F437757

General Info

Members Datasets Scaffolds Average Seq Length
412 172 824 313

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10003477|Ga0081538_100034779
Length 328
Sequence MHGVQVSAFGGPEVLEYRELPMPEPGAGQVRVRLHAVGVNPADTYIRTGTYAFFTPELPYTPGFDGAGVVDAVGAGVDQVAPGDRVFVAALGTPGCTGLYADLVVVDAAGVHPLLSTLSYGQGAAVGVPCVTAWRALFQKAHLQPGETVLIHGASGGVGVPATQLAVDAGAVVVGTAGSAAGMEVVRRAGASHVLDHSAPGYLDELAGITGGRGVSVVVEMLADVNLEHDLGVLATGGRVVVVGSRGRLEFTPRLTMIKEGTVMGTALWNASAAETAGALAGVAAKLRSGALVPVVGEELPLGEAAVAHRRILEPGARGKLILVPDQA

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
95 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
96 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
97 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
98 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
99 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
100 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
117 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
118 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
119 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.27
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10003477 3300005981 Bacteria 14880
2 JGI25406J46586_10000526 3300003203 Bacteria 17888
3 JGI25406J46586_10011302 3300003203 Bacteria 3922
4 JGI25407J50210_10005971 3300003373 Bacteria 3015
5 JGI25407J50210_10009506 3300003373 Bacteria 2465
6 Ga0070676_10011848 3300005328 Bacteria 4749
7 Ga0068869_100002053 3300005334 Bacteria 12100
8 Ga0070689_100175584 3300005340 Bacteria 1737
9 Ga0070669_100145381 3300005353 Bacteria 1832
10 Ga0070669_100266826 3300005353 Bacteria 1367
11 Ga0070669_100280399 3300005353 Bacteria 1335
12 Ga0070667_100259594 3300005367 Unclassified 1555
13 Ga0070705_100138709 3300005440 Bacteria 1597
14 Ga0070694_100002862 3300005444 Bacteria 10250
15 Ga0070694_100021189 3300005444 Bacteria 4150
16 Ga0070694_100097527 3300005444 Bacteria 2074
17 Ga0070694_100216251 3300005444 Bacteria 1435
18 Ga0070708_100032163 3300005445 Bacteria 4547
19 Ga0070708_100043289 3300005445 Bacteria 3956
20 Ga0070708_100113905 3300005445 Bacteria 2488
21 Ga0070708_100182566 3300005445 Bacteria 1961
22 Ga0070662_100360805 3300005457 Bacteria 1192
23 Ga0070706_100012001 3300005467 Bacteria 8042
24 Ga0070706_100066029 3300005467 Bacteria 3346
25 Ga0070706_100094046 3300005467 Bacteria 2781
26 Ga0070706_100174594 3300005467 Bacteria 2006
27 Ga0070707_100020729 3300005468 Bacteria 6204
28 Ga0070707_100031417 3300005468 Bacteria 5059
29 Ga0070707_100058571 3300005468 Bacteria 3694
30 Ga0070707_100105885 3300005468 Bacteria 2727
31 Ga0070707_100108601 3300005468 Bacteria 2691
32 Ga0070698_100003851 3300005471 Bacteria 16502
33 Ga0070698_100005788 3300005471 Bacteria 13523
34 Ga0070698_100040865 3300005471 Bacteria 4764
35 Ga0070698_100342868 3300005471 Unclassified 1425
36 Ga0070699_100007462 3300005518 Bacteria 9515
37 Ga0070699_100185162 3300005518 Bacteria 1849
38 Ga0070699_100243075 3300005518 Unclassified 1607
39 Ga0070679_100115578 3300005530 Bacteria 2668
40 Ga0070697_100009746 3300005536 Bacteria 7492
41 Ga0070697_100014889 3300005536 Bacteria 6104
42 Ga0070697_100016680 3300005536 Bacteria 5778
43 Ga0070697_100031498 3300005536 Bacteria 4267
44 Ga0070697_100448509 3300005536 Bacteria 1124
45 Ga0070686_100150708 3300005544 Bacteria 1628
46 Ga0070695_100000636 3300005545 Bacteria 18606
47 Ga0070695_100333876 3300005545 Bacteria 1131
48 Ga0070696_100006460 3300005546 Bacteria 7843
49 Ga0070696_100164907 3300005546 Bacteria 1634
50 Ga0070696_100251975 3300005546 Bacteria 1335
51 Ga0070704_100048472 3300005549 Bacteria 2974
52 Ga0068859_100085586 3300005617 Bacteria 3198
53 Ga0068861_100473685 3300005719 Bacteria 1127
54 Ga0068863_100286020 3300005841 Bacteria 1598
55 Ga0068860_100154281 3300005843 Bacteria 2213
56 Ga0068860_100463384 3300005843 Bacteria 1261
57 Ga0068862_100010583 3300005844 Bacteria 7624
58 Ga0068862_100059031 3300005844 Bacteria 3293
59 Ga0081455_10000080 3300005937 Bacteria 104190
60 Ga0081455_10005495 3300005937 Bacteria 13893
