F437786

General Info

Members Datasets Scaffolds Average Seq Length
412 255 398 217

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10485062|Ga0111539_104850622
Length 255
Sequence MAAVKGILGRKLGMTQVWDSDNRVIPVTVIQAGPCRVVQLKTPERDGYSAVQIAFGAAKEQRLTKPELGHLKKNGAAPSKHLAELRVDDLSPYAVGQVIGADVFVAGERVDVTGISKGKGFTGVMQRHNFKGQGASHGNHKKHRSPGSIGACATPARVFKGMKMAGQHGNERVTTLNLEVVEGDAERGLLLVRGAVPGPNGAIVFVRNAAKGPAVAPPELGNGNGAKKDAKADASGGTPPSSEGPEAAEEVTSEA

Samples

Sample ID Description Type Environment
1 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
2 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
3 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
4 2643221711 Terrabacter sp. Root85 Isolate Unclassified
5 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
6 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
7 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
8 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
9 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
10 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
11 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
12 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
13 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
14 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
15 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
76 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.32
Metatranscriptomes 7.28
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.55
Nodule 0
Rhizoplane 8.74
Rhizosphere 80.34
Stem 0
Stem Tuber 0
Unclassified 4.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1005137 3300001915 Bacteria 2784
2 JGI24740J21852_10001487 3300001979 Bacteria 10770
3 JGI24740J21852_10016445 3300001979 Bacteria 2675
4 JGI25156J39149_1011939 3300002705 Bacteria 1940
5 Ga0055539_1004905 3300003752 Bacteria 1762
6 Ga0055533_1004361 3300003756 Bacteria 2561
7 Ga0055532_1000066 3300003758 Bacteria 139987
8 Ga0055527_1001137 3300003760 Bacteria 6091
9 Ga0055535_1000046 3300003761 Bacteria 139987
10 Ga0055529_1000087 3300003763 Bacteria 139975
11 Ga0055541_1003652 3300003841 Bacteria 2868
12 Ga0070658_10001764 3300005327 Bacteria 18213
13 Ga0070680_100004398 3300005336 Bacteria 10606
14 Ga0070680_100694425 3300005336 Bacteria 875
15 Ga0070682_100197643 3300005337 Bacteria 1416
16 Ga0070682_100488376 3300005337 Bacteria 951
17 Ga0070682_100627145 3300005337 Bacteria 853
18 Ga0070660_100247889 3300005339 Bacteria 1452
19 Ga0070661_100000276 3300005344 Bacteria 41562
20 Ga0070675_100255681 3300005354 Bacteria 1534
21 Ga0070674_100413564 3300005356 Bacteria 1105
22 Ga0070659_100029079 3300005366 Bacteria 4270
23 Ga0070713_100032992 3300005436 Bacteria 4143
24 Ga0070708_100101114 3300005445 Bacteria 2640
25 Ga0070663_100001053 3300005455 Bacteria 15091
26 Ga0070681_10004293 3300005458 Bacteria 13527
27 Ga0070681_10107238 3300005458 Bacteria 2734
28 Ga0070681_10119645 3300005458 Bacteria 2569
29 Ga0070681_10674579 3300005458 Bacteria 949
30 Ga0070679_100006878 3300005530 Bacteria 10606
31 Ga0070679_100191489 3300005530 Bacteria 2014
32 Ga0070679_100331328 3300005530 Bacteria 1471
33 Ga0070679_100336621 3300005530 Bacteria 1457
34 Ga0070696_100171088 3300005546 Bacteria 1606
35 Ga0070664_100000018 3300005564 Bacteria 125281
36 Ga0068854_100000225 3300005578 Bacteria 38422
37 Ga0068856_100000070 3300005614 Bacteria 95320
38 Ga0068852_100281704 3300005616 Bacteria 1603
39 Ga0068860_100922757 3300005843 Bacteria 890
40 Ga0081540_1006273 3300005983 Bacteria 8701
41 Ga0075363_100063734 3300006048 Bacteria 1990
42 Ga0075364_10167862 3300006051 Bacteria 1483
43 Ga0070712_100033777 3300006175 Bacteria 3463
44 Ga0075428_100069898 3300006844 Bacteria 3838
45 Ga0075428_100293702 3300006844 Bacteria 1748
46 Ga0075430_100096393 3300006846 Bacteria 2472
47 Ga0075430_100263670 3300006846 Bacteria 1427
48 Ga0075431_100041531 3300006847 Bacteria 4742
49 Ga0075434_100105102 3300006871 Bacteria 2834
50 Ga0068865_100252048 3300006881 Bacteria 1394
51 Ga0075435_100161885 3300007076 Bacteria 1885
52 Ga0075435_100308212 3300007076 Bacteria 1355
53 Ga0105240_10419005 3300009093 Bacteria 1505
54 Ga0111539_10189124 3300009094 Bacteria 2403
55 Ga0111539_10485062 3300009094 Bacteria 1440
56 Ga0105245_10028450 3300009098 Bacteria 4931
57 Ga0105245_10517115 3300009098 Bacteria 1212
58 Ga0105245_10519984 3300009098 Bacteria 1208
59 Ga0105245_10566780 3300009098 Bacteria 1159
60 Ga0105245_10779930 3300009098 Bacteria 993
61 Ga0105245_11364366 3300009098 Bacteria 759
62 Ga0105243_10528853 3300009148 Bacteria 1123
63 Ga0105242_10159874 3300009176 Bacteria 1971
64 Ga0105248_10378170 3300009177 Bacteria 1594
65 Ga0105237_10627906 3300009545 Bacteria 1081
66 Ga0105238_10587420 3300009551 Bacteria 1121
67 Ga0105238_11257590 3300009551 Bacteria 765
68 Ga0105239_10262307 3300010375 Bacteria 1942
69 Ga0105246_10244420 3300011119 Bacteria 1421
70 Ga0157371_10556527 3300013102 Bacteria 850
71 Ga0157369_10050197 3300013105 Bacteria 4520
72 Ga0157369_10064955 3300013105 Bacteria 3930
73 Ga0157369_10075764 3300013105 Bacteria 3606
74 Ga0157369_10256672 3300013105 Bacteria 1823
75 Ga0157369_10718559 3300013105 Bacteria 1028
76 Ga0157374_10847369 3300013296 Bacteria 931
77 Ga0157378_10648259 3300013297 Bacteria 1071
78 Ga0157372_10561561 3300013307 Bacteria 1330
79 Ga0157375_10145381 3300013308 Bacteria 2502
80 Ga0157375_10345017 3300013308 Bacteria 1654
81 Ga0157375_10724552 3300013308 Bacteria 1147
82 Ga0157375_10794758 3300013308 Bacteria 1095
83 Ga0157377_10255711 3300014745 Bacteria 1137
84 Ga0163161_10771344 3300017792 Bacteria 806
85 Ga0197907_10132969 3300020069 Bacteria 1699
86 Ga0197907_10620284 3300020069 Bacteria 13642
87 Ga0197907_10975053 3300020069 Bacteria 1967
88 Ga0197907_11504167 3300020069 Bacteria 4009
89 Ga0206356_10882538 3300020070 Bacteria 952
90 Ga0206356_11473966 3300020070 Bacteria 2324
