F437739

General Info

Members Datasets Scaffolds Average Seq Length
412 270 824 279

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100023246|Ga0070699_1000232463
Length 317
Sequence MLQSHHIVTHKGEKESPVQAIEMEISRDEHGSMMKISAVPNITLNDGNTIPQLGFGVFQIAPKDTAKAVSKALEIGYRHIDTAEMYGNEKGVGEAIRASGLERGEFFVTSKLNNGFHRANDARKAFSTTLSELGFDYVDLFLIHWPLPTLYGGDFVSTWKMLEEFYRDGRARSIGVSNFQIQHLERLAAETDLVPAVNQIEVHPYFTNEAVRAYGREHRIATEAWSPIAQGKVLGDPTITQLADKVGKTPAQVVLRWHIQRGEIVFPKSVTPSRMKENFELFDFELEPADIARISALDRSERGRTGPNPDTFAYIPR

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
127 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
128 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
158 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
159 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
257 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 2643221641 Nocardioides sp. Root122 Isolate Unclassified
261 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
262 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
263 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
264 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
265 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
266 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
267 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
268 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
269 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
270 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.6
Metatranscriptomes 0.73
Isolates 2.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0.24
Rhizoplane 9.22
Rhizosphere 81.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100023246 3300005518 Bacteria 5339
2 rootL2_10206833 3300003322 Bacteria 8305
3 JGI25160J50197_1023259 3300003354 Bacteria 1793
4 JGI25407J50210_10008040 3300003373 Bacteria 2652
5 Ga0070658_10359429 3300005327 Bacteria 1247
6 Ga0070682_100215812 3300005337 Bacteria 1362
7 Ga0068868_100063266 3300005338 Bacteria 2935
8 Ga0070689_100126103 3300005340 Bacteria 2048
9 Ga0070687_100018772 3300005343 Bacteria 3206
10 Ga0070671_100082458 3300005355 Bacteria 2689
11 Ga0070674_100302334 3300005356 Bacteria 1276
12 Ga0070673_100074911 3300005364 Bacteria 2728
13 Ga0070709_10145009 3300005434 Bacteria 1635
14 Ga0070714_100001139 3300005435 Bacteria 19083
15 Ga0070714_100015182 3300005435 Bacteria 6194
16 Ga0070714_100278136 3300005435 Bacteria 1554
17 Ga0070714_100319739 3300005435 Bacteria 1451
18 Ga0070714_100338139 3300005435 Bacteria 1411
19 Ga0070713_100307552 3300005436 Bacteria 1461
20 Ga0070710_10419915 3300005437 Bacteria 900
21 Ga0070711_100034572 3300005439 Bacteria 3372
22 Ga0070711_100323178 3300005439 Bacteria 1233
23 Ga0070694_100075512 3300005444 Bacteria 2331
24 Ga0070663_100042372 3300005455 Bacteria 3199
25 Ga0070684_100047076 3300005535 Bacteria 3737
26 Ga0070684_100069312 3300005535 Bacteria 3102
27 Ga0070684_100436047 3300005535 Bacteria 1210
28 Ga0068853_100175778 3300005539 Bacteria 1939
29 Ga0070686_100363759 3300005544 Bacteria 1090
30 Ga0070695_100111320 3300005545 Bacteria 1858
31 Ga0070696_100021486 3300005546 Bacteria 4375
32 Ga0070693_100107155 3300005547 Bacteria 1712
33 Ga0068855_100327956 3300005563 Bacteria 1690
34 Ga0070664_100108784 3300005564 Bacteria 2417
35 Ga0068857_100096685 3300005577 Bacteria 2647
36 Ga0070702_100370772 3300005615 Bacteria 1015
37 Ga0068852_100691069 3300005616 Bacteria 1030
38 Ga0068859_100417282 3300005617 Bacteria 1438
39 Ga0068864_100070462 3300005618 Bacteria 3042
40 Ga0068866_10083682 3300005718 Bacteria 1720
41 Ga0068863_100180934 3300005841 Bacteria 2023
42 Ga0068858_100368467 3300005842 Bacteria 1377
43 Ga0081455_10113738 3300005937 Bacteria 2146
44 Ga0081538_10000048 3300005981 Bacteria 111909
45 Ga0081538_10000491 3300005981 Bacteria 44144
46 Ga0081538_10001360 3300005981 Bacteria 25147
47 Ga0081538_10019231 3300005981 Bacteria 5087
48 Ga0081538_10023832 3300005981 Bacteria 4383
49 Ga0081538_10048802 3300005981 Bacteria 2576
