 Ga0207640_10255506 3300025981 Bacteria 1362
108 Ga0207678_10105360 3300026067 Bacteria 2406
109 Ga0207678_10243829 3300026067 Bacteria 1539
110 Ga0207702_10246009 3300026078 Bacteria 1677
111 Ga0207641_10000587 3300026088 Bacteria 39995
112 Ga0207674_10338973 3300026116 Bacteria 1454
113 Ga0207674_10609072 3300026116 Bacteria 1055
114 Ga0207675_100809631 3300026118 Bacteria 950
115 Ga0207683_10412894 3300026121 Bacteria 1242
116 Ga0207698_10168024 3300026142 Bacteria 1928
117 Ga0207698_10384327 3300026142 Bacteria 1336
118 Ga0207698_10519384 3300026142 Bacteria 1162
119 Ga0268265_10000161 3300028380 Bacteria 81761
120 Ga0268265_10197830 3300028380 Bacteria 1741
121 Ga0268264_10197700 3300028381 Bacteria 1837
122 Ga0307517_10148834 3300028786 Bacteria 1614
123 Ga0307517_10234216 3300028786 Bacteria 1098
124 Ga0307515_10353885 3300028794 Bacteria 1113
125 Ga0316176_1164944 3300030732 Bacteria 3500
126 Ga0316181_1013717 3300030744 Bacteria 1002
127 Ga0316181_1161165 3300030744 Bacteria 1476
128 Ga0316182_1257982 3300030745 Bacteria 6210
129 Ga0265332_10156205 3300031238 Bacteria 954
130 Ga0265325_10005992 3300031241 Bacteria 7440
131 Ga0265325_10124558 3300031241 Bacteria 1239
132 Ga0265325_10142337 3300031241 Bacteria 1139
133 Ga0265340_10020008 3300031247 Bacteria 3443
134 Ga0265339_10111791 3300031249 Bacteria 1413
135 Ga0265316_10033289 3300031344 Bacteria 4199
136 Ga0265316_10407018 3300031344 Bacteria 979
137 Ga0265313_10161216 3300031595 Bacteria 952
138 Ga0265313_10248805 3300031595 Bacteria 725
139 Ga0307508_10261565 3300031616 Bacteria 1325
140 Ga0265314_10076174 3300031711 Bacteria 2230
141 Ga0265342_10045452 3300031712 Bacteria 2643
142 Ga0265342_10199739 3300031712 Bacteria 1087
143 Ga0307413_10647770 3300031824 Bacteria 871
144 Ga0307413_10863450 3300031824 Bacteria 766
145 Ga0307410_10286044 3300031852 Bacteria 1296
146 Ga0307406_10729959 3300031901 Bacteria 830
147 Ga0307412_11802077 3300031911 Bacteria 563
148 Ga0307416_100604397 3300032002 Bacteria 1177
149 Ga0307507_10073067 3300033179 Bacteria 3086
150 Ga0395899_0209386 3300037312 Bacteria 1356
151 Ga0395901_0208625 3300038443 Bacteria 2046
152 Ga0395901_0590335 3300038443 Bacteria 1121
153 Ga0436365_0950230 3300039437 Bacteria 25492
154 Ga0436363_0727995 3300039450 Bacteria 1910
155 Ga0439466_0077201 3300041411 Bacteria 1054
156 Ga0439465_0054716 3300041413 Bacteria 1313
157 Ga0439465_0143837 3300041413 Bacteria 848
158 Ga0451791_0685422 3300041451 Bacteria 4015
159 Ga0451793_0164075 3300041452 Bacteria 1898
160 Ga0451798_0608106 3300041458 Bacteria 640
161 Ga0451800_0982963 3300041459 Bacteria 502
162 Ga0451833_1318116 3300041491 Bacteria 603
163 Ga0451837_0698950 3300041494 Bacteria 2969
164 Ga0451839_0131691 3300041496 Bacteria 2187
165 Ga0451841_1322198 3300041498 Bacteria 776
166 Ga0451847_0771052 3300041503 Bacteria 770
167 Ga0451843_1638129 3300041509 Bacteria 838
168 Ga0451853_3518340 3300041512 Bacteria 1021
169 Ga0439431_0010861 3300041997 Bacteria 2074
170 Ga0439445_0002108 3300042004 Bacteria 4400
171 Ga0439434_0068402 3300042435 Bacteria 1116
172 Ga0466969_0001426 3300044656 Bacteria 12898
173 Ga0466969_0005549 3300044656 Bacteria 6706
174 Ga0466969_0025927 3300044656 Bacteria 3010
175 Ga0466965_0311721 3300044683 Bacteria 856