91 Ga0206356_11653616 3300020070 Bacteria 1227
92 Ga0206356_11734114 3300020070 Bacteria 2265
93 Ga0206349_1036328 3300020075 Bacteria 16217
94 Ga0206355_1151807 3300020076 Bacteria 1993
95 Ga0206355_1407414 3300020076 Bacteria 6114
96 Ga0206355_1655497 3300020076 Bacteria 1601
97 Ga0206351_10362168 3300020077 Bacteria 1371
98 Ga0206350_10175503 3300020080 Bacteria 1068
99 Ga0206350_10389078 3300020080 Bacteria 739
100 Ga0206354_10122129 3300020081 Bacteria 1042
101 Ga0206354_11044897 3300020081 Bacteria 2821
102 Ga0224712_10000310 3300022467 Bacteria 9101
103 Ga0224712_10058223 3300022467 Bacteria 1530
104 Ga0224712_10090225 3300022467 Bacteria 1282
105 Ga0209784_100052 3300025224 Bacteria 182783
106 Ga0209566_101697 3300025225 Bacteria 5423
107 Ga0209674_100087 3300025226 Bacteria 182783
108 Ga0209672_100276 3300025228 Bacteria 37317
109 Ga0209672_100383 3300025228 Bacteria 26965
110 Ga0209147_100090 3300025229 Bacteria 176176
111 Ga0209563_100470 3300025230 Bacteria 13814
112 Ga0209258_100130 3300025242 Bacteria 176078
113 Ga0209677_100043 3300025253 Bacteria 222331
114 Ga0209759_1006739 3300025256 Bacteria 3809
115 Ga0209455_1000119 3300025272 Bacteria 174994
116 Ga0207688_10200980 3300025901 Bacteria 1195
117 Ga0207647_10052601 3300025904 Bacteria 2513
118 Ga0207699_10363790 3300025906 Bacteria 1023
119 Ga0207643_10088117 3300025908 Bacteria 1806
120 Ga0207705_10000671 3300025909 Bacteria 28465
121 Ga0207705_10001318 3300025909 Bacteria 19884
122 Ga0207707_10006511 3300025912 Bacteria 10199
123 Ga0207707_10084979 3300025912 Bacteria 2764
124 Ga0207707_10810270 3300025912 Bacteria 780
125 Ga0207695_10002409 3300025913 Bacteria 27691
126 Ga0207693_10067873 3300025915 Bacteria 2792
127 Ga0207660_10000562 3300025917 Bacteria 24961
128 Ga0207657_10232848 3300025919 Bacteria 1473
129 Ga0207657_10288104 3300025919 Bacteria 1303
130 Ga0207657_10549733 3300025919 Bacteria 903
131 Ga0207649_10000490 3300025920 Bacteria 28067
132 Ga0207652_10000632 3300025921 Bacteria 34827
133 Ga0207652_10084500 3300025921 Bacteria 2781
134 Ga0207652_10227046 3300025921 Bacteria 1683
135 Ga0207652_10429738 3300025921 Bacteria 1191
136 Ga0207659_10363462 3300025926 Bacteria 1203
137 Ga0207687_10106156 3300025927 Bacteria 2076
138 Ga0207670_10056299 3300025936 Bacteria 2661
139 Ga0207704_10588108 3300025938 Bacteria 910
140 Ga0207661_10397245 3300025944 Bacteria 1250
141 Ga0207661_10550837 3300025944 Bacteria 1057
142 Ga0207679_10000032 3300025945 Bacteria 158845
143 Ga0207679_10465998 3300025945 Bacteria 1122
144 Ga0207712_10408887 3300025961 Bacteria 1142
145 Ga0207668_10356878 3300025972 Bacteria 1224
146 Ga0207640_10001991 3300025981 Bacteria 11019
147 Ga0207678_10000024 3300026067 Bacteria 125239
148 Ga0207678_10607024 3300026067 Bacteria 959
149 Ga0207678_10619747 3300026067 Bacteria 949
150 Ga0207708_10060766 3300026075 Bacteria 2885
151 Ga0207708_10375097 3300026075 Bacteria 1172
152 Ga0207702_10000973 3300026078 Bacteria 29351
153 Ga0207674_10003250 3300026116 Bacteria 20001
154 Ga0207683_10308528 3300026121 Bacteria 1448
155 Ga0207698_10023034 3300026142 Bacteria 4344
156 Ga0265334_10034741 3300028573 Bacteria 2000
157 Ga0265338_10000149 3300028800 Bacteria 127027
158 Ga0265328_10027208 3300031239 Bacteria 2144
159 Ga0265325_10002115 3300031241 Bacteria 13565
160 Ga0265339_10013505 3300031249 Bacteria 4946
161 Ga0265331_10272329 3300031250 Bacteria 759
162 Ga0265327_10043188 3300031251 Bacteria 2415
163 Ga0265327_10110389 3300031251 Bacteria 1315
164 Ga0265316_10024763 3300031344 Bacteria 5018
165 Ga0265313_10006027 3300031595 Bacteria 8747
166 Ga0265314_10147988 3300031711 Bacteria 1444
167 Ga0316578_10019688 3300031728 Bacteria 3720
168 Ga0307410_10437952 3300031852 Bacteria 1064
169 Ga0307406_10819556 3300031901 Bacteria 787
170 Ga0307416_101090287 3300032002 Bacteria 903
171 Ga0307415_100557924 3300032126 Bacteria 1012
172 Ga0316596_1082865 3300033541 Bacteria 862
173 Ga0316574_0004933 3300035398 Bacteria 7067
174 Ga0373931_0028029 3300035691 Bacteria 2880
175 Ga0373927_0379826 3300035695 Bacteria 932
176 Ga0373927_0426225 3300035695 Bacteria 876
177 Ga0373933_0587425 3300035724 Bacteria 731
178 Ga0436365_0440237 3300039437 Bacteria 4106
179 Ga0436365_0787645 3300039437 Bacteria 1406
180 Ga0436365_1510258 3300039437 Bacteria 2194
181 Ga0436360_0452772 3300039438 Bacteria 2288
182 Ga0436360_0639768 3300039438 Bacteria 2249
183 Ga0436363_1130555 3300039450 Bacteria 1530
184 Ga0436363_1366990 3300039450 Bacteria 725
185 Ga0436362_1068984 3300039453 Bacteria 2365
186 Ga0436362_1070743 3300039453 Bacteria 1881
187 Ga0439436_0054059 3300041404 Bacteria 1130
188 Ga0451791_0098276 3300041451 Bacteria 1093
189 Ga0451853_2424835 3300041512 Bacteria 809
190 Ga0450908_032994 3300042184 Bacteria 898
191 Ga0439434_0024723 3300042435 Bacteria 1813
192 Ga0439434_0045462 3300042435 Bacteria 1354
193 Ga0466965_0043734 3300044683 Bacteria 2212
194 Ga0466961_0038025 3300044693 Bacteria 3087
195 Ga0466961_0050135 3300044693 Bacteria 2666
196 Ga0466961_0101521 3300044693 Bacteria 1812
197 Ga0466961_0135108 3300044693 Bacteria 1545
198 Ga0466961_0194188 3300044693 Bacteria 1257
199 Ga0466961_0194570 3300044693 Bacteria 1256
200 Ga0466963_0134331 3300044694 Bacteria 1711
201 Ga0466963_0278772 3300044694 Bacteria 1175
202 Ga0466963_0318423 3300044694 Bacteria 1094
203 Ga0453684_0677221 3300044712 Bacteria 1123
204 Ga0466971_0007279 3300044719 Bacteria 4818
205 Ga0466971_0093838 3300044719 Bacteria 1375
206 Ga0466970_0153967 3300044765 Bacteria 1270
207 Ga0466970_0193942 3300044765 Bacteria 1129
208 Ga0466957_0156308 3300044842 Bacteria 1478
209 Ga0466957_0703207 3300044842 Bacteria 713
210 Ga0466959_0149875 3300045049 Bacteria 1644
211 Ga0466959_0174741 3300045049 Bacteria 1505
212 Ga0466958_0004358 3300045836 Bacteria 7466
213 Ga0466958_0007393 3300045836 Bacteria 6040