50 Ga0081540_1000074 3300005983 Bacteria 107172
51 Ga0081540_1016918 3300005983 Bacteria 4538
52 Ga0081539_10036690 3300005985 Bacteria 2929
53 Ga0070717_10002078 3300006028 Bacteria 14026
54 Ga0070717_10071940 3300006028 Bacteria 2886
55 Ga0070717_10511561 3300006028 Bacteria 1086
56 Ga0075364_10036910 3300006051 Bacteria 3161
57 Ga0070715_10023000 3300006163 Bacteria 2436
58 Ga0070712_100078882 3300006175 Bacteria 2378
59 Ga0070712_100167050 3300006175 Bacteria 1704
60 Ga0075369_10001514 3300006186 Bacteria 7947
61 Ga0075427_10007648 3300006194 Bacteria 1591
62 Ga0097621_100128912 3300006237 Bacteria 2151
63 Ga0075431_100034877 3300006847 Bacteria 5183
64 Ga0075431_100459576 3300006847 Bacteria 1268
65 Ga0075434_100383539 3300006871 Bacteria 1426
66 Ga0068865_100033425 3300006881 Bacteria 3444
67 Ga0097620_100417277 3300006931 Bacteria 1438
68 Ga0075435_100078431 3300007076 Bacteria 2708
69 Ga0111539_10305146 3300009094 Bacteria 1852
70 Ga0105245_10289283 3300009098 Bacteria 1604
71 Ga0105247_10356875 3300009101 Bacteria 1030
72 Ga0114129_10033711 3300009147 Bacteria 7235
73 Ga0105242_10807634 3300009176 Bacteria 929
74 Ga0105237_10360748 3300009545 Bacteria 1457
75 Ga0105238_10082579 3300009551 Bacteria 3203
76 Ga0099796_10013689 3300010159 Bacteria 2323
77 Ga0157345_1002312 3300012498 Bacteria 1340
78 Ga0157373_10096946 3300013100 Bacteria 2076
79 Ga0157371_10057701 3300013102 Bacteria 2753
80 Ga0157371_10217068 3300013102 Bacteria 1373
81 Ga0157370_10236050 3300013104 Bacteria 1692
82 Ga0157369_10236556 3300013105 Bacteria 1908
83 Ga0163162_10312004 3300013306 Bacteria 1705
84 Ga0157372_10215868 3300013307 Bacteria 2223
85 Ga0157375_10227175 3300013308 Bacteria 2025
86 Ga0163163_10650755 3300014325 Bacteria 1117
87 Ga0182008_10093606 3300014497 Bacteria 1483
88 Ga0157377_10005402 3300014745 Bacteria 6004
89 Ga0157376_10213700 3300014969 Bacteria 1782
90 Ga0206356_11488539 3300020070 Bacteria 1033
91 Ga0206353_11648679 3300020082 Bacteria 1590
92 Ga0213876_10072094 3300021384 Bacteria 1824
93 Ga0213875_10000274 3300021388 Bacteria 50867
94 Ga0213875_10008140 3300021388 Bacteria 5384
95 Ga0213875_10035332 3300021388 Bacteria 2358
96 Ga0213875_10102079 3300021388 Bacteria 1339
97 Ga0207426_1011076 3300025302 Bacteria 3458
98 Ga0207713_1099560 3300025735 Bacteria 1006
99 Ga0207653_10012605 3300025885 Bacteria 2640
100 Ga0207692_10015916 3300025898 Bacteria 3318
101 Ga0207688_10118843 3300025901 Bacteria 1541
102 Ga0207680_10369209 3300025903 Bacteria 1010
103 Ga0207647_10101648 3300025904 Bacteria 1705
104 Ga0207699_10018294 3300025906 Bacteria 3710
105 Ga0207643_10053665 3300025908 Bacteria 2290
106 Ga0207654_10274860 3300025911 Bacteria 1138
107 Ga0207707_10291198 3300025912 Bacteria 1413
108 Ga0207693_10012799 3300025915 Bacteria 6768
109 Ga0207657_10078538 3300025919 Bacteria 2779
110 Ga0207649_10041097 3300025920 Bacteria 2813
111 Ga0207681_10499512 3300025923 Bacteria 996
112 Ga0207687_10020578 3300025927 Bacteria 4378
113 Ga0207700_10003735 3300025928 Bacteria 8886
114 Ga0207664_10013412 3300025929 Bacteria 5881
115 Ga0207664_10049377 3300025929 Bacteria 3312
116 Ga0207664_10363295 3300025929 Bacteria 1283
117 Ga0207664_10404069 3300025929 Bacteria 1215
118 Ga0207644_10069973 3300025931 Bacteria 2563
119 Ga0207644_10104539 3300025931 Bacteria 2132
120 Ga0207706_10038268 3300025933 Bacteria 4255
121 Ga0207709_10315559 3300025935 Bacteria 1168
122 Ga0207704_10649910 3300025938 Bacteria 868
123 Ga0207665_10002770 3300025939 Bacteria 11751
124 Ga0207665_10076547 3300025939 Bacteria 2295
125 Ga0207689_10028242 3300025942 Bacteria 4693
126 Ga0207661_10382928 3300025944 Bacteria 1273
127 Ga0207667_10173581 3300025949 Bacteria 2215
128 Ga0207640_10360379 3300025981 Bacteria 1171
129 Ga0207677_10375005 3300026023 Bacteria 1199
130 Ga0207678_10021996 3300026067 Bacteria 5590
131 Ga0207678_10197966 3300026067 Bacteria 1717
132 Ga0207708_10099571 3300026075 Bacteria 2248
133 Ga0207702_10040897 3300026078 Bacteria 3886