61 Ga0081455_10057360 3300005937 Bacteria 3301
62 Ga0081455_10060651 3300005937 Bacteria 3187
63 Ga0081538_10006888 3300005981 Bacteria 9894
64 Ga0081538_10011214 3300005981 Bacteria 7280
65 Ga0081538_10013573 3300005981 Bacteria 6442
66 Ga0081538_10018635 3300005981 Bacteria 5201
67 Ga0081538_10019654 3300005981 Bacteria 5006
68 Ga0081538_10079517 3300005981 Bacteria 1754
69 Ga0081539_10000183 3300005985 Bacteria 148051
70 Ga0081539_10000445 3300005985 Bacteria 88000
71 Ga0081539_10008535 3300005985 Bacteria 8876
72 Ga0081539_10027831 3300005985 Bacteria 3571
73 Ga0081539_10145079 3300005985 Bacteria 1149
74 Ga0075432_10013819 3300006058 Bacteria 2746
75 Ga0070715_10016058 3300006163 Bacteria 2805
76 Ga0070716_100010320 3300006173 Bacteria 4680
77 Ga0075428_100102453 3300006844 Bacteria 3121
78 Ga0075428_100124894 3300006844 Bacteria 2801
79 Ga0075428_100138309 3300006844 Bacteria 2648
80 Ga0075428_100320962 3300006844 Unclassified 1664
81 Ga0075430_100019101 3300006846 Bacteria 5829
82 Ga0075430_100174861 3300006846 Bacteria 1786
83 Ga0075431_100041166 3300006847 Bacteria 4764
84 Ga0075431_100050420 3300006847 Bacteria 4292
85 Ga0075431_100076215 3300006847 Bacteria 3461
86 Ga0075431_100280801 3300006847 Bacteria 1686
87 Ga0075431_100360858 3300006847 Bacteria 1459
88 Ga0075433_10000558 3300006852 Bacteria 24524
89 Ga0075433_10003389 3300006852 Bacteria 12309
90 Ga0075433_10006916 3300006852 Bacteria 8987
91 Ga0075433_10019211 3300006852 Bacteria 5689
92 Ga0075433_10060997 3300006852 Bacteria 3303
93 Ga0075434_100020500 3300006871 Bacteria 6412
94 Ga0075434_100022579 3300006871 Bacteria 6128
95 Ga0075434_100025554 3300006871 Bacteria 5778
96 Ga0075434_100037238 3300006871 Bacteria 4816
97 Ga0075434_100100061 3300006871 Bacteria 2905
98 Ga0075429_100003694 3300006880 Bacteria 13035
99 Ga0075429_100040733 3300006880 Bacteria 4044
100 Ga0075429_100148208 3300006880 Bacteria 2054
101 Ga0075429_100317011 3300006880 Bacteria 1364
102 Ga0075436_100016366 3300006914 Bacteria 5075
103 Ga0075436_100102030 3300006914 Bacteria 1998
104 Ga0075436_100131593 3300006914 Bacteria 1754
105 Ga0097620_100085587 3300006931 Bacteria 3198
106 Ga0075435_100006668 3300007076 Bacteria 8185
107 Ga0075435_100016930 3300007076 Bacteria 5504
108 Ga0099794_10033559 3300007265 Bacteria 2413
109 Ga0111539_10004405 3300009094 Bacteria 18400
110 Ga0111539_10007072 3300009094 Bacteria 14384
111 Ga0111539_10156955 3300009094 Bacteria 2662
112 Ga0111539_10178705 3300009094 Bacteria 2479
113 Ga0111539_10224598 3300009094 Bacteria 2187
114 Ga0105247_10148751 3300009101 Unclassified 1541
115 Ga0114129_10018149 3300009147 Bacteria 10020
116 Ga0114129_10026621 3300009147 Bacteria 8190
117 Ga0114129_10108138 3300009147 Bacteria 3840
118 Ga0114129_10132340 3300009147 Bacteria 3424
119 Ga0114129_10185014 3300009147 Bacteria 2832
120 Ga0114129_10356972 3300009147 Bacteria 1935
121 Ga0114129_10359336 3300009147 Bacteria 1927
122 Ga0114129_10362460 3300009147 Bacteria 1917
123 Ga0114129_10864160 3300009147 Bacteria 1149
124 Ga0105248_10241182 3300009177 Bacteria 2035
125 Ga0105249_10047904 3300009553 Bacteria 3896
126 Ga0157378_10307219 3300013297 Bacteria 1537
127 Ga0157380_10463542 3300014326 Bacteria 1220
128 Ga0157379_10300049 3300014968 Bacteria 1464
129 Ga0207685_10058256 3300025905 Bacteria 1519
130 Ga0207645_10012920 3300025907 Bacteria 5651
131 Ga0207684_10003244 3300025910 Bacteria 15956
132 Ga0207684_10005417 3300025910 Bacteria 11772
133 Ga0207684_10016346 3300025910 Bacteria 6372
134 Ga0207684_10080707 3300025910 Bacteria 2768
135 Ga0207684_10155455 3300025910 Bacteria 1968
136 Ga0207660_10086698 3300025917 Bacteria 2312
137 Ga0207646_10007629 3300025922 Bacteria 10952
138 Ga0207646_10012309 3300025922 Bacteria 8227
139 Ga0207646_10027397 3300025922 Bacteria 5197
140 Ga0207646_10091326 3300025922 Bacteria 2725
141 Ga0207681_10048200 3300025923 Bacteria 2875
142 Ga0207681_10254949 3300025923 Bacteria 1371
143 Ga0207681_10281180 3300025923 Bacteria 1310
144 Ga0207706_10056083 3300025933 Bacteria 3474
145 Ga0207706_10237245 3300025933 Unclassified 1594