176 Ga0466965_0431682 3300044683 Bacteria 731
177 Ga0466965_0692029 3300044683 Bacteria 584
178 Ga0466966_0020242 3300044684 Bacteria 4378
179 Ga0466966_0026557 3300044684 Bacteria 3780
180 Ga0466966_0203442 3300044684 Bacteria 1198
181 Ga0466961_0005178 3300044693 Bacteria 8204
182 Ga0466961_0040792 3300044693 Bacteria 2976
183 Ga0466961_0063208 3300044693 Bacteria 2352
184 Ga0466961_0192280 3300044693 Bacteria 1265
185 Ga0466963_0106815 3300044694 Bacteria 1919
186 Ga0466963_0207459 3300044694 Bacteria 1371
187 Ga0466963_0271609 3300044694 Bacteria 1191
188 Ga0466964_0130802 3300044706 Bacteria 1143
189 Ga0466964_0146962 3300044706 Bacteria 1089
190 Ga0466971_0001796 3300044719 Bacteria 9106
191 Ga0466971_0168358 3300044719 Bacteria 1027
192 Ga0466970_0240085 3300044765 Bacteria 1014
193 Ga0466970_0426734 3300044765 Bacteria 758
194 Ga0466957_0094174 3300044842 Bacteria 1880
195 Ga0466957_0994590 3300044842 Bacteria 602
196 Ga0466960_0006365 3300044901 Bacteria 4734
197 Ga0466960_0024185 3300044901 Bacteria 2738
198 Ga0466959_0011972 3300045049 Bacteria 6255
199 Ga0466958_0052040 3300045836 Bacteria 2481
200 Ga0466958_0082424 3300045836 Bacteria 1981
201 Ga0466958_0356133 3300045836 Bacteria 942
202 Ga0466958_0385678 3300045836 Bacteria 904
203 Ga0466967_0013404 3300045976 Bacteria 6333
204 Ga0466967_0025676 3300045976 Bacteria 4861
205 Ga0466967_0073646 3300045976 Bacteria 3065
206 Ga0466967_0134691 3300045976 Bacteria 2297
207 Ga0466967_1399378 3300045976 Bacteria 697
208 Ga0466967_2080791 3300045976 Bacteria 564
209 Ga0495627_010310 3300046453 Bacteria 3403
210 Ga0495603_0044961 3300046455 Bacteria 2634
211 Ga0495629_0138264 3300046459 Bacteria 1696
212 Ga0495651_0077142 3300046462 Bacteria 2523
213 Ga0495653_0017203 3300046463 Bacteria 5879
214 Ga0495653_0052830 3300046463 Bacteria 3112
215 Ga0495662_0006323 3300046476 Bacteria 5921
216 Ga0495662_0443044 3300046476 Bacteria 637
217 Ga0495664_0018030 3300046477 Bacteria 4037
218 Ga0495584_0404731 3300046491 Bacteria 693
219 Ga0495608_0000504 3300046511 Bacteria 26840
220 Ga0495628_0005234 3300046516 Bacteria 11386
221 Ga0495630_0500685 3300046517 Bacteria 931
222 Ga0495631_0223165 3300046518 Bacteria 804
223 Ga0495648_0020224 3300046524 Bacteria 4652
224 Ga0495666_0000748 3300046526 Bacteria 14948
225 Ga0495652_0081043 3300046529 Bacteria 2678
226 Ga0495665_0003667 3300046531 Bacteria 8331
227 Ga0495640_0032733 3300046533 Bacteria 3699
228 Ga0495586_0041500 3300046535 Bacteria 2478
229 Ga0495587_0135077 3300046536 Bacteria 1409
230 Ga0495645_0001246 3300046543 Bacteria 17373
231 Ga0495645_0109635 3300046543 Bacteria 1954
232 Ga0495645_0417261 3300046543 Bacteria 852
233 Ga0495667_0024420 3300046559 Bacteria 4069
234 Ga0495667_0628029 3300046559 Bacteria 668
235 Ga0495634_0009860 3300046642 Bacteria 7027
236 Ga0495635_0009890 3300046663 Bacteria 6667
237 Ga0495588_0054423 3300046674 Bacteria 2064
238 Ga0495657_0005346 3300046675 Bacteria 10158
239 Ga0495657_0183579 3300046675 Bacteria 1282
240 Ga0495599_0050090 3300046678 Bacteria 2617
241 Ga0495623_0003783 3300046679 Bacteria 9970
242 Ga0495646_0018406 3300046680 Bacteria 4423
243 Ga0495646_0341459 3300046680 Bacteria 786
244 Ga0495613_0001655 3300046689 Bacteria 16964
245 Ga0495613_0003685 3300046689 Bacteria 11483
246 Ga0495600_0183580 3300046809 Bacteria 1347