134 Ga0207641_10133789 3300026088 Bacteria 2230
135 Ga0207674_10079049 3300026116 Bacteria 3294
136 Ga0207683_10004505 3300026121 Bacteria 12018
137 Ga0268264_10468427 3300028381 Bacteria 1223
138 Ga0265336_10026374 3300028666 Bacteria 1826
139 Ga0307515_10000065 3300028794 Bacteria 244497
140 Ga0265338_10001322 3300028800 Bacteria 40480
141 Ga0265338_10035784 3300028800 Bacteria 4764
142 Ga0265338_10186402 3300028800 Bacteria 1576
143 Ga0265760_10067556 3300031090 Bacteria 1093
144 Ga0307408_100142644 3300031548 Bacteria 1882
145 Ga0307514_10155753 3300031649 Bacteria 1523
146 Ga0307516_10006600 3300031730 Bacteria 13563
147 Ga0307410_10027946 3300031852 Bacteria 3571
148 Ga0307410_10112441 3300031852 Bacteria 1972
149 Ga0307410_10148547 3300031852 Bacteria 1742
150 Ga0307410_10269204 3300031852 Bacteria 1332
151 Ga0307406_10154210 3300031901 Bacteria 1643
152 Ga0307407_10058299 3300031903 Bacteria 2244
153 Ga0307409_100085785 3300031995 Bacteria 2560
154 Ga0307409_100477272 3300031995 Bacteria 1209
155 Ga0307416_100025971 3300032002 Bacteria 4307
156 Ga0307416_100065184 3300032002 Bacteria 2992
157 Ga0307416_100115226 3300032002 Bacteria 2380
158 Ga0307414_10044880 3300032004 Bacteria 3023
159 Ga0307415_100049649 3300032126 Bacteria 2838
160 Ga0307415_100097938 3300032126 Bacteria 2142
161 Ga0307510_10079080 3300033180 Bacteria 3210
162 Ga0373930_0053950 3300034816 Bacteria 884
163 Ga0373926_0000598 3300035083 Bacteria 9767
164 Ga0373928_0022353 3300035084 Bacteria 1341
165 Ga0373944_0000476 3300035089 Bacteria 9293
166 Ga0373944_0006878 3300035089 Bacteria 3034
167 Ga0373932_0066975 3300035112 Bacteria 1105
168 Ga0373936_0000201 3300035113 Bacteria 19876
169 Ga0373936_0002761 3300035113 Bacteria 6542
170 Ga0373936_0055486 3300035113 Bacteria 1608
171 Ga0373941_0061131 3300035115 Bacteria 1226
172 Ga0373945_0000113 3300035116 Bacteria 19629
173 Ga0373945_0000170 3300035116 Bacteria 17159
174 Ga0373953_0024239 3300035117 Bacteria 2305
175 Ga0373954_0004433 3300035118 Bacteria 6042
176 Ga0373956_0008614 3300035119 Bacteria 4132
177 Ga0373960_0026170 3300035121 Bacteria 1592
178 Ga0373943_0000318 3300035170 Bacteria 20237
179 Ga0373943_0000529 3300035170 Bacteria 16512
180 Ga0373946_0000378 3300035171 Bacteria 14437
181 Ga0373946_0001221 3300035171 Bacteria 8880
182 Ga0373955_0001184 3300035172 Bacteria 11105
183 Ga0373942_0013267 3300035207 Bacteria 1979
184 Ga0373924_0000216 3300035410 Bacteria 17445
185 Ga0373931_0011694 3300035691 Bacteria 4241
186 Ga0373935_0003921 3300035692 Bacteria 8686
187 Ga0373935_0074962 3300035692 Bacteria 2188
188 Ga0373927_0000893 3300035695 Bacteria 22703
189 Ga0373927_0014318 3300035695 Bacteria 5252
190 Ga0373947_0007638 3300035725 Bacteria 6255
191 Ga0373947_0012573 3300035725 Bacteria 4852
192 Ga0373937_0031154 3300036401 Bacteria 4829
193 Ga0373937_0152538 3300036401 Bacteria 2164
194 Ga0373925_0001109 3300037068 Bacteria 23991
195 Ga0373925_0033092 3300037068 Bacteria 3810
196 Ga0373925_0044515 3300037068 Bacteria 3295
197 Ga0395899_0003706 3300037312 Bacteria 12091
198 Ga0395900_0077486 3300037418 Bacteria 3415
199 Ga0395900_0397414 3300037418 Bacteria 1343
200 Ga0436364_0216354 3300037853 Bacteria 3852
201 Ga0436364_0440595 3300037853 Bacteria 4271
202 Ga0436364_0676911 3300037853 Bacteria 5610
203 Ga0436364_0786308 3300037853 Bacteria 1331
204 Ga0436364_1205220 3300037853 Bacteria 2270
205 Ga0436364_1471647 3300037853 Bacteria 6647
206 Ga0436364_1557168 3300037853 Bacteria 5462
207 Ga0436364_1562251 3300037853 Bacteria 140891
208 Ga0395901_0554334 3300038443 Bacteria 1164
209 Ga0395901_0679217 3300038443 Bacteria 1030
210 Ga0242420_020342 3300038996 Bacteria 1180
211 Ga0436365_1751960 3300039437 Bacteria 12991
212 Ga0436365_1791071 3300039437 Bacteria 3379
213 Ga0436360_1138901 3300039438 Bacteria 1650
214 Ga0436363_1598334 3300039450 Bacteria 1388
215 Ga0451789_0173410 3300041443 Bacteria 2210
216 Ga0451791_0668625 3300041451 Bacteria 3104