146 Ga0207670_10045037 3300025936 Bacteria 2922
147 Ga0207704_10318299 3300025938 Bacteria 1199
148 Ga0207665_10001514 3300025939 Bacteria 15638
149 Ga0207689_10134723 3300025942 Bacteria 2034
150 Ga0207689_10271910 3300025942 Bacteria 1403
151 Ga0207712_10013342 3300025961 Bacteria 5267
152 Ga0207712_10032621 3300025961 Bacteria 3515
153 Ga0207640_10167588 3300025981 Bacteria 1633
154 Ga0207658_10191410 3300025986 Unclassified 1701
155 Ga0207708_10196057 3300026075 Bacteria 1609
156 Ga0207648_10081994 3300026089 Bacteria 2813
157 Ga0207648_10355071 3300026089 Bacteria 1322
158 Ga0207674_10058711 3300026116 Bacteria 3896
159 Ga0207675_100329918 3300026118 Bacteria 1491
160 Ga0209996_1004239 3300027395 Bacteria 1822
161 Ga0210000_1009484 3300027462 Bacteria 1433
162 Ga0209995_1009573 3300027471 Bacteria 1568
163 Ga0209999_1001223 3300027543 Bacteria 4414
164 Ga0209983_1003515 3300027665 Bacteria 3339
165 Ga0209588_1056828 3300027671 Bacteria 1265
166 Ga0209971_1000005 3300027682 Bacteria 108671
167 Ga0209966_1000010 3300027695 Bacteria 86172
168 Ga0209998_10000023 3300027717 Bacteria 65076
169 Ga0209974_10000464 3300027876 Bacteria 13490
170 Ga0207428_10000036 3300027907 Bacteria 223539
171 Ga0207428_10001482 3300027907 Bacteria 24541
172 Ga0268265_10011589 3300028380 Bacteria 5962
173 Ga0268264_10154572 3300028381 Bacteria 2060
174 Ga0307408_100158841 3300031548 Bacteria 1793
175 Ga0307408_100185627 3300031548 Bacteria 1671
176 Ga0307408_100283157 3300031548 Bacteria 1381
177 Ga0307408_100543079 3300031548 Bacteria 1024
178 Ga0307405_10061625 3300031731 Bacteria 2372
179 Ga0307405_10097079 3300031731 Bacteria 1966
180 Ga0307405_10148211 3300031731 Bacteria 1646
181 Ga0307405_10258003 3300031731 Bacteria 1300
182 Ga0307413_10026909 3300031824 Bacteria 3178
183 Ga0307413_10144368 3300031824 Bacteria 1649
184 Ga0307410_10014535 3300031852 Bacteria 4636
185 Ga0307410_10076327 3300031852 Bacteria 2339
186 Ga0307410_10101108 3300031852 Bacteria 2066
187 Ga0307410_10125359 3300031852 Bacteria 1879
188 Ga0307406_10001762 3300031901 Bacteria 11852
189 Ga0307407_10023793 3300031903 Bacteria 3201
190 Ga0307407_10066722 3300031903 Bacteria 2123
191 Ga0307407_10117673 3300031903 Bacteria 1679
192 Ga0307407_10154248 3300031903 Bacteria 1496
193 Ga0307412_10077084 3300031911 Bacteria 2292
194 Ga0307412_10257791 3300031911 Bacteria 1358
195 Ga0307409_100000218 3300031995 Bacteria 22963
196 Ga0307409_100005453 3300031995 Bacteria 7326
197 Ga0307409_100051494 3300031995 Bacteria 3151
198 Ga0307409_100062856 3300031995 Bacteria 2908
199 Ga0307409_100076557 3300031995 Bacteria 2683
200 Ga0307409_100222683 3300031995 Bacteria 1704
201 Ga0307416_100000365 3300032002 Bacteria 23532
202 Ga0307416_100002849 3300032002 Bacteria 10061
203 Ga0307416_100015547 3300032002 Bacteria 5260
204 Ga0307416_100047929 3300032002 Bacteria 3386
205 Ga0307416_100158581 3300032002 Bacteria 2087
206 Ga0307414_10010425 3300032004 Bacteria 5391
207 Ga0307414_10091224 3300032004 Bacteria 2264
208 Ga0307414_10183804 3300032004 Bacteria 1684
209 Ga0307411_10046828 3300032005 Bacteria 2791
210 Ga0307411_10100149 3300032005 Bacteria 2047
211 Ga0307415_100000165 3300032126 Bacteria 29375
212 Ga0307415_100000414 3300032126 Bacteria 18232
213 Ga0307415_100065713 3300032126 Bacteria 2528
214 Ga0307415_100083969 3300032126 Bacteria 2283
215 Ga0307415_100269134 3300032126 Bacteria 1395
216 Ga0373930_0001742 3300034816 Bacteria 3298
217 Ga0373950_0007529 3300034818 Bacteria 1693
218 Ga0373959_0012591 3300034820 Bacteria 1514
219 Ga0373928_0000369 3300035084 Bacteria 8997
220 Ga0373929_0012847 3300035085 Bacteria 1597
221 Ga0373949_0010627 3300035090 Bacteria 2019
222 Ga0373951_0004864 3300035091 Bacteria 3156
223 Ga0373932_0004779 3300035112 Bacteria 3194
224 Ga0373932_0013381 3300035112 Bacteria 2039
225 Ga0373932_0035887 3300035112 Bacteria 1404
226 Ga0373939_0011310 3300035114 Bacteria 2248
227 Ga0373945_0080262 3300035116 Bacteria 1249
228 Ga0373961_0016724 3300035241 Bacteria 1893
229 Ga0373961_0030345 3300035241 Bacteria 1503