214 Ga0466958_0029204 3300045836 Bacteria 3271
215 Ga0466967_0058701 3300045976 Bacteria 3402
216 Ga0466967_0115719 3300045976 Bacteria 2470
217 Ga0466967_0121021 3300045976 Bacteria 2418
218 Ga0466967_0164855 3300045976 Bacteria 2082
219 Ga0466967_0268408 3300045976 Bacteria 1634
220 Ga0495592_0300262 3300046454 Bacteria 1044
221 Ga0495641_0088030 3300046461 Bacteria 1389
222 Ga0495651_0232137 3300046462 Bacteria 1270
223 Ga0495653_0257561 3300046463 Bacteria 1155
224 Ga0495653_0336194 3300046463 Bacteria 975
225 Ga0495582_0268632 3300046473 Bacteria 979
226 Ga0495639_0094748 3300046475 Bacteria 1404
227 Ga0495664_0251341 3300046477 Bacteria 1069
228 Ga0495584_0160857 3300046491 Bacteria 1141
229 Ga0495596_0166116 3300046500 Bacteria 858
230 Ga0495608_0223113 3300046511 Bacteria 1182
231 Ga0495608_0312841 3300046511 Bacteria 971
232 Ga0495618_0137183 3300046514 Bacteria 1565
233 Ga0495618_0145422 3300046514 Bacteria 1516
234 Ga0495628_0017197 3300046516 Bacteria 6023
235 Ga0495628_0054403 3300046516 Bacteria 3156
236 Ga0495630_0009898 3300046517 Bacteria 6866
237 Ga0495630_0029240 3300046517 Bacteria 4096
238 Ga0495630_0044139 3300046517 Bacteria 3331
239 Ga0495637_0092799 3300046520 Bacteria 1189
240 Ga0495663_0077070 3300046525 Bacteria 1069
241 Ga0495666_0126831 3300046526 Bacteria 1193
242 Ga0495586_0243547 3300046535 Bacteria 1025
243 Ga0495645_0063332 3300046543 Bacteria 2678
244 Ga0495622_0060856 3300046557 Bacteria 1749
245 Ga0495622_0274015 3300046557 Bacteria 739
246 Ga0495656_0172150 3300046615 Bacteria 1059
247 Ga0495634_0446466 3300046642 Bacteria 764
248 Ga0495659_0246245 3300046664 Bacteria 744
249 Ga0495657_0035993 3300046675 Bacteria 3426
250 Ga0495658_0034888 3300046683 Bacteria 2763
251 Ga0495658_0038331 3300046683 Bacteria 2654
252 Ga0495658_0256466 3300046683 Bacteria 1101
253 Ga0495613_0152906 3300046689 Bacteria 1645
254 Ga0495613_0197646 3300046689 Bacteria 1419
255 Ga0495613_0543863 3300046689 Bacteria 778
256 Ga0495670_0198007 3300046691 Bacteria 1063
257 Ga0495649_0055563 3300046694 Bacteria 2139
258 Ga0495660_0222967 3300046810 Bacteria 888
259 Ga0495674_0280873 3300047319 Bacteria 1364
260 Ga0495674_0399085 3300047319 Bacteria 1110
261 Ga0495676_0056624 3300047321 Bacteria 3099
262 Ga0495676_0321873 3300047321 Bacteria 1039
263 Ga0495680_0110279 3300047322 Bacteria 2040
264 Ga0495680_0393217 3300047322 Bacteria 958
265 Ga0495675_0139934 3300047444 Bacteria 1501
266 Ga0495684_0054899 3300047471 Bacteria 3038
267 Ga0495684_0075284 3300047471 Bacteria 2565
268 Ga0495684_0381445 3300047471 Bacteria 994
269 Ga0496100_0158131 3300048903 Bacteria 1622
270 Ga0496101_0020929 3300048904 Bacteria 4488
271 Ga0496102_0085644 3300048905 Bacteria 2910
272 Ga0496102_0220931 3300048905 Bacteria 1786
273 Ga0496102_0282772 3300048905 Bacteria 1564
274 Ga0496102_0440886 3300048905 Bacteria 1222
275 Ga0496103_0129997 3300048906 Bacteria 1608
276 Ga0496104_0014571 3300048907 Bacteria 7103
277 Ga0496104_0133735 3300048907 Bacteria 2382
278 Ga0496104_0136556 3300048907 Bacteria 2356
279 Ga0496105_0119895 3300048908 Bacteria 2169
280 Ga0496105_0275467 3300048908 Bacteria 1358
281 Ga0496105_0476743 3300048908 Bacteria 982
282 Ga0496107_0404980 3300048910 Bacteria 1014
283 Ga0496108_0029977 3300048911 Bacteria 4509
284 Ga0496108_0312436 3300048911 Bacteria 1369
285 Ga0496109_0023891 3300048912 Bacteria 5428
286 Ga0496109_0121866 3300048912 Bacteria 2430
287 Ga0496109_0137123 3300048912 Bacteria 2287
288 Ga0496109_0233500 3300048912 Bacteria 1731
289 Ga0496109_0243504 3300048912 Bacteria 1693
290 Ga0496109_0840664 3300048912 Bacteria 856
291 Ga0496110_0065999 3300048913 Bacteria 3200
292 Ga0496110_0140076 3300048913 Bacteria 2187
293 Ga0496110_0236454 3300048913 Bacteria 1662
294 Ga0496111_0243225 3300048914 Bacteria 1336
295 Ga0496112_0007477 3300048915 Bacteria 9696
296 Ga0496112_0037283 3300048915 Bacteria 4746
297 Ga0496112_0088274 3300048915 Bacteria 3069
298 Ga0496112_0344195 3300048915 Bacteria 1434
299 Ga0496112_0764873 3300048915 Bacteria 892
300 Ga0496113_0069795 3300048916 Bacteria 2669
301 Ga0496113_0413837 3300048916 Bacteria 1083
302 Ga0496114_0129628 3300048917 Bacteria 2177
303 Ga0496114_0466097 3300048917 Bacteria 1118
304 Ga0496119_0256315 3300048922 Bacteria 880
305 Ga0496126_0374572 3300048929 Bacteria 1160
306 Ga0501306_022643 3300049127 Bacteria 887
307 Ga0501306_025390 3300049127 Bacteria 852
308 Ga0501308_003283 3300049128 Bacteria 1489
309 Ga0501310_009023 3300049130 Bacteria 1092
310 Ga0501311_034767 3300049527 Bacteria 743
311 Ga0501315_003915 3300049531 Bacteria 1521
312 Ga0501315_018619 3300049531 Bacteria 917
313 Ga0501031_0050492 3300049568 Bacteria 2710
314 Ga0501034_0022224 3300049571 Bacteria 6464
315 Ga0501034_0336537 3300049571 Bacteria 1440
316 Ga0501034_0376154 3300049571 Bacteria 1346
317 Ga0501036_0265810 3300049572 Bacteria 1437
318 Ga0501037_0143264 3300049573 Bacteria 1710
319 Ga0501037_0283468 3300049573 Bacteria 1154
320 Ga0501038_0229283 3300049574 Bacteria 1479
321 Ga0501038_0515590 3300049574 Bacteria 913
322 Ga0501039_0040158 3300049575 Bacteria 3613
323 Ga0501040_0353608 3300049576 Bacteria 1053
324 Ga0501041_0007814 3300049577 Bacteria 6285
325 Ga0501041_0123591 3300049577 Bacteria 1610
326 Ga0501043_0544869 3300049579 Bacteria 862
327 Ga0501046_0038334 3300049580 Bacteria 3847
328 Ga0501047_0000014 3300049581 Bacteria 321541
329 Ga0501047_0019391 3300049581 Bacteria 6524
330 Ga0501048_0071990 3300049582 Bacteria 2440
331 Ga0501048_0211853 3300049582 Bacteria 1374
332 Ga0501068_0163026 3300049584 Bacteria 1405
333 Ga0501069_0005427 3300049585 Bacteria 6629
334 Ga0501070_0006873 3300049586 Bacteria 9678
335 Ga0501070_0014536 3300049586 Bacteria 6623
336 Ga0501070_0023755 3300049586 Bacteria 5137
337 Ga0501070_0039598 3300049586 Bacteria 3931
338 Ga0501070_0242394 3300049586 Bacteria 1475
339 Ga0501071_0034095 3300049587 Bacteria 3621
