F437731

General Info

Members Datasets Scaffolds Average Seq Length
412 223 824 353

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100059115|Ga0070708_1000591152
Length 411
Sequence VGEGEKARHPLAPSSPRPLILSNHHGSAICRHGLAIRYTLRALRPGQSSPVLYYLLFPLARRFPLFNVFRYITFRTAMAAVTALLLALVLGPPMIRLLKRRQISQSIREEGPKSHLSKAGTPTMGGLLIHLAVLVATLLWMDLSNRFVWIALATLLALAAVGFADDFVKFARRRSLGLTGRGKLVPQFLVAFLVAWAIGQWAGRGATSTVVTFPFLKRVFLDLGLFYVPFVALVVVGASNAVNLTDGLDGLAIGAVGIAAGTYAILSYVTGNAVAARYLQIPFVAGAGELTVFCGAVVGAALGFLWFNCHPADVFMGDVGSLPLGGVIAAIAVMTKHEMLLAIVGGLFVLEALSVIVQVVSFQSTGRRVFRMAPLHHHFELGGWAESRVIIRFWILAILFAVLGLSTLKLR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
163 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 4.37
Rhizosphere 94.42
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100059115 3300005445 Bacteria 3417
2 Ga0065712_10101377 3300005290 Bacteria 2036
3 Ga0065715_10205107 3300005293 Bacteria 1341
4 Ga0065707_10006153 3300005295 Bacteria 2854
5 Ga0070683_100015996 3300005329 Bacteria 6601
6 Ga0070683_100147956 3300005329 Bacteria 2226
7 Ga0070690_100000226 3300005330 Bacteria 29234
8 Ga0070690_100059000 3300005330 Unclassified 2466
9 Ga0070670_100013441 3300005331 Bacteria 7011
10 Ga0070677_10000894 3300005333 Bacteria 9807
11 Ga0068869_100027359 3300005334 Bacteria 3975
12 Ga0070666_10000121 3300005335 Bacteria 54173
13 Ga0070666_10016266 3300005335 Bacteria 4757
14 Ga0070666_10029269 3300005335 Bacteria 3619
15 Ga0070666_10233347 3300005335 Bacteria 1300
16 Ga0068868_100002188 3300005338 Bacteria 13473
17 Ga0068868_100011306 3300005338 Bacteria 6500
18 Ga0070660_100075694 3300005339 Bacteria 2636
19 Ga0070689_100135682 3300005340 Bacteria 1976
20 Ga0070692_10004001 3300005345 Bacteria 6087
21 Ga0070668_100002552 3300005347 Bacteria 13398
22 Ga0070668_100073029 3300005347 Bacteria 2674
23 Ga0070668_100127902 3300005347 Bacteria 2036
24 Ga0070669_100004069 3300005353 Bacteria 10587
25 Ga0070669_100023990 3300005353 Bacteria 4370
26 Ga0070669_100098033 3300005353 Bacteria 2207
27 Ga0070675_100003554 3300005354 Bacteria 11836
28 Ga0070675_100213282 3300005354 Bacteria 1679
29 Ga0070671_100044995 3300005355 Unclassified 3668
30 Ga0070674_100060575 3300005356 Bacteria 2638
31 Ga0070673_100371594 3300005364 Bacteria 1273
32 Ga0070688_100022254 3300005365 Bacteria 3710
33 Ga0070659_100007887 3300005366 Bacteria 7751
34 Ga0070667_100001566 3300005367 Bacteria 20495
35 Ga0070667_100013433 3300005367 Bacteria 6769
36 Ga0070667_100068091 3300005367 Bacteria 3029
37 Ga0070667_100200483 3300005367 Bacteria 1771
38 Ga0070701_10069824 3300005438 Bacteria 1875
39 Ga0070705_100120158 3300005440 Bacteria 1695
40 Ga0070708_100008168 3300005445 Bacteria 8395
41 Ga0070708_100069093 3300005445 Bacteria 3176
42 Ga0070708_100131266 3300005445 Bacteria 2318
43 Ga0070678_100032199 3300005456 Bacteria 3626