247 Ga0495604_0000730 3300047317 Bacteria 27582
248 Ga0495604_0002789 3300047317 Bacteria 14016
249 Ga0495674_0135711 3300047319 Bacteria 2070
250 Ga0495675_0013731 3300047444 Bacteria 5119
251 Ga0495675_0028125 3300047444 Bacteria 3584
252 Ga0495675_0312170 3300047444 Bacteria 931
253 Ga0495684_0066319 3300047471 Bacteria 2744
254 Ga0495602_0007615 3300048088 Bacteria 11322
255 Ga0495614_0000083 3300048089 Bacteria 31058
256 Ga0496101_0632006 3300048904 Bacteria 846
257 Ga0496102_0575438 3300048905 Bacteria 1049
258 Ga0496102_0719686 3300048905 Bacteria 921
259 Ga0496103_0440083 3300048906 Bacteria 836
260 Ga0496104_0203294 3300048907 Bacteria 1892
261 Ga0496106_0119881 3300048909 Bacteria 2055
262 Ga0496108_0012156 3300048911 Bacteria 7001
263 Ga0496108_0192093 3300048911 Bacteria 1770
264 Ga0496109_0015892 3300048912 Bacteria 6573
265 Ga0496109_0252239 3300048912 Bacteria 1662
266 Ga0496110_0071806 3300048913 Bacteria 3070
267 Ga0496110_0392198 3300048913 Bacteria 1265
268 Ga0496112_0752391 3300048915 Bacteria 901
269 Ga0496113_0082529 3300048916 Bacteria 2465
270 Ga0496114_0072175 3300048917 Bacteria 2902
271 Ga0496114_0580300 3300048917 Bacteria 989
272 Ga0496115_0152620 3300048918 Bacteria 1908
273 Ga0496116_0000491 3300048919 Bacteria 54460
274 Ga0496117_0003331 3300048920 Bacteria 18767
275 Ga0496117_0009357 3300048920 Bacteria 9126
276 Ga0496117_0058479 3300048920 Bacteria 2669
277 Ga0496118_0004465 3300048921 Bacteria 16594
278 Ga0496118_0014039 3300048921 Bacteria 7522
279 Ga0496118_0034292 3300048921 Bacteria 4144
280 Ga0496119_0002786 3300048922 Bacteria 18744
281 Ga0496119_0006867 3300048922 Bacteria 10400
282 Ga0496119_0045172 3300048922 Bacteria 2765
283 Ga0496120_0003334 3300048923 Bacteria 14748
284 Ga0496120_0326574 3300048923 Bacteria 695
285 Ga0496121_0011172 3300048924 Bacteria 10013
286 Ga0496122_0001413 3300048925 Bacteria 38906
287 Ga0496124_0066258 3300048927 Bacteria 3008
288 Ga0496124_0210536 3300048927 Bacteria 1471
289 Ga0496125_0000075 3300048928 Bacteria 234414
290 Ga0496125_0000977 3300048928 Bacteria 44759
291 Ga0501318_012499 3300049534 Bacteria 974
292 Ga0501031_0007480 3300049568 Bacteria 7114
293 Ga0501032_0030375 3300049569 Bacteria 3707
294 Ga0501033_0018046 3300049570 Bacteria 5329
295 Ga0501034_0048420 3300049571 Bacteria 4289
296 Ga0501034_0421138 3300049571 Bacteria 1256
297 Ga0501034_0787746 3300049571 Bacteria 844
298 Ga0501037_0236454 3300049573 Bacteria 1281
299 Ga0501038_0088765 3300049574 Bacteria 2594
300 Ga0501039_0007440 3300049575 Bacteria 8357
301 Ga0501042_0332920 3300049578 Bacteria 1097
302 Ga0501043_0144077 3300049579 Bacteria 1865
303 Ga0501047_0007593 3300049581 Bacteria 10203
304 Ga0501047_0101520 3300049581 Bacteria 2756
305 Ga0501047_0179650 3300049581 Bacteria 1983
306 Ga0501067_0259327 3300049583 Bacteria 968
307 Ga0501069_0004690 3300049585 Bacteria 7064
308 Ga0501069_0125392 3300049585 Bacteria 1468
309 Ga0501070_0001926 3300049586 Bacteria 18311
310 Ga0501070_0004935 3300049586 Bacteria 11386
311 Ga0501070_0009235 3300049586 Bacteria 8338
312 Ga0501070_0039429 3300049586 Bacteria 3940
313 Ga0501070_0360609 3300049586 Bacteria 1179
314 Ga0501070_0911990 3300049586 Bacteria 685
315 Ga0501071_0190350 3300049587 Bacteria 1539
316 Ga0501073_0053845 3300049589 Bacteria 2817