217 Ga0451843_0403463 3300041509 Bacteria 1171
218 Ga0451853_4028362 3300041512 Bacteria 1092
219 Ga0439455_0012428 3300042012 Bacteria 1912
220 Ga0466966_0063458 3300044684 Bacteria 2328
221 Ga0466963_0074948 3300044694 Bacteria 2283
222 Ga0466963_0093424 3300044694 Bacteria 2051
223 Ga0466963_0131748 3300044694 Bacteria 1728
224 Ga0466968_0108418 3300044735 Bacteria 1247
225 Ga0466957_0013274 3300044842 Bacteria 4779
226 Ga0466957_0038155 3300044842 Bacteria 2894
227 Ga0466957_0126887 3300044842 Bacteria 1631
228 Ga0466957_0310615 3300044842 Bacteria 1061
229 Ga0466960_0016951 3300044901 Bacteria 3168
230 Ga0466960_0199877 3300044901 Bacteria 1091
231 Ga0466960_0293593 3300044901 Bacteria 914
232 Ga0466958_0010718 3300045836 Bacteria 5141
233 Ga0466958_0023075 3300045836 Bacteria 3649
234 Ga0466958_0254336 3300045836 Bacteria 1124
235 Ga0466967_0030602 3300045976 Bacteria 4519
236 Ga0466967_0068249 3300045976 Bacteria 3174
237 Ga0466967_0081075 3300045976 Bacteria 2930
238 Ga0466967_0090929 3300045976 Bacteria 2773
239 Ga0466967_0110886 3300045976 Bacteria 2520
240 Ga0466967_0146197 3300045976 Bacteria 2205
241 Ga0466967_0240610 3300045976 Bacteria 1726
242 Ga0466967_0290620 3300045976 Bacteria 1570
243 Ga0466967_0495009 3300045976 Bacteria 1199
244 Ga0495592_0100816 3300046454 Bacteria 2058
245 Ga0495603_0000597 3300046455 Bacteria 20309
246 Ga0495629_0000371 3300046459 Bacteria 37969
247 Ga0495651_0008180 3300046462 Bacteria 8022
248 Ga0495651_0049404 3300046462 Bacteria 3246
249 Ga0495651_0224632 3300046462 Bacteria 1297
250 Ga0495653_0011712 3300046463 Bacteria 7159
251 Ga0495653_0070274 3300046463 Bacteria 2621
252 Ga0495580_0003938 3300046472 Bacteria 12527
253 Ga0495582_0005397 3300046473 Bacteria 7134
254 Ga0495639_0000581 3300046475 Bacteria 16991
255 Ga0495662_0000105 3300046476 Bacteria 30869
256 Ga0495662_0033910 3300046476 Bacteria 2466
257 Ga0495664_0001590 3300046477 Bacteria 12049
258 Ga0495664_0123554 3300046477 Bacteria 1565
259 Ga0495608_0010298 3300046511 Bacteria 6524
260 Ga0495608_0016502 3300046511 Bacteria 5110
261 Ga0495608_0030431 3300046511 Bacteria 3654
262 Ga0495608_0263054 3300046511 Bacteria 1074
263 Ga0495618_0274613 3300046514 Bacteria 1053
264 Ga0495630_0002619 3300046517 Bacteria 12460
265 Ga0495630_0004822 3300046517 Bacteria 9462
266 Ga0495648_0001409 3300046524 Bacteria 23507
267 Ga0495666_0000671 3300046526 Bacteria 15488
268 Ga0495652_0043291 3300046529 Bacteria 3879
269 Ga0495652_0051722 3300046529 Bacteria 3506
270 Ga0495652_0075304 3300046529 Bacteria 2803
271 Ga0495654_0039981 3300046530 Bacteria 2339
272 Ga0495665_0000625 3300046531 Bacteria 18008
273 Ga0495665_0018050 3300046531 Bacteria 3793
274 Ga0495640_0001207 3300046533 Bacteria 20212
275 Ga0495640_0142358 3300046533 Bacteria 1545
276 Ga0495586_0000778 3300046535 Bacteria 18341
277 Ga0495587_0020903 3300046536 Bacteria 4037
278 Ga0495645_0009325 3300046543 Bacteria 6865
279 Ga0495645_0048019 3300046543 Bacteria 3110
280 Ga0495645_0281147 3300046543 Bacteria 1094
281 Ga0495667_0004233 3300046559 Bacteria 9670
282 Ga0495667_0009116 3300046559 Bacteria 6737
283 Ga0495667_0011341 3300046559 Bacteria 6035
284 Ga0495667_0145020 3300046559 Bacteria 1529
285 Ga0495668_0054495 3300046616 Bacteria 2210
286 Ga0495634_0003154 3300046642 Bacteria 13357
287 Ga0495634_0054323 3300046642 Bacteria 2682
288 Ga0495611_0137911 3300046648 Bacteria 1139
289 Ga0495635_0004193 3300046663 Bacteria 10001
290 Ga0495635_0006918 3300046663 Bacteria 7923
291 Ga0495635_0010202 3300046663 Bacteria 6566
292 Ga0495588_0086598 3300046674 Bacteria 1638
293 Ga0495657_0010016 3300046675 Bacteria 7150
294 Ga0495657_0085470 3300046675 Bacteria 2033
295 Ga0495599_0004796 3300046678 Bacteria 8038
296 Ga0495599_0027290 3300046678 Bacteria 3579
297 Ga0495623_0091475 3300046679 Bacteria 1866
298 Ga0495646_0045591 3300046680 Bacteria 2677
299 Ga0495647_0009193 3300046681 Bacteria 3340
300 Ga0495658_0121735 3300046683 Bacteria 1579
301 Ga0495658_0222725 3300046683 Bacteria 1181