44 Ga0070662_100019656 3300005457 Bacteria 4588
45 Ga0068867_100002419 3300005459 Bacteria 13126
46 Ga0068867_100003842 3300005459 Bacteria 10557
47 Ga0070706_100001285 3300005467 Bacteria 26765
48 Ga0070706_100002015 3300005467 Bacteria 20853
49 Ga0070706_100014413 3300005467 Bacteria 7306
50 Ga0070706_100043206 3300005467 Bacteria 4164
51 Ga0070706_100129902 3300005467 Bacteria 2351
52 Ga0070707_100015656 3300005468 Bacteria 7119
53 Ga0070707_100029824 3300005468 Bacteria 5191
54 Ga0070698_100000228 3300005471 Bacteria 55302
55 Ga0070698_100090969 3300005471 Bacteria 3034
56 Ga0070699_100094116 3300005518 Bacteria 2622
57 Ga0070699_100114702 3300005518 Bacteria 2367
58 Ga0070699_100311589 3300005518 Bacteria 1413
59 Ga0070679_100268899 3300005530 Bacteria 1659
60 Ga0070684_100015543 3300005535 Bacteria 6202
61 Ga0070697_100103080 3300005536 Bacteria 2371
62 Ga0070697_100168507 3300005536 Bacteria 1853
63 Ga0070672_100001290 3300005543 Bacteria 15415
64 Ga0070672_100114092 3300005543 Bacteria 2206
65 Ga0070686_100033722 3300005544 Bacteria 3148
66 Ga0070695_100054114 3300005545 Bacteria 2582
67 Ga0070696_100030633 3300005546 Bacteria 3685
68 Ga0070696_100078035 3300005546 Bacteria 2341
69 Ga0070665_100040202 3300005548 Bacteria 4701
70 Ga0070665_100056975 3300005548 Bacteria 3919
71 Ga0068855_100140850 3300005563 Bacteria 2749
72 Ga0070664_100012791 3300005564 Bacteria 6829
73 Ga0070664_100130308 3300005564 Bacteria 2209
74 Ga0070664_100196323 3300005564 Bacteria 1799
75 Ga0068857_100011915 3300005577 Bacteria 7563
76 Ga0068856_100001423 3300005614 Bacteria 25112
77 Ga0068856_100419018 3300005614 Bacteria 1359
78 Ga0070702_100078020 3300005615 Bacteria 1976
79 Ga0070702_100195689 3300005615 Bacteria 1334
80 Ga0068852_100042032 3300005616 Bacteria 3868
81 Ga0068852_100231903 3300005616 Bacteria 1760
82 Ga0068859_100000557 3300005617 Bacteria 37026
83 Ga0068859_100005279 3300005617 Bacteria 13137
84 Ga0068859_100009220 3300005617 Bacteria 9967
85 Ga0068859_100192291 3300005617 Bacteria 2125
86 Ga0068864_100002377 3300005618 Bacteria 15563
87 Ga0068864_100003985 3300005618 Bacteria 12157
88 Ga0068864_100004584 3300005618 Bacteria 11339
89 Ga0068866_10007381 3300005718 Bacteria 4599
90 Ga0068861_100011465 3300005719 Bacteria 6166
91 Ga0068861_100208568 3300005719 Bacteria 1644
92 Ga0068861_100339886 3300005719 Bacteria 1313
93 Ga0068870_10002965 3300005840 Bacteria 7156
94 Ga0068870_10019113 3300005840 Bacteria 3319
95 Ga0068863_100019105 3300005841 Bacteria 6559
96 Ga0068863_100028333 3300005841 Bacteria 5347
97 Ga0068863_100059405 3300005841 Bacteria 3617
98 Ga0068858_100001113 3300005842 Bacteria 27831
99 Ga0068858_100005998 3300005842 Bacteria 11866
100 Ga0068858_100079873 3300005842 Bacteria 3039
101 Ga0068858_100192605 3300005842 Bacteria 1926
102 Ga0068860_100001040 3300005843 Bacteria 30519
103 Ga0068860_100001631 3300005843 Bacteria 24044