317 Ga0501074_0063848 3300049590 Bacteria 2652
318 Ga0501079_0029830 3300049741 Bacteria 4189
319 Ga0501079_0145985 3300049741 Bacteria 1843
320 Ga0501080_0000044 3300049742 Bacteria 79921
321 Ga0501080_0002293 3300049742 Bacteria 16667
322 Ga0501080_0092020 3300049742 Bacteria 2817
323 Ga0501080_0961768 3300049742 Bacteria 742
324 Ga0501044_0018295 3300049823 Bacteria 7509
325 Ga0501045_0364584 3300049824 Bacteria 1075
326 nmdc:mga00v17_358881_c1 3300050491 Bacteria 947
327 nmdc:mga00v17_4765_c1 3300050491 Bacteria 7100
328 nmdc:mga07m45_51356_c1 3300050496 Bacteria 2325
329 nmdc:mga06r32_220146_c1 3300050510 Bacteria 1887
330 Ga0495601_0013076 3300053077 Bacteria 4989
331 Ga0495619_0271204 3300053085 Bacteria 1176
332 Ga0500643_000395 3300053087 Bacteria 33621
333 Ga0500641_0000475 3300053096 Bacteria 14614
334 Ga0500641_0127938 3300053096 Bacteria 1096
335 Ga0500573_0240843 3300053140 Bacteria 938
336 Ga0500604_0026006 3300053151 Bacteria 1685
337 Ga0500616_0004040 3300053153 Bacteria 10672
338 Ga0501084_0096759 3300054114 Bacteria 2479
339 Ga0587122_011686 3300059628 Bacteria 847
340 Ga0587067_050833 3300059640 Bacteria 838
341 Ga0587069_097719 3300059642 Bacteria 596
342 Ga0466962_0006136 3300061719 Bacteria 5776
343 Ga0466962_0049282 3300061719 Bacteria 2013
344 Ga0466962_0253086 3300061719 Bacteria 866
345 Ga0466962_0254138 3300061719 Bacteria 864
346 2508677419 2508501039 Bacteria 9978592
347 2515853580 2515154155 Bacteria 7985436
348 2517760439 2517572101 Bacteria 6884336
349 2528202911 2527291627 Bacteria 5309833
350 2528213412 2527291629 Bacteria 5267418
351 2546947851 2546825537 Bacteria 5389291
352 2579855742 2579778521 Bacteria 7624758
353 2585297559 2582581312 Bacteria 7308206
354 2616903402 2616644941 Bacteria 8510691
355 2619857518 2619618881 Bacteria 7521104
356 2620353419 2619619003 Bacteria 7619552
357 2643764134 2643221548 Bacteria 8053412
358 2643850874 2643221567 Bacteria 4163945
359 2644018063 2643221601 Bacteria 7493239
360 2644084642 2643221613 Bacteria 4622396
361 2644134614 2643221624 Bacteria 4384879
362 2644176650 2643221631 Bacteria 8168043
363 2644461433 2643221682 Bacteria 6743283
364 2644537960 2643221697 Bacteria 3575694
365 2644667254 2643221721 Bacteria 4486924
366 2645720224 2643221961 Bacteria 3919167
367 2645723161 2643221962 Bacteria 3874254
368 2676200133 2675902999 Bacteria 9438463
369 2676488976 2675903060 Bacteria 10051191
370 2686535387 2684623035 Bacteria 8032739
371 2689960297 2687453737 Bacteria 11203906
372 2738696598 2738541272 Bacteria 6848551
373 2739324328 2738543027 Bacteria 6409078
374 2739606743 2739367654 Bacteria 6049412
375 2760306436 2758568522 Bacteria 5953541
376 2760625098 2758568621 Bacteria 5967089
377 2768642840 2767802112 Bacteria 6465194
378 2774844711 2773857921 Bacteria 9435764
379 2774864604 2773857924 Bacteria 5256821
380 2804848044 2802429296 Bacteria 7227771
381 2809029965 2808606394 Bacteria 6248540
382 2816427422 2816332119 Bacteria 8120218
383 2819694502 2818991463 Bacteria 7948711
384 2819740546 2818991472 Bacteria 10089953
385 2835189060 2835188231 Bacteria 3476928
386 2837271490 2837268691 Bacteria 7850704
387 2862709064 2862705112 Bacteria 6563286
388 2867349051 2867346516 Bacteria 7608576
389 2868091994 2868088558 Bacteria 7609351