230 Ga0373962_0009413 3300035242 Bacteria 2421
231 Ga0373962_0058076 3300035242 Bacteria 1130
232 Ga0373931_0036315 3300035691 Bacteria 2568
233 Ga0373927_0161435 3300035695 Bacteria 1468
234 Ga0373925_0227346 3300037068 Bacteria 1491
235 Ga0395900_0011316 3300037418 Bacteria 9127
236 Ga0395905_0345967 3300037471 Bacteria 1378
237 Ga0436364_1039143 3300037853 Unclassified 1323
238 Ga0395901_0001513 3300038443 Bacteria 24145
239 Ga0395901_0008272 3300038443 Bacteria 10508
240 Ga0395901_0013062 3300038443 Bacteria 8429
241 Ga0436360_0266106 3300039438 Bacteria 1470
242 Ga0439448_0016192 3300042005 Bacteria 2267
243 Ga0439450_000004 3300042008 Bacteria 26188
244 Ga0439451_005441 3300042009 Bacteria 2597
245 Ga0439463_014768 3300042016 Bacteria 1927
246 Ga0450905_001459 3300042142 Bacteria 3021
247 Ga0439444_0000094 3300042437 Bacteria 6952
248 Ga0439460_0000314 3300042461 Bacteria 10206
249 Ga0451577_0000146 3300042876 Bacteria 156252
250 Ga0451577_0163445 3300042876 Bacteria 2005
251 Ga0451577_0248786 3300042876 Bacteria 1609
252 Ga0451577_0531194 3300042876 Unclassified 1068
253 Ga0439440_0000031 3300042993 Bacteria 17654
254 Ga0439440_0005887 3300042993 Bacteria 2448
255 Ga0453683_0000009 3300044673 Bacteria 491115
256 Ga0453683_0000012 3300044673 Bacteria 376341
257 Ga0453683_0000077 3300044673 Bacteria 149320
258 Ga0453683_0006714 3300044673 Bacteria 7867
259 Ga0453683_0068818 3300044673 Bacteria 2213
260 Ga0453684_0000708 3300044712 Bacteria 118229
261 Ga0453684_0001687 3300044712 Bacteria 59695
262 Ga0453684_0041720 3300044712 Bacteria 6198
263 Ga0453684_0089811 3300044712 Bacteria 3798
264 Ga0451576_0000026 3300045051 Bacteria 427585
265 Ga0451576_0041919 3300045051 Bacteria 4836
266 Ga0451576_0084970 3300045051 Bacteria 3291
267 Ga0451576_0156160 3300045051 Bacteria 2380
268 Ga0451576_0190995 3300045051 Bacteria 2139
269 Ga0451576_0464454 3300045051 Bacteria 1329
270 Ga0495580_0000282 3300046472 Bacteria 41334
271 Ga0495580_0056808 3300046472 Bacteria 2756
272 Ga0495580_0346804 3300046472 Bacteria 1006
273 Ga0495584_0134073 3300046491 Bacteria 1257
274 Ga0495584_0145944 3300046491 Bacteria 1202
275 Ga0495642_0025561 3300046528 Bacteria 2341
276 Ga0496100_0274939 3300048903 Bacteria 1254
277 Ga0496106_0393883 3300048909 Bacteria 1113
278 Ga0501292_013634 3300049515 Bacteria 1253
279 Ga0501031_0101185 3300049568 Bacteria 1880
280 Ga0501032_0108806 3300049569 Bacteria 1835
281 Ga0501033_0056123 3300049570 Bacteria 2911
282 Ga0501036_0016929 3300049572 Bacteria 6090
283 Ga0501036_0053671 3300049572 Bacteria 3413
284 Ga0501036_0454544 3300049572 Bacteria 1067
285 Ga0501037_0017666 3300049573 Bacteria 5251
286 Ga0501038_0023972 3300049574 Bacteria 5449
287 Ga0501039_0006232 3300049575 Bacteria 9064
288 Ga0501039_0010187 3300049575 Bacteria 7166
289 Ga0501039_0027338 3300049575 Bacteria 4387
290 Ga0501039_0155566 3300049575 Bacteria 1796
291 Ga0501039_0182411 3300049575 Bacteria 1651
292 Ga0501040_0002755 3300049576 Bacteria 11327
293 Ga0501040_0026323 3300049576 Bacteria 3912
294 Ga0501040_0075516 3300049576 Bacteria 2329
295 Ga0501041_0020208 3300049577 Bacteria 3979
296 Ga0501041_0052034 3300049577 Bacteria 2497
297 Ga0501042_0000131 3300049578 Bacteria 32519
298 Ga0501042_0006137 3300049578 Bacteria 7788
299 Ga0501042_0011866 3300049578 Bacteria 5885
300 Ga0501042_0057825 3300049578 Bacteria 2767
301 Ga0501043_0011781 3300049579 Bacteria 6848
302 Ga0501043_0225826 3300049579 Bacteria 1447
303 Ga0501046_0001215 3300049580 Bacteria 24954
304 Ga0501046_0002155 3300049580 Bacteria 18575
305 Ga0501046_0008262 3300049580 Bacteria 9088
306 Ga0501046_0011959 3300049580 Bacteria 7404
307 Ga0501046_0169199 3300049580 Bacteria 1641
308 Ga0501047_0297859 3300049581 Bacteria 1456
309 Ga0501048_0001940 3300049582 Bacteria 15697
310 Ga0501048_0003092 3300049582 Bacteria 12693
311 Ga0501048_0013425 3300049582 Bacteria 6079
312 Ga0501068_0228127 3300049584 Bacteria 1184
313 Ga0501070_0046074 3300049586 Bacteria 3626
314 Ga0501071_0014039 3300049587 Bacteria 5472
315 Ga0501072_0000516 3300049588 Bacteria 27751