104 Ga0068860_100005809 3300005843 Bacteria 12425
105 Ga0068860_100058272 3300005843 Bacteria 3671
106 Ga0068860_100134205 3300005843 Bacteria 2377
107 Ga0068862_100013095 3300005844 Bacteria 6859
108 Ga0068862_100020220 3300005844 Bacteria 5560
109 Ga0068862_100319722 3300005844 Bacteria 1432
110 Ga0081455_10006267 3300005937 Bacteria 12799
111 Ga0081539_10000666 3300005985 Bacteria 68895
112 Ga0075364_10034346 3300006051 Bacteria 3271
113 Ga0070712_100109623 3300006175 Bacteria 2058
114 Ga0075362_10002620 3300006177 Bacteria 6094
115 Ga0075366_10024372 3300006195 Bacteria 3530
116 Ga0097621_100003493 3300006237 Bacteria 10844
117 Ga0097621_100109971 3300006237 Bacteria 2328
118 Ga0097621_100298612 3300006237 Bacteria 1422
119 Ga0068871_100003478 3300006358 Bacteria 10822
120 Ga0068871_100021312 3300006358 Bacteria 4980
121 Ga0068871_100080489 3300006358 Bacteria 2697
122 Ga0075428_100064296 3300006844 Bacteria 4018
123 Ga0075428_100076774 3300006844 Bacteria 3647
124 Ga0075430_100164262 3300006846 Bacteria 1848
125 Ga0075431_100064448 3300006847 Bacteria 3784
126 Ga0075433_10001168 3300006852 Bacteria 19073
127 Ga0075433_10030789 3300006852 Bacteria 4581
128 Ga0075434_100001601 3300006871 Bacteria 19202
129 Ga0075434_100007807 3300006871 Bacteria 9910
130 Ga0075434_100057366 3300006871 Bacteria 3870
131 Ga0075434_100086107 3300006871 Bacteria 3142
132 Ga0075434_100086815 3300006871 Bacteria 3129
133 Ga0075434_100340960 3300006871 Bacteria 1519
134 Ga0075429_100039165 3300006880 Bacteria 4125
135 Ga0068865_100021085 3300006881 Bacteria 4235
136 Ga0068865_100048437 3300006881 Bacteria 2924
137 Ga0068865_100088639 3300006881 Bacteria 2239
138 Ga0075436_100085076 3300006914 Bacteria 2195
139 Ga0075436_100231343 3300006914 Bacteria 1313
140 Ga0097620_100000557 3300006931 Bacteria 37026
141 Ga0097620_100005279 3300006931 Bacteria 13137
142 Ga0097620_100009220 3300006931 Bacteria 9967
143 Ga0097620_100192289 3300006931 Bacteria 2125
144 Ga0075435_100005233 3300007076 Bacteria 9029
145 Ga0075435_100286674 3300007076 Bacteria 1406
146 Ga0075435_100287635 3300007076 Bacteria 1404
147 Ga0075435_100340332 3300007076 Bacteria 1285
148 Ga0105240_10021507 3300009093 Bacteria 8578
149 Ga0105240_10217973 3300009093 Bacteria 2225
150 Ga0111539_10000602 3300009094 Bacteria 46554
151 Ga0111539_10003359 3300009094 Bacteria 21129
152 Ga0111539_10013605 3300009094 Bacteria 10168
153 Ga0111539_10023181 3300009094 Bacteria 7624
154 Ga0111539_10036481 3300009094 Bacteria 5944
155 Ga0111539_10179889 3300009094 Bacteria 2470
156 Ga0105247_10057236 3300009101 Bacteria 2410
157 Ga0105247_10220120 3300009101 Bacteria 1284
158 Ga0114129_10000047 3300009147 Bacteria 104957
159 Ga0114129_10000551 3300009147 Bacteria 45956
160 Ga0114129_10003876 3300009147 Bacteria 21099
161 Ga0114129_10004401 3300009147 Bacteria 19869