340 Ga0501071_0468398 3300049587 Bacteria 965
341 Ga0501073_0104290 3300049589 Bacteria 1968
342 Ga0501073_0253471 3300049589 Bacteria 1215
343 Ga0501074_0002630 3300049590 Bacteria 12572
344 Ga0501074_0280687 3300049590 Bacteria 1184
345 Ga0501075_0543315 3300049591 Bacteria 887
346 Ga0501076_0008941 3300049592 Bacteria 7371
347 Ga0501077_0049257 3300049593 Bacteria 2678
348 Ga0501079_0000248 3300049741 Bacteria 32709
349 Ga0501079_0065095 3300049741 Bacteria 2812
350 Ga0501079_0548616 3300049741 Bacteria 909
351 Ga0501080_0012740 3300049742 Bacteria 7713
352 Ga0501080_0021002 3300049742 Bacteria 6042
353 Ga0501080_0024833 3300049742 Bacteria 5558
354 Ga0501080_0097290 3300049742 Bacteria 2733
355 Ga0501080_0101931 3300049742 Bacteria 2663
356 Ga0501080_0161376 3300049742 Bacteria 2070
357 Ga0501080_0223973 3300049742 Bacteria 1720
358 Ga0501083_0058980 3300049744 Bacteria 2568
359 Ga0501044_0008850 3300049823 Bacteria 11009
360 Ga0501044_0045484 3300049823 Bacteria 4547
361 Ga0501044_0612131 3300049823 Bacteria 981
362 Ga0501045_0005535 3300049824 Bacteria 8737
363 Ga0501045_0117323 3300049824 Bacteria 1976
364 Ga0501045_0222954 3300049824 Bacteria 1404
365 nmdc:mga03n38_209483_c1 3300050490 Bacteria 1012
366 nmdc:mga03n38_25382_c1 3300050490 Bacteria 2433
367 nmdc:mga00v17_182687_c1 3300050491 Bacteria 1353
368 nmdc:mga0qj67_123151_c1 3300050509 Bacteria 2098
369 nmdc:mga0qj67_66003_c1 3300050509 Bacteria 2882
370 nmdc:mga0qj67_94539_c1 3300050509 Bacteria 2404
371 nmdc:mga06r32_224423_c1 3300050510 Bacteria 1867
372 nmdc:mga06r32_865576_c1 3300050510 Bacteria 862
373 nmdc:mga0n895_410302_c1 3300050512 Bacteria 1370
374 nmdc:mga0rr50_476459_c1 3300050513 Bacteria 1060
375 Ga0495601_0215055 3300053077 Bacteria 1255
376 Ga0495612_0027288 3300053078 Bacteria 2296
377 Ga0495595_0221002 3300053084 Bacteria 945
378 Ga0495619_0067954 3300053085 Bacteria 2380
379 Ga0495619_0195464 3300053085 Bacteria 1400
380 Ga0495619_0315156 3300053085 Bacteria 1083
381 Ga0500607_007545 3300053121 Bacteria 6708
382 Ga0500559_0044340 3300053136 Bacteria 1945
383 Ga0500616_0000147 3300053153 Bacteria 119392
384 Ga0500616_0000816 3300053153 Bacteria 35390
385 Ga0500636_0000697 3300053177 Bacteria 18023
386 Ga0501084_0000009 3300054114 Bacteria 194961
387 Ga0501084_0030367 3300054114 Bacteria 4520
388 Ga0501084_0194817 3300054114 Bacteria 1710
389 Ga0501084_0480867 3300054114 Bacteria 1050
390 Ga0501084_0713432 3300054114 Bacteria 846
391 Ga0587122_006568 3300059628 Bacteria 1008
392 Ga0587075_008367 3300059644 Bacteria 1321
393 Ga0501082_0355679 3300060353 Bacteria 1277
394 Ga0501082_0697288 3300060353 Bacteria 889
395 Ga0466962_0029879 3300061719 Bacteria 2609
396 Ga0530510_0012514 3300061734 Bacteria 5960
397 Ga0530510_0028059 3300061734 Bacteria 4036
398 Ga0530510_0202597 3300061734 Bacteria 1474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049527 Ga0501311_034767 Ga0501311_034767_116_727 168
2 3300044842 Ga0466957_0703207 Ga0466957_0703207_10_594 181
3 3300049127 Ga0501306_022643 Ga0501306_022643_14_685 188
4 3300044693 Ga0466961_0194188 Ga0466961_0194188_210_884 189
5 3300049128 Ga0501308_003283 Ga0501308_003283_337_1032 192
6 3300049531 Ga0501315_003915 Ga0501315_003915_423_1118 192
7 3300039438 Ga0436360_0639768 Ga0436360_0639768_387_1064 195
8 3300039453 Ga0436362_1070743 Ga0436362_1070743_1018_1695 195
9 3300046477 Ga0495664_0251341 Ga0495664_0251341_19_717 195
10 3300053121 Ga0500607_007545 Ga0500607_007545_806_1480 195
11 3300053136 Ga0500559_0044340 Ga0500559_0044340_1029_1703 195
12 3300053177 Ga0500636_0000697 Ga0500636_0000697_15764_16438 195
13 3300009545 Ga0105237_10627906 Ga0105237_106279062 197
14 3300013105 Ga0157369_10050197 Ga0157369_100501976 197
15 3300013105 Ga0157369_10064955 Ga0157369_100649552 197
16 3300013105 Ga0157369_10075764 Ga0157369_100757644 197
17 3300013105 Ga0157369_10256672 Ga0157369_102566722 197
18 3300013296 Ga0157374_10847369 Ga0157374_108473692 197
19 3300020069 Ga0197907_10620284 Ga0197907_106202843 197
20 3300020075 Ga0206349_1036328 Ga0206349_10363284 197
21 3300020076 Ga0206355_1407414 Ga0206355_14074142 197
22 3300020076 Ga0206355_1655497 Ga0206355_16554972 197
23 3300020077 Ga0206351_10362168 Ga0206351_103621683 197
24 3300020081 Ga0206354_10122129 Ga0206354_101221291 197
25 3300020081 Ga0206354_11044897 Ga0206354_110448973 197
26 3300022467 Ga0224712_10000310 Ga0224712_100003103 197
27 3300025909 Ga0207705_10001318 Ga0207705_1000131828 197
28 3300044693 Ga0466961_0050135 Ga0466961_0050135_878_1552 197
29 3300045049 Ga0466959_0174741 Ga0466959_0174741_618_1292 197
30 3300045836 Ga0466958_0007393 Ga0466958_0007393_189_863 197
31 3300005327 Ga0070658_10001764 Ga0070658_100017648 198
32 3300005336 Ga0070680_100004398 Ga0070680_10000439821 198
33 3300005336 Ga0070680_100694425 Ga0070680_1006944251 198
34 3300005337 Ga0070682_100627145 Ga0070682_1006271451 198
35 3300005458 Ga0070681_10004293 Ga0070681_1000429321 198
36 3300005458 Ga0070681_10107238 Ga0070681_101072384 198
37 3300005530 Ga0070679_100006878 Ga0070679_10000687821 198
38 3300005530 Ga0070679_100336621 Ga0070679_1003366212 198
39 3300006844 Ga0075428_100293702 Ga0075428_1002937022 198
40 3300007076 Ga0075435_100161885 Ga0075435_1001618854 198
41 3300009098 Ga0105245_10779930 Ga0105245_107799301 198
42 3300013105 Ga0157369_10718559 Ga0157369_107185592 198
43 3300020069 Ga0197907_10132969 Ga0197907_101329692 198
44 3300020070 Ga0206356_11653616 Ga0206356_116536162 198
45 3300025909 Ga0207705_10000671 Ga0207705_1000067135 198
46 3300025912 Ga0207707_10006511 Ga0207707_1000651110 198
47 3300025912 Ga0207707_10084979 Ga0207707_100849794 198
48 3300025917 Ga0207660_10000562 Ga0207660_1000056236 198
49 3300025921 Ga0207652_10000632 Ga0207652_100006328 198
50 3300025921 Ga0207652_10084500 Ga0207652_100845002 198
51 3300005337 Ga0070682_100488376 Ga0070682_1004883762 200