302 Ga0495624_0001483 3300046690 Bacteria 18221
303 Ga0495624_0031649 3300046690 Bacteria 3436
304 Ga0495624_0194217 3300046690 Bacteria 1234
305 Ga0495600_0016895 3300046809 Bacteria 4639
306 Ga0495600_0101441 3300046809 Bacteria 1876
307 Ga0495581_0000627 3300047315 Bacteria 18445
308 Ga0495581_0025615 3300047315 Bacteria 3420
309 Ga0495581_0060022 3300047315 Bacteria 2198
310 Ga0495604_0043475 3300047317 Bacteria 3517
311 Ga0495604_0074896 3300047317 Bacteria 2550
312 Ga0495674_0000545 3300047319 Bacteria 34891
313 Ga0495674_0014041 3300047319 Bacteria 7507
314 Ga0495674_0062836 3300047319 Bacteria 3232
315 Ga0495674_0223567 3300047319 Bacteria 1555
316 Ga0495672_0002531 3300047320 Bacteria 16675
317 Ga0495672_0131206 3300047320 Bacteria 1318
318 Ga0495676_0002281 3300047321 Bacteria 17007
319 Ga0495676_0003291 3300047321 Bacteria 14604
320 Ga0495680_0004964 3300047322 Bacteria 12576
321 Ga0495680_0008845 3300047322 Bacteria 9108
322 Ga0495680_0020607 3300047322 Bacteria 5540
323 Ga0495680_0029017 3300047322 Bacteria 4533
324 Ga0495675_0008800 3300047444 Bacteria 6268
325 Ga0495673_0000640 3300047469 Bacteria 34402
326 Ga0495684_0003425 3300047471 Bacteria 12434
327 Ga0495684_0006574 3300047471 Bacteria 9015
328 Ga0495684_0009984 3300047471 Bacteria 7337
329 Ga0495684_0032232 3300047471 Bacteria 4022
330 Ga0495686_0156397 3300047472 Bacteria 1335
331 Ga0495593_0166143 3300047673 Bacteria 1113
332 Ga0495602_0039140 3300048088 Bacteria 4371
333 Ga0495602_0081744 3300048088 Bacteria 2714
334 Ga0495602_0118408 3300048088 Bacteria 2136
335 Ga0495602_0166204 3300048088 Bacteria 1717
336 Ga0495614_0006598 3300048089 Bacteria 5197
337 Ga0496100_0356079 3300048903 Bacteria 1106
338 Ga0496100_0367821 3300048903 Bacteria 1089
339 Ga0496100_0450984 3300048903 Bacteria 986
340 Ga0496101_0089992 3300048904 Bacteria 2282
341 Ga0496101_0100344 3300048904 Bacteria 2165
342 Ga0496102_0058422 3300048905 Bacteria 3524
343 Ga0496102_0266817 3300048905 Bacteria 1614
344 Ga0496102_0320756 3300048905 Bacteria 1459
345 Ga0496103_0071011 3300048906 Bacteria 2179
346 Ga0496104_0027956 3300048907 Bacteria 5223
347 Ga0496104_0047849 3300048907 Bacteria 4031
348 Ga0496105_0003831 3300048908 Bacteria 11223
349 Ga0496105_0120530 3300048908 Bacteria 2163
350 Ga0496105_0308082 3300048908 Bacteria 1272
351 Ga0496106_0032937 3300048909 Bacteria 3864
352 Ga0496106_0258361 3300048909 Bacteria 1393
353 Ga0496106_0438885 3300048909 Bacteria 1049
354 Ga0496107_0023017 3300048910 Bacteria 4404
355 Ga0496108_0339950 3300048911 Bacteria 1309
356 Ga0496108_0641304 3300048911 Bacteria 924
357 Ga0496109_0017984 3300048912 Bacteria 6206
358 Ga0496109_0108433 3300048912 Bacteria 2581
359 Ga0496109_0160340 3300048912 Bacteria 2107
360 Ga0496109_0324107 3300048912 Bacteria 1454
361 Ga0496110_0016265 3300048913 Bacteria 6208
362 Ga0496110_0044367 3300048913 Bacteria 3883
363 Ga0496110_0129778 3300048913 Bacteria 2275
364 Ga0496111_0005126 3300048914 Bacteria 8346
365 Ga0496111_0091492 3300048914 Bacteria 2229
366 Ga0496111_0259652 3300048914 Bacteria 1289
367 Ga0496112_0085194 3300048915 Bacteria 3126
368 Ga0496113_0067000 3300048916 Bacteria 2720
369 Ga0496113_0442732 3300048916 Bacteria 1044
370 Ga0496114_0047905 3300048917 Bacteria 3555
371 Ga0496114_0057849 3300048917 Bacteria 3237
372 Ga0496115_0386434 3300048918 Bacteria 1137
373 Ga0496121_0029305 3300048924 Bacteria 5095
374 Ga0501034_0078294 3300049571 Bacteria 3311
375 Ga0501034_0233630 3300049571 Bacteria 1787
376 Ga0501038_0307392 3300049574 Bacteria 1243
377 Ga0501041_0362754 3300049577 Bacteria 916
378 Ga0501046_0204061 3300049580 Bacteria 1470
379 Ga0501047_0040174 3300049581 Bacteria 4525
380 Ga0501048_0179674 3300049582 Bacteria 1500
381 Ga0501067_0044588 3300049583 Bacteria 2463
382 Ga0501067_0118562 3300049583 Bacteria 1472
383 Ga0501068_0051115 3300049584 Bacteria 2500
384 Ga0501072_0107194 3300049588 Bacteria 2222
385 Ga0501076_0279420 3300049592 Bacteria 1368