162 Ga0114129_10008072 3300009147 Bacteria 14998
163 Ga0114129_10037167 3300009147 Bacteria 6875
164 Ga0105243_10074365 3300009148 Bacteria 2756
165 Ga0105243_10302657 3300009148 Bacteria 1450
166 Ga0105242_10116767 3300009176 Bacteria 2283
167 Ga0105242_10236481 3300009176 Bacteria 1640
168 Ga0105248_10000975 3300009177 Bacteria 31815
169 Ga0105248_10005765 3300009177 Bacteria 13607
170 Ga0105248_10048718 3300009177 Bacteria 4752
171 Ga0105248_10173742 3300009177 Bacteria 2429
172 Ga0105249_10004028 3300009553 Bacteria 12679
173 Ga0105246_10235442 3300011119 Bacteria 1444
174 Ga0157374_10004184 3300013296 Bacteria 12123
175 Ga0157374_10059715 3300013296 Bacteria 3567
176 Ga0157378_10042880 3300013297 Bacteria 4017
177 Ga0157378_10130262 3300013297 Bacteria 2328
178 Ga0157378_10289001 3300013297 Bacteria 1583
179 Ga0163162_10043297 3300013306 Bacteria 4508
180 Ga0163162_10130576 3300013306 Bacteria 2621
181 Ga0157372_10396886 3300013307 Bacteria 1607
182 Ga0157375_10002402 3300013308 Bacteria 16217
183 Ga0157375_10005626 3300013308 Bacteria 10911
184 Ga0157375_10071186 3300013308 Bacteria 3490
185 Ga0157375_10340128 3300013308 Bacteria 1666
186 Ga0157375_10694108 3300013308 Bacteria 1172
187 Ga0163163_10000071 3300014325 Bacteria 112778
188 Ga0163163_10004527 3300014325 Bacteria 11865
189 Ga0163163_10021673 3300014325 Bacteria 6067
190 Ga0163163_10079173 3300014325 Bacteria 3284
191 Ga0157379_10000375 3300014968 Bacteria 36095
192 Ga0157379_10001051 3300014968 Bacteria 22452
193 Ga0157379_10074287 3300014968 Bacteria 3043
194 Ga0157379_10084895 3300014968 Bacteria 2837
195 Ga0157379_10141199 3300014968 Bacteria 2171
196 Ga0157376_10009377 3300014969 Bacteria 7108
197 Ga0207697_10003277 3300025315 Bacteria 8046
198 Ga0207682_10005827 3300025893 Bacteria 4994
199 Ga0207642_10006772 3300025899 Bacteria 3831
200 Ga0207710_10057607 3300025900 Bacteria 1755
201 Ga0207688_10110036 3300025901 Bacteria 1598
202 Ga0207680_10031524 3300025903 Bacteria 3003
203 Ga0207680_10032464 3300025903 Bacteria 2968
204 Ga0207680_10132987 3300025903 Bacteria 1641
205 Ga0207647_10146034 3300025904 Bacteria 1384
206 Ga0207645_10010790 3300025907 Bacteria 6264
207 Ga0207643_10004267 3300025908 Bacteria 7699
208 Ga0207684_10001309 3300025910 Bacteria 27359
209 Ga0207684_10039811 3300025910 Bacteria 3984
210 Ga0207684_10099773 3300025910 Bacteria 2481
211 Ga0207695_10072219 3300025913 Bacteria 3522
212 Ga0207695_10153043 3300025913 Bacteria 2244
213 Ga0207693_10139852 3300025915 Bacteria 1904
214 Ga0207662_10179240 3300025918 Bacteria 1363
215 Ga0207652_10065844 3300025921 Bacteria 3139
216 Ga0207646_10141603 3300025922 Bacteria 2166
217 Ga0207681_10020557 3300025923 Bacteria 4185
218 Ga0207681_10024730 3300025923 Bacteria 3856
219 Ga0207681_10031633 3300025923 Bacteria 3458
220 Ga0207650_10034169 3300025925 Bacteria 3687