52 3300020070 Ga0206356_11473966 Ga0206356_114739661 200
53 3300025972 Ga0207668_10356878 Ga0207668_103568782 200
54 3300049571 Ga0501034_0336537 Ga0501034_0336537_444_1112 200
55 3300049586 Ga0501070_0242394 Ga0501070_0242394_507_1175 200
56 3300049589 Ga0501073_0104290 Ga0501073_0104290_512_1180 200
57 3300049590 Ga0501074_0002630 Ga0501074_0002630_4998_5666 200
58 3300049741 Ga0501079_0000248 Ga0501079_0000248_30640_31308 200
59 3300049742 Ga0501080_0012740 Ga0501080_0012740_6532_7200 200
60 3300049823 Ga0501044_0612131 Ga0501044_0612131_293_961 200
61 3300054114 Ga0501084_0194817 Ga0501084_0194817_1020_1688 200
62 3300048922 Ga0496119_0256315 Ga0496119_0256315_241_858 201
63 3300050509 nmdc:mga0qj67_123151_c1 nmdc:mga0qj67_123151_c1_685_1374 202
64 3300050509 nmdc:mga0qj67_66003_c1 nmdc:mga0qj67_66003_c1_649_1338 202
65 3300049742 Ga0501080_0161376 Ga0501080_0161376_188_856 203
66 3300050491 nmdc:mga00v17_182687_c1 nmdc:mga00v17_182687_c1_421_1095 203
67 3300044694 Ga0466963_0318423 Ga0466963_0318423_219_887 204
68 3300046642 Ga0495634_0446466 Ga0495634_0446466_95_745 204
69 3300046689 Ga0495613_0543863 Ga0495613_0543863_27_680 204
70 3300049571 Ga0501034_0376154 Ga0501034_0376154_621_1289 204
71 3300049586 Ga0501070_0006873 Ga0501070_0006873_1223_1891 204
72 3300049742 Ga0501080_0223973 Ga0501080_0223973_297_965 204
73 3300049823 Ga0501044_0008850 Ga0501044_0008850_9492_10160 204
74 3300013308 Ga0157375_10794758 Ga0157375_107947582 205
75 3300041451 Ga0451791_0098276 Ga0451791_0098276_380_1021 205
76 3300044693 Ga0466961_0101521 Ga0466961_0101521_879_1547 205
77 3300044693 Ga0466961_0194570 Ga0466961_0194570_205_873 205
78 3300044694 Ga0466963_0278772 Ga0466963_0278772_204_872 205
79 3300044719 Ga0466971_0007279 Ga0466971_0007279_3521_4189 205
80 3300045976 Ga0466967_0115719 Ga0466967_0115719_96_764 205
81 3300045976 Ga0466967_0268408 Ga0466967_0268408_273_941 205
82 3300049127 Ga0501306_025390 Ga0501306_025390_145_786 205
83 3300049130 Ga0501310_009023 Ga0501310_009023_144_785 205
84 3300049585 Ga0501069_0005427 Ga0501069_0005427_925_1593 205
85 3300049586 Ga0501070_0023755 Ga0501070_0023755_3889_4557 205
86 3300049587 Ga0501071_0468398 Ga0501071_0468398_286_954 205
87 3300049742 Ga0501080_0021002 Ga0501080_0021002_2499_3167 205
88 3300039438 Ga0436360_0452772 Ga0436360_0452772_1419_2159 206
89 3300033541 Ga0316596_1082865 Ga0316596_10828651 207
90 3300046491 Ga0495584_0160857 Ga0495584_0160857_260_922 207
91 3300046500 Ga0495596_0166116 Ga0495596_0166116_87_749 207
92 3300046520 Ga0495637_0092799 Ga0495637_0092799_510_1172 207
93 3300046525 Ga0495663_0077070 Ga0495663_0077070_78_740 207
94 3300046615 Ga0495656_0172150 Ga0495656_0172150_269_931 207
95 3300046664 Ga0495659_0246245 Ga0495659_0246245_28_690 207
96 3300046691 Ga0495670_0198007 Ga0495670_0198007_188_850 207
97 3300049589 Ga0501073_0253471 Ga0501073_0253471_19_675 207
98 iso_pu_bacteria 2643221635 2644197845 207
99 iso_pu_bacteria 2857479173 2857479648 207
100 iso_pu_bacteria 2857632687 2857633001 207
101 iso_pu_bacteria 2870804320 2870806309 207
102 3300005546 Ga0070696_100171088 Ga0070696_1001710882 208
103 3300006844 Ga0075428_100069898 Ga0075428_1000698984 208
104 3300006846 Ga0075430_100263670 Ga0075430_1002636702 208
105 3300009177 Ga0105248_10378170 Ga0105248_103781703 208
106 3300026075 Ga0207708_10375097 Ga0207708_103750972 208
107 3300031728 Ga0316578_10019688 Ga0316578_100196884 208
108 3300035398 Ga0316574_0004933 Ga0316574_0004933_5863_6609 208
109 3300045836 Ga0466958_0029204 Ga0466958_0029204_464_1108 208
110 3300048912 Ga0496109_0233500 Ga0496109_0233500_469_1236 208
111 3300048913 Ga0496110_0140076 Ga0496110_0140076_464_1231 208
112 3300061719 Ga0466962_0029879 Ga0466962_0029879_1570_2214 208
113 iso_pu_bacteria 2643221711 2644607528 208
114 iso_pu_bacteria 2818991458 2819665358 208
115 iso_pu_bacteria 2862993130 2862993642 208
116 iso_pu_bacteria 2870622029 2870622174 208
117 iso_pu_bacteria 2939657138 2939659464 208
118 iso_pu_bacteria 2964326757 2964328449 208
119 3300005983 Ga0081540_1006273 Ga0081540_10062735 209
120 3300013102 Ga0157371_10556527 Ga0157371_105565271 209
121 3300020069 Ga0197907_11504167 Ga0197907_115041673 209
122 3300020080 Ga0206350_10389078 Ga0206350_103890781 209
123 3300022467 Ga0224712_10090225 Ga0224712_100902253 209
124 3300039450 Ga0436363_1130555 Ga0436363_1130555_736_1386 209
125 3300044683 Ga0466965_0043734 Ga0466965_0043734_890_1540 209
126 3300044765 Ga0466970_0153967 Ga0466970_0153967_273_926 209
127 3300045976 Ga0466967_0164855 Ga0466967_0164855_802_1452 209
128 3300048905 Ga0496102_0282772 Ga0496102_0282772_388_1038 209
129 3300049574 Ga0501038_0229283 Ga0501038_0229283_238_882 209
130 iso_pu_bacteria 2643221567 2643851186 209
131 iso_pu_bacteria 2643221624 2644134975 209
132 3300020080 Ga0206350_10175503 Ga0206350_101755033 210
133 3300025919 Ga0207657_10288104 Ga0207657_102881042 210
134 3300044693 Ga0466961_0038025 Ga0466961_0038025_1707_2360 210
135 3300044693 Ga0466961_0135108 Ga0466961_0135108_477_1130 210
136 3300044694 Ga0466963_0134331 Ga0466963_0134331_216_869 210
137 3300044719 Ga0466971_0093838 Ga0466971_0093838_275_928 210
138 3300044765 Ga0466970_0193942 Ga0466970_0193942_18_671 210
139 3300044842 Ga0466957_0156308 Ga0466957_0156308_300_953 210
140 3300045049 Ga0466959_0149875 Ga0466959_0149875_599_1252 210
141 3300045836 Ga0466958_0004358 Ga0466958_0004358_2965_3618 210
142 3300045976 Ga0466967_0058701 Ga0466967_0058701_1053_1706 210
143 3300045976 Ga0466967_0121021 Ga0466967_0121021_1591_2244 210
144 iso_pu_bacteria 2919713450 2919718239 210
145 3300039453 Ga0436362_1068984 Ga0436362_1068984_44_691 211
146 3300049824 Ga0501045_0117323 Ga0501045_0117323_897_1535 211
147 3300005337 Ga0070682_100197643 Ga0070682_1001976432 212
148 3300005458 Ga0070681_10119645 Ga0070681_101196453 212