316 Ga0501072_0013555 3300049588 Bacteria 6239
317 Ga0501072_0028351 3300049588 Bacteria 4372
318 Ga0501072_0043408 3300049588 Bacteria 3533
319 Ga0501072_0047225 3300049588 Bacteria 3391
320 Ga0501074_0001173 3300049590 Bacteria 17178
321 Ga0501074_0003061 3300049590 Bacteria 11789
322 Ga0501075_0000226 3300049591 Bacteria 30174
323 Ga0501075_0093206 3300049591 Bacteria 2286
324 Ga0501076_0001552 3300049592 Bacteria 15383
325 Ga0501076_0052034 3300049592 Bacteria 3243
326 Ga0501076_0085124 3300049592 Bacteria 2540
327 Ga0501076_0179017 3300049592 Bacteria 1728
328 Ga0501076_0187970 3300049592 Bacteria 1685
329 Ga0501077_0022501 3300049593 Bacteria 3993
330 Ga0501077_0143255 3300049593 Bacteria 1516
331 Ga0501079_0000045 3300049741 Bacteria 52410
332 Ga0501079_0004056 3300049741 Bacteria 10838
333 Ga0501079_0009235 3300049741 Bacteria 7469
334 Ga0501079_0024565 3300049741 Bacteria 4625
335 Ga0501079_0157027 3300049741 Bacteria 1773
336 Ga0501079_0320110 3300049741 Bacteria 1214
337 Ga0501079_0379753 3300049741 Bacteria 1108
338 Ga0501080_0013705 3300049742 Bacteria 7466
339 Ga0501080_0163619 3300049742 Bacteria 2054
340 Ga0501081_0001175 3300049743 Bacteria 15829
341 Ga0501081_0012812 3300049743 Bacteria 5514
342 Ga0501081_0105810 3300049743 Bacteria 1993
343 Ga0501083_0056940 3300049744 Bacteria 2619
344 Ga0501083_0311435 3300049744 Bacteria 1024
345 Ga0501035_0060019 3300049822 Bacteria 3386
346 Ga0501035_0384322 3300049822 Bacteria 1170
347 Ga0501045_0000917 3300049824 Bacteria 19248
348 Ga0501045_0004682 3300049824 Bacteria 9449
349 Ga0501045_0051453 3300049824 Bacteria 3006
350 Ga0501045_0175203 3300049824 Bacteria 1598
351 Ga0501045_0178406 3300049824 Bacteria 1582
352 Ga0501045_0202458 3300049824 Bacteria 1479
353 nmdc:mga05p37_121793_c1 3300050507 Bacteria 3204
354 nmdc:mga05p37_124666_c1 3300050507 Bacteria 3164
355 nmdc:mga05p37_143169_c1 3300050507 Bacteria 2928
356 nmdc:mga05p37_20414_c1 3300050507 Bacteria 8014
357 nmdc:mga05p37_370802_c1 3300050507 Bacteria 1680
358 nmdc:mga05p37_376127_c1 3300050507 Bacteria 1666
359 nmdc:mga05p37_87287_c1 3300050507 Bacteria 3845
360 nmdc:mga05p37_89956_c1 3300050507 Bacteria 3783
361 nmdc:mga09592_10085_c1 3300050508 Bacteria 7682
362 nmdc:mga09592_1647_c2 3300050508 Bacteria 15973
363 nmdc:mga09592_171235_c1 3300050508 Bacteria 1878
364 nmdc:mga0qj67_20267_c1 3300050509 Bacteria 5089
365 nmdc:mga06r32_24505_c1 3300050510 Bacteria 5602
366 nmdc:mga06r32_331108_c1 3300050510 Bacteria 1508
367 nmdc:mga06r32_391446_c1 3300050510 Bacteria 1372
368 nmdc:mga06r32_78777_c1 3300050510 Bacteria 3204
369 nmdc:mga08y16_10348_c1 3300050511 Bacteria 9792
370 nmdc:mga08y16_153393_c1 3300050511 Bacteria 2394
371 nmdc:mga08y16_1699_c1 3300050511 Bacteria 22311
372 nmdc:mga08y16_202849_c1 3300050511 Bacteria 2055
373 nmdc:mga08y16_4840_c1 3300050511 Bacteria 14051
374 nmdc:mga0n895_105632_c1 3300050512 Bacteria 2829
375 nmdc:mga0n895_11673_c1 3300050512 Bacteria 7850
376 nmdc:mga0n895_35842_c1 3300050512 Bacteria 4787
377 nmdc:mga0n895_53018_c1 3300050512 Bacteria 3983
378 nmdc:mga0n895_551334_c1 3300050512 Bacteria 1159
379 nmdc:mga0n895_62669_c1 3300050512 Bacteria 3676
380 nmdc:mga0n895_8797_c1 3300050512 Bacteria 8781
381 nmdc:mga0rr50_1117_c1 3300050513 Bacteria 14584
382 nmdc:mga0rr50_150124_c1 3300050513 Bacteria 1882
383 nmdc:mga0rr50_18428_c1 3300050513 Bacteria 4691
384 nmdc:mga0rr50_367497_c1 3300050513 Bacteria 1212
385 nmdc:mga0rr50_46194_c1 3300050513 Bacteria 3206
386 nmdc:mga0rr50_76928_c1 3300050513 Bacteria 2563
387 nmdc:mga08x19_14970_c1 3300050514 Bacteria 4711
388 nmdc:mga08x19_46843_c1 3300050514 Bacteria 2766
389 nmdc:mga08x19_99317_c1 3300050514 Bacteria 1929
390 nmdc:mga0a205_10627_c1 3300050515 Bacteria 8462
391 nmdc:mga0a205_18346_c1 3300050515 Bacteria 6576
392 nmdc:mga0a205_18510_c1 3300050515 Bacteria 6550
393 nmdc:mga0a205_20318_c1 3300050515 Bacteria 6264
394 nmdc:mga0a205_4167_c1 3300050515 Bacteria 12957
395 nmdc:mga0a205_56823_c1 3300050515 Bacteria 3778
396 nmdc:mga0a205_7048_c1 3300050515 Bacteria 10152