390 2873317218 2873314349 Bacteria 8512634
391 2884702583 2884693830 Bacteria 11273186
392 2884994639 2884994152 Bacteria 4492978
393 2893686694 2893684298 Bacteria 2897960
394 2895429358 2895427314 Bacteria 13147766
395 2895452083 2895442618 Bacteria 11027144
396 2895887070 2895880812 Bacteria 11255272
397 2935894346 2935890801 Bacteria 4593001
398 2966600742 2966598605 Bacteria 7676064
399 2984595198 2984592036 Bacteria 3670284
400 2990047573 2990044586 Bacteria 6603797
401 2995467028 2995463766 Bacteria 8577691
402 637880962 637000116 Bacteria 5433628
403 8002783657 8002775197 Bacteria 10728764
404 8002787644 8002784119 Bacteria 9788632
405 8008491169 8008485437 Bacteria 7198341
406 8025416264 8025413630 Bacteria 7014048
407 8025530498 8025524527 Bacteria 7197316
408 8033686036 8033684223 Bacteria 6906479
409 8055071710 8055066027 Bacteria 9479577
410 8055162958 8055157932 Bacteria 6429399
411 8055173068 8055172936 Bacteria 9305943
412 8056582680 8056579771 Bacteria 5840325
413 Ga0307415_100353233
414 JGI24740J21852_10020332
415 JGI24739J22299_10015356
416 JGI24739J22299_10019512
417 JGI24737J22298_10022388
418 JGI24735J21928_10034620
419 Ga0007423J48922_100219
420 JGI25405J52794_10070529
421 Ga0065714_10258358
422 Ga0070658_10935143
423 Ga0070682_100148698
424 Ga0070682_100156706
425 Ga0070661_100714698
426 Ga0070668_100136748
427 Ga0070668_100880255
428 Ga0070668_101053051
429 Ga0070671_100272856
430 Ga0070663_100743482
431 Ga0070678_100337155
432 Ga0070678_100836391
433 Ga0068867_100167994
434 Ga0070684_100255031
435 Ga0070686_100721464
436 Ga0070696_100041026
437 Ga0070693_100067251
438 Ga0070665_100566313
439 Ga0068857_100119332
440 Ga0070702_100105510
441 Ga0068852_100232228
442 Ga0068852_100664758
443 Ga0068859_100000103
444 Ga0068861_101109967
445 Ga0068851_10645046
446 Ga0068863_100004756
447 Ga0068858_100538440
448 Ga0068862_100000232
449 Ga0081455_10005839
450 Ga0081538_10248418
451 Ga0081540_1001174
452 Ga0075364_10005914
453 Ga0075364_10213208
454 Ga0075364_10373910
455 Ga0070716_101004250
456 Ga0075370_10126876
457 Ga0075428_100006874
458 Ga0075429_100034994
459 Ga0068865_100701111
460 Ga0097620_100000103
461 Ga0097620_100011001
462 Ga0105240_10725872
463 Ga0105245_10012832
464 Ga0105245_10334794
465 Ga0105247_10000014
466 Ga0105247_10826712
467 Ga0105243_10030404
468 Ga0105243_11083748
469 Ga0105248_10000038
470 Ga0105248_10001871
471 Ga0105249_10034941
472 Ga0105249_10279166
473 Ga0105249_10441791
474 Ga0105249_11408519
475 Ga0105239_10509382
476 Ga0105246_10184109
477 Ga0157371_10508902
478 Ga0157370_10076159
479 Ga0157370_10677921
480 Ga0157369_10605424
481 Ga0157369_11773138
482 Ga0157372_10084698
483 Ga0157372_10156843
484 Ga0157372_10175713
485 Ga0157375_10074256
486 Ga0163163_10007686
487 Ga0163163_10021193
488 Ga0163163_11675971
489 Ga0157380_10134324
490 Ga0157380_10389136
491 Ga0157379_10649798
492 Ga0163161_10117247
493 Ga0163161_10288982
494 Ga0163161_10500168
495 Ga0197907_11379459
496 Ga0197907_11415599
497 Ga0206356_11870264
498 Ga0206350_11506015
499 Ga0213876_10002143
500 Ga0224712_10232487
501 Ga0224712_10425545
502 Ga0207710_10000031
503 Ga0207647_10052808
504 Ga0207643_10101172
505 Ga0207705_10404084
506 Ga0207694_10518755
507 Ga0207669_10384359
508 Ga0207704_10589999
509 Ga0207691_10236573