386 Ga0501035_0018489 3300049822 Bacteria 6421
387 Ga0501044_0061432 3300049823 Bacteria 3844
388 Ga0501212_021656 3300049851 Bacteria 998
389 nmdc:mga0yw44_139000_c1 3300050492 Bacteria 1577
390 nmdc:mga05p37_440726_c1 3300050507 Bacteria 1511
391 nmdc:mga06r32_65160_c1 3300050510 Bacteria 3514
392 nmdc:mga08y16_253363_c1 3300050511 Bacteria 1819
393 nmdc:mga0rr50_272721_c1 3300050513 Bacteria 1410
394 Ga0495601_0040497 3300053077 Bacteria 2917
395 Ga0495619_0004629 3300053085 Bacteria 8772
396 Ga0500641_0033390 3300053096 Bacteria 2042
397 Ga0500573_0000495 3300053140 Bacteria 17000
398 Ga0500573_0015536 3300053140 Bacteria 4317
399 Ga0590071_003630 3300059421 Bacteria 3790
400 Ga0590074_010123 3300059423 Bacteria 1576
401 Ga0590075_010106 3300059424 Bacteria 2269
402 2644228278 2643221641 Bacteria 4490190
403 2729905274 2728369276 Bacteria 5610032
404 2753035512 2751185725 Bacteria 5740550
405 2753326462 2751185792 Bacteria 5739090
406 2868089828 2868088558 Bacteria 7609351
407 2912764500 2912757875 Bacteria 7940295
408 2929214243 2929212328 Bacteria 7708288
409 2939658636 2939657138 Bacteria 3740283
410 2946025657 2946024296 Bacteria 3508095
411 2996222493 2996221748 Bacteria 6799777
412 8055413457 8055412473 Bacteria 6257500
413 Ga0070699_100023246
414 rootL2_10206833
415 JGI25160J50197_1023259
416 JGI25407J50210_10008040
417 Ga0070658_10359429
418 Ga0070682_100215812
419 Ga0068868_100063266
420 Ga0070689_100126103
421 Ga0070687_100018772
422 Ga0070671_100082458
423 Ga0070674_100302334
424 Ga0070673_100074911
425 Ga0070709_10145009
426 Ga0070714_100001139
427 Ga0070714_100015182
428 Ga0070714_100278136
429 Ga0070714_100319739
430 Ga0070714_100338139
431 Ga0070713_100307552
432 Ga0070710_10419915
433 Ga0070711_100034572
434 Ga0070711_100323178
435 Ga0070694_100075512
436 Ga0070663_100042372
437 Ga0070684_100047076
438 Ga0070684_100069312
439 Ga0070684_100436047
440 Ga0068853_100175778
441 Ga0070686_100363759
442 Ga0070695_100111320
443 Ga0070696_100021486
444 Ga0070693_100107155
445 Ga0068855_100327956
446 Ga0070664_100108784
447 Ga0068857_100096685
448 Ga0070702_100370772
449 Ga0068852_100691069
450 Ga0068859_100417282
451 Ga0068864_100070462
452 Ga0068866_10083682
453 Ga0068863_100180934
454 Ga0068858_100368467
455 Ga0081455_10113738
456 Ga0081538_10000048
457 Ga0081538_10000491
458 Ga0081538_10001360
459 Ga0081538_10019231
460 Ga0081538_10023832
461 Ga0081538_10048802
462 Ga0081540_1000074
463 Ga0081540_1016918
464 Ga0081539_10036690
465 Ga0070717_10002078
466 Ga0070717_10071940
467 Ga0070717_10511561
468 Ga0075364_10036910
469 Ga0070715_10023000
470 Ga0070712_100078882
471 Ga0070712_100167050
472 Ga0075369_10001514
473 Ga0075427_10007648
474 Ga0097621_100128912
475 Ga0075431_100034877
476 Ga0075431_100459576
477 Ga0075434_100383539
478 Ga0068865_100033425
479 Ga0097620_100417277
480 Ga0075435_100078431
481 Ga0111539_10305146
482 Ga0105245_10289283
483 Ga0105247_10356875
484 Ga0114129_10033711
485 Ga0105242_10807634
486 Ga0105237_10360748
487 Ga0105238_10082579
488 Ga0099796_10013689
489 Ga0157345_1002312
490 Ga0157373_10096946
491 Ga0157371_10057701
492 Ga0157371_10217068
493 Ga0157370_10236050
494 Ga0157369_10236556
495 Ga0163162_10312004
496 Ga0157372_10215868
497 Ga0157375_10227175
498 Ga0163163_10650755
499 Ga0182008_10093606
500 Ga0157377_10005402
501 Ga0157376_10213700
502 Ga0206356_11488539
503 Ga0206353_11648679
504 Ga0213876_10072094
505 Ga0213875_10000274
506 Ga0213875_10008140
507 Ga0213875_10035332
508 Ga0213875_10102079
509 Ga0207426_1011076
510 Ga0207713_1099560
511 Ga0207653_10012605
512 Ga0207692_10015916
513 Ga0207688_10118843
514 Ga0207680_10369209
515 Ga0207647_10101648
516 Ga0207699_10018294
517 Ga0207643_10053665
518 Ga0207654_10274860
519 Ga0207707_10291198
520 Ga0207693_10012799
521 Ga0207657_10078538
522 Ga0207649_10041097
523 Ga0207681_10499512
524 Ga0207687_10020578
525 Ga0207700_10003735
526 Ga0207664_10013412
527 Ga0207664_10049377
528 Ga0207664_10363295
529 Ga0207664_10404069
530 Ga0207644_10069973