397 Ga0501084_0000380 3300054114 Bacteria 34119
398 Ga0501084_0003069 3300054114 Bacteria 13535
399 Ga0501084_0011856 3300054114 Bacteria 7215
400 Ga0501084_0076155 3300054114 Bacteria 2812
401 Ga0501084_0083340 3300054114 Bacteria 2684
402 Ga0501084_0227940 3300054114 Bacteria 1572
403 Ga0590077_006231 3300059426 Bacteria 2445
404 Ga0501082_0000495 3300060353 Bacteria 34846
405 Ga0501082_0001952 3300060353 Bacteria 18158
406 Ga0501082_0002544 3300060353 Bacteria 15977
407 Ga0501082_0010145 3300060353 Bacteria 8112
408 Ga0530510_0000399 3300061734 Bacteria 28299
409 Ga0530510_0004967 3300061734 Bacteria 9187
410 Ga0530510_0104733 3300061734 Bacteria 2070
411 Ga0530510_0109391 3300061734 Bacteria 2024
412 Ga0530510_0229066 3300061734 Bacteria 1382
413 Ga0081538_10003477
414 JGI25406J46586_10000526
415 JGI25406J46586_10011302
416 JGI25407J50210_10005971
417 JGI25407J50210_10009506
418 Ga0070676_10011848
419 Ga0068869_100002053
420 Ga0070689_100175584
421 Ga0070669_100145381
422 Ga0070669_100266826
423 Ga0070669_100280399
424 Ga0070667_100259594
425 Ga0070705_100138709
426 Ga0070694_100002862
427 Ga0070694_100021189
428 Ga0070694_100097527
429 Ga0070694_100216251
430 Ga0070708_100032163
431 Ga0070708_100043289
432 Ga0070708_100113905
433 Ga0070708_100182566
434 Ga0070662_100360805
435 Ga0070706_100012001
436 Ga0070706_100066029
437 Ga0070706_100094046
438 Ga0070706_100174594
439 Ga0070707_100020729
440 Ga0070707_100031417
441 Ga0070707_100058571
442 Ga0070707_100105885
443 Ga0070707_100108601
444 Ga0070698_100003851
445 Ga0070698_100005788
446 Ga0070698_100040865
447 Ga0070698_100342868
448 Ga0070699_100007462
449 Ga0070699_100185162
450 Ga0070699_100243075
451 Ga0070679_100115578
452 Ga0070697_100009746
453 Ga0070697_100014889
454 Ga0070697_100016680
455 Ga0070697_100031498
456 Ga0070697_100448509
457 Ga0070686_100150708
458 Ga0070695_100000636
459 Ga0070695_100333876
460 Ga0070696_100006460
461 Ga0070696_100164907
462 Ga0070696_100251975
463 Ga0070704_100048472
464 Ga0068859_100085586
465 Ga0068861_100473685
466 Ga0068863_100286020
467 Ga0068860_100154281
468 Ga0068860_100463384
469 Ga0068862_100010583
470 Ga0068862_100059031
471 Ga0081455_10000080
472 Ga0081455_10005495
473 Ga0081455_10057360
474 Ga0081455_10060651
475 Ga0081538_10006888
476 Ga0081538_10011214
477 Ga0081538_10013573
478 Ga0081538_10018635
479 Ga0081538_10019654
480 Ga0081538_10079517
481 Ga0081539_10000183
482 Ga0081539_10000445
483 Ga0081539_10008535
484 Ga0081539_10027831
485 Ga0081539_10145079
486 Ga0075432_10013819
487 Ga0070715_10016058
488 Ga0070716_100010320
489 Ga0075428_100102453
490 Ga0075428_100124894
491 Ga0075428_100138309
492 Ga0075428_100320962
493 Ga0075430_100019101
494 Ga0075430_100174861
495 Ga0075431_100041166
496 Ga0075431_100050420
497 Ga0075431_100076215
498 Ga0075431_100280801
499 Ga0075431_100360858
500 Ga0075433_10000558
501 Ga0075433_10003389
502 Ga0075433_10006916
503 Ga0075433_10019211
504 Ga0075433_10060997
505 Ga0075434_100020500
506 Ga0075434_100022579
507 Ga0075434_100025554
508 Ga0075434_100037238
509 Ga0075434_100100061
510 Ga0075429_100003694
511 Ga0075429_100040733
512 Ga0075429_100148208
513 Ga0075429_100317011
514 Ga0075436_100016366
515 Ga0075436_100102030
516 Ga0075436_100131593
517 Ga0097620_100085587
518 Ga0075435_100006668
519 Ga0075435_100016930
520 Ga0099794_10033559
521 Ga0111539_10004405
522 Ga0111539_10007072
523 Ga0111539_10156955
524 Ga0111539_10178705
525 Ga0111539_10224598
526 Ga0105247_10148751
527 Ga0114129_10018149
528 Ga0114129_10026621
529 Ga0114129_10108138
530 Ga0114129_10132340
531 Ga0114129_10185014
532 Ga0114129_10356972
533 Ga0114129_10359336
534 Ga0114129_10362460
535 Ga0114129_10864160
536 Ga0105248_10241182
537 Ga0105249_10047904
538 Ga0157378_10307219
539 Ga0157380_10463542
540 Ga0157379_10300049
541 Ga0207685_10058256
542 Ga0207645_10012920
543 Ga0207684_10003244
544 Ga0207684_10005417
545 Ga0207684_10016346
546 Ga0207684_10080707
547 Ga0207684_10155455
548 Ga0207660_10086698
549 Ga0207646_10007629
550 Ga0207646_10012309
551 Ga0207646_10027397