149 3300005530 Ga0070679_100331328 Ga0070679_1003313282 212
150 3300006847 Ga0075431_100041531 Ga0075431_1000415314 212
151 3300009098 Ga0105245_10517115 Ga0105245_105171152 212
152 3300009148 Ga0105243_10528853 Ga0105243_105288532 212
153 3300009551 Ga0105238_10587420 Ga0105238_105874202 212
154 3300025921 Ga0207652_10227046 Ga0207652_102270462 212
155 3300025944 Ga0207661_10397245 Ga0207661_103972452 212
156 3300031251 Ga0265327_10110389 Ga0265327_101103892 212
157 3300032002 Ga0307416_101090287 Ga0307416_1010902871 212
158 3300044712 Ga0453684_0677221 Ga0453684_0677221_384_1022 212
159 3300046683 Ga0495658_0256466 Ga0495658_0256466_54_719 212
160 3300046810 Ga0495660_0222967 Ga0495660_0222967_183_824 212
161 3300048905 Ga0496102_0220931 Ga0496102_0220931_504_1145 212
162 3300048906 Ga0496103_0129997 Ga0496103_0129997_654_1295 212
163 3300048912 Ga0496109_0121866 Ga0496109_0121866_1575_2216 212
164 3300048913 Ga0496110_0065999 Ga0496110_0065999_405_1115 212
165 3300048915 Ga0496112_0088274 Ga0496112_0088274_2189_2854 212
166 3300048915 Ga0496112_0344195 Ga0496112_0344195_200_910 212
167 3300049581 Ga0501047_0000014 Ga0501047_0000014_207987_208664 212
168 3300049586 Ga0501070_0039598 Ga0501070_0039598_303_980 212
169 3300049742 Ga0501080_0024833 Ga0501080_0024833_4264_4941 212
170 3300050490 nmdc:mga03n38_209483_c1 nmdc:mga03n38_209483_c1_52_717 212
171 3300050510 nmdc:mga06r32_224423_c1 nmdc:mga06r32_224423_c1_1182_1844 212
172 3300050510 nmdc:mga06r32_865576_c1 nmdc:mga06r32_865576_c1_123_785 212
173 3300053153 Ga0500616_0000816 Ga0500616_0000816_33977_34618 212
174 3300005445 Ga0070708_100101114 Ga0070708_1001011144 213
175 3300009551 Ga0105238_11257590 Ga0105238_112575901 213
176 3300013308 Ga0157375_10724552 Ga0157375_107245521 213
177 3300014745 Ga0157377_10255711 Ga0157377_102557112 213
178 3300025919 Ga0207657_10549733 Ga0207657_105497332 213
179 3300025938 Ga0207704_10588108 Ga0207704_105881082 213
180 3300026067 Ga0207678_10607024 Ga0207678_106070241 213
181 3300041404 Ga0439436_0054059 Ga0439436_0054059_27_674 213
182 3300042184 Ga0450908_032994 Ga0450908_032994_41_688 213
183 3300042435 Ga0439434_0024723 Ga0439434_0024723_263_910 213
184 3300042435 Ga0439434_0045462 Ga0439434_0045462_605_1252 213
185 3300046461 Ga0495641_0088030 Ga0495641_0088030_686_1330 213
186 3300046475 Ga0495639_0094748 Ga0495639_0094748_271_915 213
187 3300046511 Ga0495608_0312841 Ga0495608_0312841_25_669 213
188 3300046535 Ga0495586_0243547 Ga0495586_0243547_18_662 213
189 3300046683 Ga0495658_0038331 Ga0495658_0038331_497_1141 213
190 3300047321 Ga0495676_0056624 Ga0495676_0056624_2321_2965 213
191 3300048907 Ga0496104_0136556 Ga0496104_0136556_1288_1932 213
192 3300048911 Ga0496108_0312436 Ga0496108_0312436_195_839 213
193 3300048912 Ga0496109_0023891 Ga0496109_0023891_1116_1760 213
194 3300048912 Ga0496109_0137123 Ga0496109_0137123_754_1398 213
195 3300048913 Ga0496110_0236454 Ga0496110_0236454_267_911 213
196 3300048916 Ga0496113_0413837 Ga0496113_0413837_118_762 213
197 3300048917 Ga0496114_0129628 Ga0496114_0129628_1508_2152 213
198 3300049531 Ga0501315_018619 Ga0501315_018619_232_906 213
199 3300049574 Ga0501038_0515590 Ga0501038_0515590_129_773 213
200 3300049576 Ga0501040_0353608 Ga0501040_0353608_258_902 213
201 3300049577 Ga0501041_0123591 Ga0501041_0123591_455_1099 213
202 3300049584 Ga0501068_0163026 Ga0501068_0163026_726_1370 213
203 3300049744 Ga0501083_0058980 Ga0501083_0058980_1801_2445 213
204 3300053153 Ga0500616_0000147 Ga0500616_0000147_58558_59247 213
205 3300054114 Ga0501084_0000009 Ga0501084_0000009_35315_35959 213
206 3300054114 Ga0501084_0480867 Ga0501084_0480867_83_727 213
207 3300061734 Ga0530510_0012514 Ga0530510_0012514_4068_4712 213
208 iso_pu_bacteria 2728369276 2729906681 213
209 3300001979 JGI24740J21852_10001487 JGI24740J21852_100014873 214
210 3300005530 Ga0070679_100191489 Ga0070679_1001914892 214
211 3300006871 Ga0075434_100105102 Ga0075434_1001051023 214
212 3300007076 Ga0075435_100308212 Ga0075435_1003082121 214
213 3300009094 Ga0111539_10189124 Ga0111539_101891242 214
214 3300009098 Ga0105245_10028450 Ga0105245_100284505 214
215 3300009176 Ga0105242_10159874 Ga0105242_101598742 214
216 3300011119 Ga0105246_10244420 Ga0105246_102444201 214
217 3300013308 Ga0157375_10145381 Ga0157375_101453812 214
218 3300020070 Ga0206356_10882538 Ga0206356_108825382 214
219 3300025921 Ga0207652_10429738 Ga0207652_104297382 214
220 3300025927 Ga0207687_10106156 Ga0207687_101061562 214
221 3300025936 Ga0207670_10056299 Ga0207670_100562994 214
222 3300025961 Ga0207712_10408887 Ga0207712_104088871 214
223 3300026075 Ga0207708_10060766 Ga0207708_100607665 214
224 3300028573 Ga0265334_10034741 Ga0265334_100347411 214
225 3300028800 Ga0265338_10000149 Ga0265338_10000149138 214
226 3300031239 Ga0265328_10027208 Ga0265328_100272083 214
227 3300031241 Ga0265325_10002115 Ga0265325_1000211520 214
228 3300031249 Ga0265339_10013505 Ga0265339_100135056 214
229 3300031250 Ga0265331_10272329 Ga0265331_102723292 214
230 3300031344 Ga0265316_10024763 Ga0265316_100247635 214
231 3300031595 Ga0265313_10006027 Ga0265313_1000602713 214
232 3300031852 Ga0307410_10437952 Ga0307410_104379522 214
233 3300031901 Ga0307406_10819556 Ga0307406_108195561 214
234 3300032126 Ga0307415_100557924 Ga0307415_1005579242 214
235 3300035695 Ga0373927_0379826 Ga0373927_0379826_58_705 214
236 3300035724 Ga0373933_0587425 Ga0373933_0587425_36_683 214
237 3300039437 Ga0436365_0440237 Ga0436365_0440237_962_1609 214
238 3300039437 Ga0436365_0787645 Ga0436365_0787645_345_992 214
239 3300039437 Ga0436365_1510258 Ga0436365_1510258_10_657 214
240 3300046473 Ga0495582_0268632 Ga0495582_0268632_213_860 214
241 3300046517 Ga0495630_0044139 Ga0495630_0044139_1983_2630 214
242 3300046689 Ga0495613_0152906 Ga0495613_0152906_69_716 214
243 3300048911 Ga0496108_0029977 Ga0496108_0029977_3055_3702 214