510 Ga0207711_10000680
511 Ga0207711_10005918
512 Ga0207661_10454353
513 Ga0207712_10193967
514 Ga0207712_10575332
515 Ga0207712_10648103
516 Ga0207668_10097097
517 Ga0207668_10435195
518 Ga0207668_10850903
519 Ga0207640_10255506
520 Ga0207678_10105360
521 Ga0207678_10243829
522 Ga0207702_10246009
523 Ga0207641_10000587
524 Ga0207674_10338973
525 Ga0207674_10609072
526 Ga0207675_100809631
527 Ga0207683_10412894
528 Ga0207698_10168024
529 Ga0207698_10384327
530 Ga0207698_10519384
531 Ga0268265_10000161
532 Ga0268265_10197830
533 Ga0268264_10197700
534 Ga0307517_10148834
535 Ga0307517_10234216
536 Ga0307515_10353885
537 Ga0316176_1164944
538 Ga0316181_1013717
539 Ga0316181_1161165
540 Ga0316182_1257982
541 Ga0265332_10156205
542 Ga0265325_10005992
543 Ga0265325_10124558
544 Ga0265325_10142337
545 Ga0265340_10020008
546 Ga0265339_10111791
547 Ga0265316_10033289
548 Ga0265316_10407018
549 Ga0265313_10161216
550 Ga0265313_10248805
551 Ga0307508_10261565
552 Ga0265314_10076174
553 Ga0265342_10045452
554 Ga0265342_10199739
555 Ga0307413_10647770
556 Ga0307413_10863450
557 Ga0307410_10286044
558 Ga0307406_10729959
559 Ga0307412_11802077
560 Ga0307416_100604397
561 Ga0307507_10073067
562 Ga0395899_0209386
563 Ga0395901_0208625
564 Ga0395901_0590335
565 Ga0436365_0950230
566 Ga0436363_0727995
567 Ga0439466_0077201
568 Ga0439465_0054716
569 Ga0439465_0143837
570 Ga0451791_0685422
571 Ga0451793_0164075
572 Ga0451798_0608106
573 Ga0451800_0982963
574 Ga0451833_1318116
575 Ga0451837_0698950
576 Ga0451839_0131691
577 Ga0451841_1322198
578 Ga0451847_0771052
579 Ga0451843_1638129
580 Ga0451853_3518340
581 Ga0439431_0010861
582 Ga0439445_0002108
583 Ga0439434_0068402
584 Ga0466969_0001426
585 Ga0466969_0005549
586 Ga0466969_0025927
587 Ga0466965_0311721
588 Ga0466965_0431682
589 Ga0466965_0692029
590 Ga0466966_0020242
591 Ga0466966_0026557
592 Ga0466966_0203442
593 Ga0466961_0005178
594 Ga0466961_0040792
595 Ga0466961_0063208
596 Ga0466961_0192280
597 Ga0466963_0106815
598 Ga0466963_0207459
599 Ga0466963_0271609
600 Ga0466964_0130802
601 Ga0466964_0146962
602 Ga0466971_0001796
603 Ga0466971_0168358
604 Ga0466970_0240085
605 Ga0466970_0426734
606 Ga0466957_0094174
607 Ga0466957_0994590
608 Ga0466960_0006365
609 Ga0466960_0024185
610 Ga0466959_0011972
611 Ga0466958_0052040
612 Ga0466958_0082424
613 Ga0466958_0356133
614 Ga0466958_0385678
615 Ga0466967_0013404
616 Ga0466967_0025676
617 Ga0466967_0073646
618 Ga0466967_0134691
619 Ga0466967_1399378
620 Ga0466967_2080791
621 Ga0495627_010310
622 Ga0495603_0044961
623 Ga0495629_0138264
624 Ga0495651_0077142
625 Ga0495653_0017203
626 Ga0495653_0052830
627 Ga0495662_0006323
628 Ga0495662_0443044
629 Ga0495664_0018030
630 Ga0495584_0404731
631 Ga0495608_0000504
632 Ga0495628_0005234
633 Ga0495630_0500685
634 Ga0495631_0223165
635 Ga0495648_0020224
636 Ga0495666_0000748
637 Ga0495652_0081043
638 Ga0495665_0003667
639 Ga0495640_0032733
640 Ga0495586_0041500
641 Ga0495587_0135077
642 Ga0495645_0001246
643 Ga0495645_0109635
644 Ga0495645_0417261
645 Ga0495667_0024420
646 Ga0495667_0628029
647 Ga0495634_0009860
648 Ga0495635_0009890
649 Ga0495588_0054423
650 Ga0495657_0005346
651 Ga0495657_0183579
652 Ga0495599_0050090
653 Ga0495623_0003783
654 Ga0495646_0018406
655 Ga0495646_0341459
656 Ga0495613_0001655