552 Ga0207646_10091326
553 Ga0207681_10048200
554 Ga0207681_10254949
555 Ga0207681_10281180
556 Ga0207706_10056083
557 Ga0207706_10237245
558 Ga0207670_10045037
559 Ga0207704_10318299
560 Ga0207665_10001514
561 Ga0207689_10134723
562 Ga0207689_10271910
563 Ga0207712_10013342
564 Ga0207712_10032621
565 Ga0207640_10167588
566 Ga0207658_10191410
567 Ga0207708_10196057
568 Ga0207648_10081994
569 Ga0207648_10355071
570 Ga0207674_10058711
571 Ga0207675_100329918
572 Ga0209996_1004239
573 Ga0210000_1009484
574 Ga0209995_1009573
575 Ga0209999_1001223
576 Ga0209983_1003515
577 Ga0209588_1056828
578 Ga0209971_1000005
579 Ga0209966_1000010
580 Ga0209998_10000023
581 Ga0209974_10000464
582 Ga0207428_10000036
583 Ga0207428_10001482
584 Ga0268265_10011589
585 Ga0268264_10154572
586 Ga0307408_100158841
587 Ga0307408_100185627
588 Ga0307408_100283157
589 Ga0307408_100543079
590 Ga0307405_10061625
591 Ga0307405_10097079
592 Ga0307405_10148211
593 Ga0307405_10258003
594 Ga0307413_10026909
595 Ga0307413_10144368
596 Ga0307410_10014535
597 Ga0307410_10076327
598 Ga0307410_10101108
599 Ga0307410_10125359
600 Ga0307406_10001762
601 Ga0307407_10023793
602 Ga0307407_10066722
603 Ga0307407_10117673
604 Ga0307407_10154248
605 Ga0307412_10077084
606 Ga0307412_10257791
607 Ga0307409_100000218
608 Ga0307409_100005453
609 Ga0307409_100051494
610 Ga0307409_100062856
611 Ga0307409_100076557
612 Ga0307409_100222683
613 Ga0307416_100000365
614 Ga0307416_100002849
615 Ga0307416_100015547
616 Ga0307416_100047929
617 Ga0307416_100158581
618 Ga0307414_10010425
619 Ga0307414_10091224
620 Ga0307414_10183804
621 Ga0307411_10046828
622 Ga0307411_10100149
623 Ga0307415_100000165
624 Ga0307415_100000414
625 Ga0307415_100065713
626 Ga0307415_100083969
627 Ga0307415_100269134
628 Ga0373930_0001742
629 Ga0373950_0007529
630 Ga0373959_0012591
631 Ga0373928_0000369
632 Ga0373929_0012847
633 Ga0373949_0010627
634 Ga0373951_0004864
635 Ga0373932_0004779
636 Ga0373932_0013381
637 Ga0373932_0035887
638 Ga0373939_0011310
639 Ga0373945_0080262
640 Ga0373961_0016724
641 Ga0373961_0030345
642 Ga0373962_0009413
643 Ga0373962_0058076
644 Ga0373931_0036315
645 Ga0373927_0161435
646 Ga0373925_0227346
647 Ga0395900_0011316
648 Ga0395905_0345967
649 Ga0436364_1039143
650 Ga0395901_0001513
651 Ga0395901_0008272
652 Ga0395901_0013062
653 Ga0436360_0266106
654 Ga0439448_0016192
655 Ga0439450_000004
656 Ga0439451_005441
657 Ga0439463_014768
658 Ga0450905_001459
659 Ga0439444_0000094
660 Ga0439460_0000314
661 Ga0451577_0000146
662 Ga0451577_0163445
663 Ga0451577_0248786
664 Ga0451577_0531194
665 Ga0439440_0000031
666 Ga0439440_0005887
667 Ga0453683_0000009
668 Ga0453683_0000012
669 Ga0453683_0000077
670 Ga0453683_0006714
671 Ga0453683_0068818
672 Ga0453684_0000708
673 Ga0453684_0001687
674 Ga0453684_0041720
675 Ga0453684_0089811
676 Ga0451576_0000026
677 Ga0451576_0041919
678 Ga0451576_0084970
679 Ga0451576_0156160
680 Ga0451576_0190995
681 Ga0451576_0464454
682 Ga0495580_0000282
683 Ga0495580_0056808
684 Ga0495580_0346804
685 Ga0495584_0134073
686 Ga0495584_0145944
687 Ga0495642_0025561
688 Ga0496100_0274939
689 Ga0496106_0393883
690 Ga0501292_013634
691 Ga0501031_0101185
692 Ga0501032_0108806
693 Ga0501033_0056123
694 Ga0501036_0016929
695 Ga0501036_0053671
696 Ga0501036_0454544
697 Ga0501037_0017666
698 Ga0501038_0023972
699 Ga0501039_0006232
700 Ga0501039_0010187
701 Ga0501039_0027338
702 Ga0501039_0155566
703 Ga0501039_0182411
704 Ga0501040_0002755
705 Ga0501040_0026323
706 Ga0501040_0075516
707 Ga0501041_0020208
708 Ga0501041_0052034
709 Ga0501042_0000131
710 Ga0501042_0006137
711 Ga0501042_0011866
712 Ga0501042_0057825
713 Ga0501043_0011781
714 Ga0501043_0225826
715 Ga0501046_0001215
716 Ga0501046_0002155
717 Ga0501046_0008262
718 Ga0501046_0011959
719 Ga0501046_0169199
720 Ga0501047_0297859
721 Ga0501048_0001940
722 Ga0501048_0003092
723 Ga0501048_0013425
724 Ga0501068_0228127
725 Ga0501070_0046074
726 Ga0501071_0014039
727 Ga0501072_0000516
728 Ga0501072_0013555
729 Ga0501072_0028351
730 Ga0501072_0043408
731 Ga0501072_0047225
732 Ga0501074_0001173