531 Ga0207644_10104539
532 Ga0207706_10038268
533 Ga0207709_10315559
534 Ga0207704_10649910
535 Ga0207665_10002770
536 Ga0207665_10076547
537 Ga0207689_10028242
538 Ga0207661_10382928
539 Ga0207667_10173581
540 Ga0207640_10360379
541 Ga0207677_10375005
542 Ga0207678_10021996
543 Ga0207678_10197966
544 Ga0207708_10099571
545 Ga0207702_10040897
546 Ga0207641_10133789
547 Ga0207674_10079049
548 Ga0207683_10004505
549 Ga0268264_10468427
550 Ga0265336_10026374
551 Ga0307515_10000065
552 Ga0265338_10001322
553 Ga0265338_10035784
554 Ga0265338_10186402
555 Ga0265760_10067556
556 Ga0307408_100142644
557 Ga0307514_10155753
558 Ga0307516_10006600
559 Ga0307410_10027946
560 Ga0307410_10112441
561 Ga0307410_10148547
562 Ga0307410_10269204
563 Ga0307406_10154210
564 Ga0307407_10058299
565 Ga0307409_100085785
566 Ga0307409_100477272
567 Ga0307416_100025971
568 Ga0307416_100065184
569 Ga0307416_100115226
570 Ga0307414_10044880
571 Ga0307415_100049649
572 Ga0307415_100097938
573 Ga0307510_10079080
574 Ga0373930_0053950
575 Ga0373926_0000598
576 Ga0373928_0022353
577 Ga0373944_0000476
578 Ga0373944_0006878
579 Ga0373932_0066975
580 Ga0373936_0000201
581 Ga0373936_0002761
582 Ga0373936_0055486
583 Ga0373941_0061131
584 Ga0373945_0000113
585 Ga0373945_0000170
586 Ga0373953_0024239
587 Ga0373954_0004433
588 Ga0373956_0008614
589 Ga0373960_0026170
590 Ga0373943_0000318
591 Ga0373943_0000529
592 Ga0373946_0000378
593 Ga0373946_0001221
594 Ga0373955_0001184
595 Ga0373942_0013267
596 Ga0373924_0000216
597 Ga0373931_0011694
598 Ga0373935_0003921
599 Ga0373935_0074962
600 Ga0373927_0000893
601 Ga0373927_0014318
602 Ga0373947_0007638
603 Ga0373947_0012573
604 Ga0373937_0031154
605 Ga0373937_0152538
606 Ga0373925_0001109
607 Ga0373925_0033092
608 Ga0373925_0044515
609 Ga0395899_0003706
610 Ga0395900_0077486
611 Ga0395900_0397414
612 Ga0436364_0216354
613 Ga0436364_0440595
614 Ga0436364_0676911
615 Ga0436364_0786308
616 Ga0436364_1205220
617 Ga0436364_1471647
618 Ga0436364_1557168
619 Ga0436364_1562251
620 Ga0395901_0554334
621 Ga0395901_0679217
622 Ga0242420_020342
623 Ga0436365_1751960
624 Ga0436365_1791071
625 Ga0436360_1138901
626 Ga0436363_1598334
627 Ga0451789_0173410
628 Ga0451791_0668625
629 Ga0451843_0403463
630 Ga0451853_4028362
631 Ga0439455_0012428
632 Ga0466966_0063458
633 Ga0466963_0074948
634 Ga0466963_0093424
635 Ga0466963_0131748
636 Ga0466968_0108418
637 Ga0466957_0013274
638 Ga0466957_0038155
639 Ga0466957_0126887
640 Ga0466957_0310615
641 Ga0466960_0016951
642 Ga0466960_0199877
643 Ga0466960_0293593
644 Ga0466958_0010718
645 Ga0466958_0023075
646 Ga0466958_0254336
647 Ga0466967_0030602
648 Ga0466967_0068249
649 Ga0466967_0081075
650 Ga0466967_0090929
651 Ga0466967_0110886
652 Ga0466967_0146197
653 Ga0466967_0240610
654 Ga0466967_0290620
655 Ga0466967_0495009
656 Ga0495592_0100816
657 Ga0495603_0000597
658 Ga0495629_0000371
659 Ga0495651_0008180
660 Ga0495651_0049404
661 Ga0495651_0224632
662 Ga0495653_0011712
663 Ga0495653_0070274
664 Ga0495580_0003938
665 Ga0495582_0005397
666 Ga0495639_0000581
667 Ga0495662_0000105
668 Ga0495662_0033910
669 Ga0495664_0001590
670 Ga0495664_0123554
671 Ga0495608_0010298
672 Ga0495608_0016502
673 Ga0495608_0030431
674 Ga0495608_0263054
675 Ga0495618_0274613
676 Ga0495630_0002619
677 Ga0495630_0004822
678 Ga0495648_0001409
679 Ga0495666_0000671
680 Ga0495652_0043291
681 Ga0495652_0051722
682 Ga0495652_0075304
683 Ga0495654_0039981
684 Ga0495665_0000625
685 Ga0495665_0018050
686 Ga0495640_0001207
687 Ga0495640_0142358
688 Ga0495586_0000778
689 Ga0495587_0020903
690 Ga0495645_0009325
691 Ga0495645_0048019
692 Ga0495645_0281147
693 Ga0495667_0004233
694 Ga0495667_0009116
695 Ga0495667_0011341
696 Ga0495667_0145020
697 Ga0495668_0054495
698 Ga0495634_0003154
699 Ga0495634_0054323
700 Ga0495611_0137911
701 Ga0495635_0004193
702 Ga0495635_0006918
703 Ga0495635_0010202
704 Ga0495588_0086598
705 Ga0495657_0010016
706 Ga0495657_0085470
707 Ga0495599_0004796
708 Ga0495599_0027290
709 Ga0495623_0091475