657 Ga0495613_0003685
658 Ga0495600_0183580
659 Ga0495604_0000730
660 Ga0495604_0002789
661 Ga0495674_0135711
662 Ga0495675_0013731
663 Ga0495675_0028125
664 Ga0495675_0312170
665 Ga0495684_0066319
666 Ga0495602_0007615
667 Ga0495614_0000083
668 Ga0496101_0632006
669 Ga0496102_0575438
670 Ga0496102_0719686
671 Ga0496103_0440083
672 Ga0496104_0203294
673 Ga0496106_0119881
674 Ga0496108_0012156
675 Ga0496108_0192093
676 Ga0496109_0015892
677 Ga0496109_0252239
678 Ga0496110_0071806
679 Ga0496110_0392198
680 Ga0496112_0752391
681 Ga0496113_0082529
682 Ga0496114_0072175
683 Ga0496114_0580300
684 Ga0496115_0152620
685 Ga0496116_0000491
686 Ga0496117_0003331
687 Ga0496117_0009357
688 Ga0496117_0058479
689 Ga0496118_0004465
690 Ga0496118_0014039
691 Ga0496118_0034292
692 Ga0496119_0002786
693 Ga0496119_0006867
694 Ga0496119_0045172
695 Ga0496120_0003334
696 Ga0496120_0326574
697 Ga0496121_0011172
698 Ga0496122_0001413
699 Ga0496124_0066258
700 Ga0496124_0210536
701 Ga0496125_0000075
702 Ga0496125_0000977
703 Ga0501318_012499
704 Ga0501031_0007480
705 Ga0501032_0030375
706 Ga0501033_0018046
707 Ga0501034_0048420
708 Ga0501034_0421138
709 Ga0501034_0787746
710 Ga0501037_0236454
711 Ga0501038_0088765
712 Ga0501039_0007440
713 Ga0501042_0332920
714 Ga0501043_0144077
715 Ga0501047_0007593
716 Ga0501047_0101520
717 Ga0501047_0179650
718 Ga0501067_0259327
719 Ga0501069_0004690
720 Ga0501069_0125392
721 Ga0501070_0001926
722 Ga0501070_0004935
723 Ga0501070_0009235
724 Ga0501070_0039429
725 Ga0501070_0360609
726 Ga0501070_0911990
727 Ga0501071_0190350
728 Ga0501073_0053845
729 Ga0501074_0063848
730 Ga0501079_0029830
731 Ga0501079_0145985
732 Ga0501080_0000044
733 Ga0501080_0002293
734 Ga0501080_0092020
735 Ga0501080_0961768
736 Ga0501044_0018295
737 Ga0501045_0364584
738 nmdc:mga00v17_358881_c1
739 nmdc:mga00v17_4765_c1
740 nmdc:mga07m45_51356_c1
741 nmdc:mga06r32_220146_c1
742 Ga0495601_0013076
743 Ga0495619_0271204
744 Ga0500643_000395
745 Ga0500641_0000475
746 Ga0500641_0127938
747 Ga0500573_0240843
748 Ga0500604_0026006
749 Ga0500616_0004040
750 Ga0501084_0096759
751 Ga0587122_011686
752 Ga0587067_050833
753 Ga0587069_097719
754 Ga0466962_0006136
755 Ga0466962_0049282
756 Ga0466962_0253086
757 Ga0466962_0254138
758 2508677419
759 2515853580
760 2517760439
761 2528202911
762 2528213412
763 2546947851
764 2579855742
765 2585297559
766 2616903402
767 2619857518
768 2620353419
769 2643764134
770 2643850874
771 2644018063
772 2644084642
773 2644134614
774 2644176650
775 2644461433
776 2644537960
777 2644667254
778 2645720224
779 2645723161
780 2676200133
781 2676488976
782 2686535387
783 2689960297
784 2738696598
785 2739324328
786 2739606743
787 2760306436
788 2760625098
789 2768642840
790 2774844711
791 2774864604
792 2804848044
793 2809029965
794 2816427422
795 2819694502
796 2819740546
797 2835189060
798 2837271490
799 2862709064
800 2867349051
801 2868091994
802 2873317218
803 2884702583
804 2884994639
805 2893686694
806 2895429358
807 2895452083
808 2895887070
809 2935894346
810 2966600742
811 2984595198
812 2990047573
813 2995467028
814 637880962
815 8002783657
816 8002787644
817 8008491169
818 8025416264
819 8025530498
820 8033686036
821 8055071710
822 8055162958
823 8055173068
824 8056582680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10369