244 3300048915 Ga0496112_0007477 Ga0496112_0007477_5293_5940 214
245 3300048915 Ga0496112_0037283 Ga0496112_0037283_1080_1727 214
246 3300048916 Ga0496113_0069795 Ga0496113_0069795_1876_2523 214
247 3300049568 Ga0501031_0050492 Ga0501031_0050492_223_882 214
248 3300049573 Ga0501037_0143264 Ga0501037_0143264_223_882 214
249 3300049575 Ga0501039_0040158 Ga0501039_0040158_789_1448 214
250 3300049577 Ga0501041_0007814 Ga0501041_0007814_5564_6223 214
251 3300049582 Ga0501048_0071990 Ga0501048_0071990_1398_2057 214
252 3300049587 Ga0501071_0034095 Ga0501071_0034095_2319_2978 214
253 3300049590 Ga0501074_0280687 Ga0501074_0280687_163_822 214
254 3300049591 Ga0501075_0543315 Ga0501075_0543315_82_771 214
255 3300049592 Ga0501076_0008941 Ga0501076_0008941_1740_2399 214
256 3300049593 Ga0501077_0049257 Ga0501077_0049257_178_837 214
257 3300049741 Ga0501079_0065095 Ga0501079_0065095_1257_1916 214
258 3300049741 Ga0501079_0548616 Ga0501079_0548616_70_717 214
259 3300049742 Ga0501080_0097290 Ga0501080_0097290_1863_2522 214
260 3300049824 Ga0501045_0005535 Ga0501045_0005535_2327_2986 214
261 3300049824 Ga0501045_0222954 Ga0501045_0222954_165_830 214
262 3300050512 nmdc:mga0n895_410302_c1 nmdc:mga0n895_410302_c1_520_1167 214
263 3300050513 nmdc:mga0rr50_476459_c1 nmdc:mga0rr50_476459_c1_378_1025 214
264 3300054114 Ga0501084_0030367 Ga0501084_0030367_3348_4007 214
265 3300054114 Ga0501084_0713432 Ga0501084_0713432_112_759 214
266 3300060353 Ga0501082_0697288 Ga0501082_0697288_219_866 214
267 3300061734 Ga0530510_0028059 Ga0530510_0028059_1841_2500 214
268 3300005354 Ga0070675_100255681 Ga0070675_1002556812 215
269 3300005356 Ga0070674_100413564 Ga0070674_1004135641 215
270 3300005436 Ga0070713_100032992 Ga0070713_1000329924 215
271 3300005458 Ga0070681_10674579 Ga0070681_106745792 215
272 3300005843 Ga0068860_100922757 Ga0068860_1009227571 215
273 3300006048 Ga0075363_100063734 Ga0075363_1000637342 215
274 3300006051 Ga0075364_10167862 Ga0075364_101678622 215
275 3300006175 Ga0070712_100033777 Ga0070712_1000337775 215
276 3300006846 Ga0075430_100096393 Ga0075430_1000963933 215
277 3300006881 Ga0068865_100252048 Ga0068865_1002520482 215
278 3300009093 Ga0105240_10419005 Ga0105240_104190052 215
279 3300009094 Ga0111539_10485062 Ga0111539_104850622 215
280 3300009098 Ga0105245_10519984 Ga0105245_105199842 215
281 3300009098 Ga0105245_10566780 Ga0105245_105667802 215
282 3300009098 Ga0105245_11364366 Ga0105245_113643661 215
283 3300010375 Ga0105239_10262307 Ga0105239_102623073 215
284 3300013297 Ga0157378_10648259 Ga0157378_106482592 215
285 3300013307 Ga0157372_10561561 Ga0157372_105615612 215
286 3300013308 Ga0157375_10345017 Ga0157375_103450173 215
287 3300017792 Ga0163161_10771344 Ga0163161_107713441 215
288 3300025901 Ga0207688_10200980 Ga0207688_102009802 215
289 3300025906 Ga0207699_10363790 Ga0207699_103637902 215
290 3300025908 Ga0207643_10088117 Ga0207643_100881172 215
291 3300025912 Ga0207707_10810270 Ga0207707_108102701 215
292 3300025915 Ga0207693_10067873 Ga0207693_100678733 215
293 3300025926 Ga0207659_10363462 Ga0207659_103634622 215
294 3300025944 Ga0207661_10550837 Ga0207661_105508372 215
295 3300025945 Ga0207679_10465998 Ga0207679_104659982 215
296 3300026067 Ga0207678_10619747 Ga0207678_106197472 215
297 3300026121 Ga0207683_10308528 Ga0207683_103085282 215
298 3300031251 Ga0265327_10043188 Ga0265327_100431882 215
299 3300031711 Ga0265314_10147988 Ga0265314_101479882 215
300 3300035691 Ga0373931_0028029 Ga0373931_0028029_607_1275 215
301 3300035695 Ga0373927_0426225 Ga0373927_0426225_53_727 215
302 3300039450 Ga0436363_1366990 Ga0436363_1366990_31_696 215
303 3300041512 Ga0451853_2424835 Ga0451853_2424835_13_690 215
304 3300046454 Ga0495592_0300262 Ga0495592_0300262_342_1016 215
305 3300046462 Ga0495651_0232137 Ga0495651_0232137_360_1025 215
306 3300046463 Ga0495653_0257561 Ga0495653_0257561_424_1098 215
307 3300046463 Ga0495653_0336194 Ga0495653_0336194_283_951 215
308 3300046511 Ga0495608_0223113 Ga0495608_0223113_463_1137 215
309 3300046514 Ga0495618_0137183 Ga0495618_0137183_244_918 215
310 3300046514 Ga0495618_0145422 Ga0495618_0145422_751_1416 215
311 3300046516 Ga0495628_0017197 Ga0495628_0017197_789_1463 215
312 3300046516 Ga0495628_0054403 Ga0495628_0054403_2057_2731 215
313 3300046517 Ga0495630_0009898 Ga0495630_0009898_3159_3833 215
314 3300046517 Ga0495630_0029240 Ga0495630_0029240_342_1016 215
315 3300046526 Ga0495666_0126831 Ga0495666_0126831_469_1143 215
316 3300046543 Ga0495645_0063332 Ga0495645_0063332_1910_2584 215
317 3300046557 Ga0495622_0060856 Ga0495622_0060856_281_955 215
318 3300046557 Ga0495622_0274015 Ga0495622_0274015_23_691 215
319 3300046675 Ga0495657_0035993 Ga0495657_0035993_1956_2630 215
320 3300046683 Ga0495658_0034888 Ga0495658_0034888_907_1581 215
321 3300046689 Ga0495613_0197646 Ga0495613_0197646_656_1330 215
322 3300046694 Ga0495649_0055563 Ga0495649_0055563_1137_1811 215
323 3300047319 Ga0495674_0280873 Ga0495674_0280873_555_1223 215
324 3300047319 Ga0495674_0399085 Ga0495674_0399085_59_733 215
325 3300047321 Ga0495676_0321873 Ga0495676_0321873_234_914 215
326 3300047322 Ga0495680_0110279 Ga0495680_0110279_1243_1917 215
327 3300047322 Ga0495680_0393217 Ga0495680_0393217_237_902 215
328 3300047444 Ga0495675_0139934 Ga0495675_0139934_456_1130 215
329 3300047471 Ga0495684_0054899 Ga0495684_0054899_1332_2006 215
330 3300047471 Ga0495684_0075284 Ga0495684_0075284_1281_1955 215
331 3300047471 Ga0495684_0381445 Ga0495684_0381445_104_772 215
332 3300048903 Ga0496100_0158131 Ga0496100_0158131_693_1361 215
333 3300048904 Ga0496101_0020929 Ga0496101_0020929_228_896 215
334 3300048905 Ga0496102_0085644 Ga0496102_0085644_1619_2287 215
335 3300048905 Ga0496102_0440886 Ga0496102_0440886_424_1086 215
336 3300048907 Ga0496104_0014571 Ga0496104_0014571_1370_2035 215
337 3300048907 Ga0496104_0133735 Ga0496104_0133735_1601_2269 215