710 Ga0495646_0045591
711 Ga0495647_0009193
712 Ga0495658_0121735
713 Ga0495658_0222725
714 Ga0495624_0001483
715 Ga0495624_0031649
716 Ga0495624_0194217
717 Ga0495600_0016895
718 Ga0495600_0101441
719 Ga0495581_0000627
720 Ga0495581_0025615
721 Ga0495581_0060022
722 Ga0495604_0043475
723 Ga0495604_0074896
724 Ga0495674_0000545
725 Ga0495674_0014041
726 Ga0495674_0062836
727 Ga0495674_0223567
728 Ga0495672_0002531
729 Ga0495672_0131206
730 Ga0495676_0002281
731 Ga0495676_0003291
732 Ga0495680_0004964
733 Ga0495680_0008845
734 Ga0495680_0020607
735 Ga0495680_0029017
736 Ga0495675_0008800
737 Ga0495673_0000640
738 Ga0495684_0003425
739 Ga0495684_0006574
740 Ga0495684_0009984
741 Ga0495684_0032232
742 Ga0495686_0156397
743 Ga0495593_0166143
744 Ga0495602_0039140
745 Ga0495602_0081744
746 Ga0495602_0118408
747 Ga0495602_0166204
748 Ga0495614_0006598
749 Ga0496100_0356079
750 Ga0496100_0367821
751 Ga0496100_0450984
752 Ga0496101_0089992
753 Ga0496101_0100344
754 Ga0496102_0058422
755 Ga0496102_0266817
756 Ga0496102_0320756
757 Ga0496103_0071011
758 Ga0496104_0027956
759 Ga0496104_0047849
760 Ga0496105_0003831
761 Ga0496105_0120530
762 Ga0496105_0308082
763 Ga0496106_0032937
764 Ga0496106_0258361
765 Ga0496106_0438885
766 Ga0496107_0023017
767 Ga0496108_0339950
768 Ga0496108_0641304
769 Ga0496109_0017984
770 Ga0496109_0108433
771 Ga0496109_0160340
772 Ga0496109_0324107
773 Ga0496110_0016265
774 Ga0496110_0044367
775 Ga0496110_0129778
776 Ga0496111_0005126
777 Ga0496111_0091492
778 Ga0496111_0259652
779 Ga0496112_0085194
780 Ga0496113_0067000
781 Ga0496113_0442732
782 Ga0496114_0047905
783 Ga0496114_0057849
784 Ga0496115_0386434
785 Ga0496121_0029305
786 Ga0501034_0078294
787 Ga0501034_0233630
788 Ga0501038_0307392
789 Ga0501041_0362754
790 Ga0501046_0204061
791 Ga0501047_0040174
792 Ga0501048_0179674
793 Ga0501067_0044588
794 Ga0501067_0118562
795 Ga0501068_0051115
796 Ga0501072_0107194
797 Ga0501076_0279420
798 Ga0501035_0018489
799 Ga0501044_0061432
800 Ga0501212_021656
801 nmdc:mga0yw44_139000_c1
802 nmdc:mga05p37_440726_c1
803 nmdc:mga06r32_65160_c1
804 nmdc:mga08y16_253363_c1
805 nmdc:mga0rr50_272721_c1
806 Ga0495601_0040497
807 Ga0495619_0004629
808 Ga0500641_0033390
809 Ga0500573_0000495
810 Ga0500573_0015536
811 Ga0590071_003630
812 Ga0590074_010123
813 Ga0590075_010106
814 2644228278
815 2729905274
816 2753035512
817 2753326462
818 2868089828
819 2912764500
820 2929214243
821 2939658636
822 2946025657
823 2996222493
824 8055413457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

52

299

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4otk-assembly1.cif.gz_A a structural characterization of the isoniazid mycobacterium tuberculosis drug target, rv2971, in its unliganded form 0.9764 4 274
3wby-assembly2.cif.gz_B crystal structure of gox0644 d53a mutant in complex with nadph 0.9747 2 278
3o0k-assembly3.cif.gz_C crystal structure of aldo/keto reductase from brucella melitensis 0.9704 4 265
2wzm-assembly2.cif.gz_B crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form 0.9695 4 274
3b3d-assembly2.cif.gz_B b.subtilis ytbe 0.9686 5 278
ID Description Score Start End Superfamily
af_Q2G2T8_4_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9725 6 278 3.20.20.100
3wbyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.971 2 278 3.20.20.100
af_Q2FXE2_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.97 6 277 3.20.20.100
2wzmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9695 4 274 3.20.20.100
af_A0A0R0I9K3_1_172_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9646 130 271 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A810DQJ8-F1-model_v4 Glyoxal reductase 0.9844 85 278 GO:0004033
GO:0044281
AF-A0A6G1YQZ6-F1-model_v4 Aldo/keto reductase 0.9828 130 241 GO:0004033
GO:0044281
AF-A0A5C8MFB0-F1-model_v4 Aldo/keto reductase 0.9824 86 274 GO:0004033
GO:0044281
AF-A0A5R2MXH8-F1-model_v4 Aldo/keto reductase 0.9817 155 266 GO:0004033
AF-A0A3M5BI66-F1-model_v4 deleted 0.981 84 278

Map