ALS_ss_C

Small subunit of acetolactate synthase

85

158

0.99

PF01842

ACT

ACT domain

4

70

0.98

PF22629

AHAS-like_ACT

AHAS-like ACT domain

6

73

0.98

PF13710

ACT_5

ACT domain

12

74

0.97

PF13291

ACT_4

ACT domain

3

75

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fgc-assembly1.cif.gz_A-2 crystal structure of acetolactate synthase- small subunit from thermotoga maritima 0.876 1 157
6u9h-assembly1.cif.gz_G arabidopsis thaliana acetohydroxyacid synthase complex 0.874 3 157
6vz8-assembly1.cif.gz_S arabidopsis thaliana acetohydroxyacid synthase complex with valine bound 0.853 1 157
2fgc-assembly1.cif.gz_A-2 crystal structure of acetolactate synthase- small subunit from thermotoga maritima 0.8509 1 157
6u9d-assembly1.cif.gz_P saccharomyces cerevisiae acetohydroxyacid synthase 0.8495 3 157
ID Description Score Start End Superfamily
af_Q93YZ7_400_477_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9709 85 157 3.30.70.1150
2fgcA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9453 85 153 3.30.70.1150
af_Q57625_89_166_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9353 85 160 3.30.70.1150
2fgdA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9343 82 157 3.30.70.1150
af_P9WKJ3_86_164_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.9311 85 162 3.30.70.1150
ID Description Score Start End GO Terms
AF-A0A833U737-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9895 83 151 GO:0003984
GO:0009097
GO:0009099
GO:1990610
AF-A0A388P049-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9823 77 152 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610
AF-A0A8A5Z5S2-F1-model_v4 deleted 0.9682 82 157
AF-A0A0A0LXQ8-F1-model_v4 Acetolactate synthase small subunit (AHAS) (ALS) (EC 2.2.1.6) (Acetohydroxy-acid synthase small subunit) 0.9613 81 159 GO:0003984
GO:0009097
GO:0009099
GO:1990610
AF-A0A2H0M709-F1-model_v4 Acetolactate synthase small subunit C-terminal domain-containing protein 0.9479 83 157 GO:0003984
GO:0005829
GO:0009097
GO:0009099
GO:1990610

Map