338 3300048908 Ga0496105_0119895 Ga0496105_0119895_1444_2109 215
339 3300048908 Ga0496105_0275467 Ga0496105_0275467_675_1343 215
340 3300048908 Ga0496105_0476743 Ga0496105_0476743_136_810 215
341 3300048910 Ga0496107_0404980 Ga0496107_0404980_68_736 215
342 3300048912 Ga0496109_0243504 Ga0496109_0243504_844_1506 215
343 3300048912 Ga0496109_0840664 Ga0496109_0840664_87_761 215
344 3300048914 Ga0496111_0243225 Ga0496111_0243225_57_746 215
345 3300048915 Ga0496112_0764873 Ga0496112_0764873_60_722 215
346 3300048917 Ga0496114_0466097 Ga0496114_0466097_219_893 215
347 3300048929 Ga0496126_0374572 Ga0496126_0374572_283_948 215
348 3300049571 Ga0501034_0022224 Ga0501034_0022224_836_1513 215
349 3300049572 Ga0501036_0265810 Ga0501036_0265810_596_1273 215
350 3300049573 Ga0501037_0283468 Ga0501037_0283468_288_965 215
351 3300049579 Ga0501043_0544869 Ga0501043_0544869_48_725 215
352 3300049580 Ga0501046_0038334 Ga0501046_0038334_621_1298 215
353 3300049581 Ga0501047_0019391 Ga0501047_0019391_638_1315 215
354 3300049582 Ga0501048_0211853 Ga0501048_0211853_204_881 215
355 3300049586 Ga0501070_0014536 Ga0501070_0014536_2783_3460 215
356 3300049742 Ga0501080_0101931 Ga0501080_0101931_848_1525 215
357 3300049823 Ga0501044_0045484 Ga0501044_0045484_2571_3248 215
358 3300050490 nmdc:mga03n38_25382_c1 nmdc:mga03n38_25382_c1_267_947 215
359 3300050509 nmdc:mga0qj67_94539_c1 nmdc:mga0qj67_94539_c1_550_1224 215
360 3300053077 Ga0495601_0215055 Ga0495601_0215055_53_721 215
361 3300053078 Ga0495612_0027288 Ga0495612_0027288_566_1240 215
362 3300053084 Ga0495595_0221002 Ga0495595_0221002_234_908 215
363 3300053085 Ga0495619_0067954 Ga0495619_0067954_1416_2084 215
364 3300053085 Ga0495619_0195464 Ga0495619_0195464_545_1219 215
365 3300053085 Ga0495619_0315156 Ga0495619_0315156_129_797 215
366 3300059628 Ga0587122_006568 Ga0587122_006568_164_844 215
367 3300060353 Ga0501082_0355679 Ga0501082_0355679_87_764 215
368 3300061734 Ga0530510_0202597 Ga0530510_0202597_399_1199 215
369 3300001915 JGI24741J21665_1005137 JGI24741J21665_10051373 217
370 3300001979 JGI24740J21852_10016445 JGI24740J21852_100164453 217
371 3300002705 JGI25156J39149_1011939 JGI25156J39149_10119392 217
372 3300003752 Ga0055539_1004905 Ga0055539_10049052 217
373 3300003756 Ga0055533_1004361 Ga0055533_10043612 217
374 3300003758 Ga0055532_1000066 Ga0055532_10000663 217
375 3300003760 Ga0055527_1001137 Ga0055527_10011373 217
376 3300003761 Ga0055535_1000046 Ga0055535_10000463 217
377 3300003763 Ga0055529_1000087 Ga0055529_10000873 217
378 3300003841 Ga0055541_1003652 Ga0055541_10036524 217
379 3300005339 Ga0070660_100247889 Ga0070660_1002478892 217
380 3300005344 Ga0070661_100000276 Ga0070661_10000027652 217
381 3300005366 Ga0070659_100029079 Ga0070659_1000290793 217
382 3300005455 Ga0070663_100001053 Ga0070663_1000010533 217
383 3300005564 Ga0070664_100000018 Ga0070664_100000018138 217
384 3300005578 Ga0068854_100000225 Ga0068854_1000002253 217
385 3300005614 Ga0068856_100000070 Ga0068856_1000000703 217
386 3300005616 Ga0068852_100281704 Ga0068852_1002817042 217
387 3300020069 Ga0197907_10975053 Ga0197907_109750533 217
388 3300020070 Ga0206356_11734114 Ga0206356_117341142 217
389 3300020076 Ga0206355_1151807 Ga0206355_11518073 217
390 3300022467 Ga0224712_10058223 Ga0224712_100582232 217
391 3300025224 Ga0209784_100052 Ga0209784_1000523 217
392 3300025225 Ga0209566_101697 Ga0209566_10169710 217
393 3300025226 Ga0209674_100087 Ga0209674_100087204 217
394 3300025228 Ga0209672_100276 Ga0209672_10027649 217
395 3300025228 Ga0209672_100383 Ga0209672_10038339 217
396 3300025229 Ga0209147_100090 Ga0209147_100090153 217
397 3300025230 Ga0209563_100470 Ga0209563_10047027 217
398 3300025242 Ga0209258_100130 Ga0209258_100130152 217
399 3300025253 Ga0209677_100043 Ga0209677_100043208 217
400 3300025256 Ga0209759_1006739 Ga0209759_10067395 217
401 3300025272 Ga0209455_1000119 Ga0209455_100011930 217
402 3300025904 Ga0207647_10052601 Ga0207647_100526012 217
403 3300025913 Ga0207695_10002409 Ga0207695_100024097 217
404 3300025919 Ga0207657_10232848 Ga0207657_102328482 217
405 3300025920 Ga0207649_10000490 Ga0207649_100004906 217
406 3300025945 Ga0207679_10000032 Ga0207679_1000003226 217
407 3300025981 Ga0207640_10001991 Ga0207640_100019913 217
408 3300026067 Ga0207678_10000024 Ga0207678_100000243 217
409 3300026078 Ga0207702_10000973 Ga0207702_100009733 217
410 3300026116 Ga0207674_10003250 Ga0207674_100032503 217
411 3300026142 Ga0207698_10023034 Ga0207698_100230342 217
412 3300059644 Ga0587075_008367 Ga0587075_008367_98_751 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

86

188

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9335 3 211
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9303 3 212
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9225 3 211
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9192 3 212
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.9114 3 211
ID Description Score Start End Superfamily
af_Q54I61_95_160_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9707 33 97 3.30.160.810
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9564 35 99 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.938 35 99 3.30.160.810
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9353 34 97 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.935 35 96 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A4Q3N8S5-F1-model_v4 deleted 0.9655 2 109
AF-A0A3B9LAN4-F1-model_v4 50S ribosomal protein L3 0.9408 4 123 GO:0003735
GO:0006412
GO:0022625
AF-A0A3B9LAN4-F1-model_v4 50S ribosomal protein L3 0.9334 4 123 GO:0003735
GO:0006412
GO:0022625
AF-A0A2G6EGS8-F1-model_v4 50S ribosomal protein L3 0.8955 1 128 GO:0003735
GO:0006412
GO:0022625
AF-A0A2G6EGS8-F1-model_v4 50S ribosomal protein L3 0.889 1 128 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
79.94 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map