733 Ga0501074_0003061
734 Ga0501075_0000226
735 Ga0501075_0093206
736 Ga0501076_0001552
737 Ga0501076_0052034
738 Ga0501076_0085124
739 Ga0501076_0179017
740 Ga0501076_0187970
741 Ga0501077_0022501
742 Ga0501077_0143255
743 Ga0501079_0000045
744 Ga0501079_0004056
745 Ga0501079_0009235
746 Ga0501079_0024565
747 Ga0501079_0157027
748 Ga0501079_0320110
749 Ga0501079_0379753
750 Ga0501080_0013705
751 Ga0501080_0163619
752 Ga0501081_0001175
753 Ga0501081_0012812
754 Ga0501081_0105810
755 Ga0501083_0056940
756 Ga0501083_0311435
757 Ga0501035_0060019
758 Ga0501035_0384322
759 Ga0501045_0000917
760 Ga0501045_0004682
761 Ga0501045_0051453
762 Ga0501045_0175203
763 Ga0501045_0178406
764 Ga0501045_0202458
765 nmdc:mga05p37_121793_c1
766 nmdc:mga05p37_124666_c1
767 nmdc:mga05p37_143169_c1
768 nmdc:mga05p37_20414_c1
769 nmdc:mga05p37_370802_c1
770 nmdc:mga05p37_376127_c1
771 nmdc:mga05p37_87287_c1
772 nmdc:mga05p37_89956_c1
773 nmdc:mga09592_10085_c1
774 nmdc:mga09592_1647_c2
775 nmdc:mga09592_171235_c1
776 nmdc:mga0qj67_20267_c1
777 nmdc:mga06r32_24505_c1
778 nmdc:mga06r32_331108_c1
779 nmdc:mga06r32_391446_c1
780 nmdc:mga06r32_78777_c1
781 nmdc:mga08y16_10348_c1
782 nmdc:mga08y16_153393_c1
783 nmdc:mga08y16_1699_c1
784 nmdc:mga08y16_202849_c1
785 nmdc:mga08y16_4840_c1
786 nmdc:mga0n895_105632_c1
787 nmdc:mga0n895_11673_c1
788 nmdc:mga0n895_35842_c1
789 nmdc:mga0n895_53018_c1
790 nmdc:mga0n895_551334_c1
791 nmdc:mga0n895_62669_c1
792 nmdc:mga0n895_8797_c1
793 nmdc:mga0rr50_1117_c1
794 nmdc:mga0rr50_150124_c1
795 nmdc:mga0rr50_18428_c1
796 nmdc:mga0rr50_367497_c1
797 nmdc:mga0rr50_46194_c1
798 nmdc:mga0rr50_76928_c1
799 nmdc:mga08x19_14970_c1
800 nmdc:mga08x19_46843_c1
801 nmdc:mga08x19_99317_c1
802 nmdc:mga0a205_10627_c1
803 nmdc:mga0a205_18346_c1
804 nmdc:mga0a205_18510_c1
805 nmdc:mga0a205_20318_c1
806 nmdc:mga0a205_4167_c1
807 nmdc:mga0a205_56823_c1
808 nmdc:mga0a205_7048_c1
809 Ga0501084_0000380
810 Ga0501084_0003069
811 Ga0501084_0011856
812 Ga0501084_0076155
813 Ga0501084_0083340
814 Ga0501084_0227940
815 Ga0590077_006231
816 Ga0501082_0000495
817 Ga0501082_0001952
818 Ga0501082_0002544
819 Ga0501082_0010145
820 Ga0530510_0000399
821 Ga0530510_0004967
822 Ga0530510_0104733
823 Ga0530510_0109391
824 Ga0530510_0229066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

157

284

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

26

116

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

189

323

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yb5-assembly1.cif.gz_A crystal structure of human zeta-crystallin with bound nadp 0.9676 1 324
1yb5-assembly1.cif.gz_A crystal structure of human zeta-crystallin with bound nadp 0.9559 1 324
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9129 1 324
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9071 1 324
4rvu-assembly1.cif.gz_D the native structure of mycobacterial rv1454c complexed with nadph 0.9059 1 324
ID Description Score Start End Superfamily
af_P47199_9_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9801 3 123 3.90.180.10
af_Q6AYT0_6_329_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9757 1 324 3.90.180.10
af_Q08257_129_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9744 126 293 3.40.50.720
af_O45496_127_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9702 126 285 3.40.50.720
af_Q08257_129_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9687 126 293 3.40.50.720
ID Description Score Start End GO Terms
AF-E9GTN4-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9737 1 326 GO:0003730
GO:0003960
GO:0005829
GO:0070402
AF-A0A2G8JEA8-F1-model_v4 Putative quinone oxidoreductase-like 0.9712 82 324 GO:0003730
GO:0003960
GO:0005829
GO:0070402
AF-E9GTN4-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9708 1 326 GO:0003730
GO:0003960
GO:0005829
GO:0070402
AF-A0A016TIR4-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9654 1 257 GO:0003730
GO:0003960
GO:0005829
GO:0070402
AF-A0A2G8JEA8-F1-model_v4 Putative quinone oxidoreductase-like 0.9633 82 324 GO:0003730
GO:0003960
GO:0005829
GO:0070402

Map