221 Ga0207650_10066333 3300025925 Bacteria 2706
222 Ga0207650_10353298 3300025925 Bacteria 1209
223 Ga0207659_10007908 3300025926 Bacteria 6574
224 Ga0207659_10010551 3300025926 Bacteria 5808
225 Ga0207687_10112637 3300025927 Bacteria 2022
226 Ga0207644_10007205 3300025931 Bacteria 7240
227 Ga0207644_10050209 3300025931 Unclassified 2989
228 Ga0207690_10037729 3300025932 Bacteria 3140
229 Ga0207690_10081197 3300025932 Bacteria 2265
230 Ga0207706_10009678 3300025933 Bacteria 8847
231 Ga0207686_10067240 3300025934 Bacteria 2292
232 Ga0207709_10122877 3300025935 Bacteria 1756
233 Ga0207670_10100252 3300025936 Bacteria 2067
234 Ga0207704_10043667 3300025938 Bacteria 2649
235 Ga0207665_10015788 3300025939 Bacteria 4956
236 Ga0207691_10000980 3300025940 Bacteria 28367
237 Ga0207691_10001362 3300025940 Bacteria 24383
238 Ga0207691_10030404 3300025940 Bacteria 5047
239 Ga0207691_10057990 3300025940 Bacteria 3522
240 Ga0207711_10000989 3300025941 Bacteria 27232
241 Ga0207711_10012750 3300025941 Bacteria 6982
242 Ga0207711_10262148 3300025941 Bacteria 1589
243 Ga0207689_10010260 3300025942 Bacteria 8068
244 Ga0207689_10098034 3300025942 Bacteria 2408
245 Ga0207661_10011976 3300025944 Bacteria 6300
246 Ga0207661_10044999 3300025944 Unclassified 3491
247 Ga0207679_10090048 3300025945 Bacteria 2370
248 Ga0207712_10048298 3300025961 Bacteria 2960
249 Ga0207658_10001747 3300025986 Bacteria 16358
250 Ga0207658_10022906 3300025986 Bacteria 4353
251 Ga0207658_10164993 3300025986 Bacteria 1819
252 Ga0207658_10289419 3300025986 Bacteria 1407
253 Ga0207677_10008427 3300026023 Bacteria 5756
254 Ga0207703_10013393 3300026035 Bacteria 6392
255 Ga0207703_10027496 3300026035 Bacteria 4480
256 Ga0207703_10169028 3300026035 Bacteria 1922
257 Ga0207678_10038653 3300026067 Bacteria 4145
258 Ga0207702_10003969 3300026078 Bacteria 13285
259 Ga0207702_10073122 3300026078 Bacteria 2955
260 Ga0207641_10001027 3300026088 Bacteria 28287
261 Ga0207641_10010782 3300026088 Bacteria 7492
262 Ga0207641_10075342 3300026088 Bacteria 2914
263 Ga0207641_10293422 3300026088 Bacteria 1533
264 Ga0207648_10006411 3300026089 Bacteria 11694
265 Ga0207648_10016430 3300026089 Bacteria 6761
266 Ga0207676_10090053 3300026095 Bacteria 2516
267 Ga0207676_10292211 3300026095 Bacteria 1484
268 Ga0207675_100168094 3300026118 Bacteria 2095
269 Ga0207683_10010118 3300026121 Bacteria 8050
270 Ga0207683_10019872 3300026121 Bacteria 5739
271 Ga0207683_10055724 3300026121 Bacteria 3467
272 Ga0207698_10308933 3300026142 Bacteria 1476
273 Ga0209983_1001114 3300027665 Bacteria 5932
274 Ga0209974_10000056 3300027876 Bacteria 29313
275 Ga0207428_10001302 3300027907 Bacteria 26596
276 Ga0207428_10066035 3300027907 Bacteria 2851
277 Ga0207428_10073156 3300027907 Bacteria 2689
278 Ga0207428_10078239 3300027907 Bacteria 2588
279 Ga0207428_10123567 3300027907 Bacteria 1983
280 Ga0268266_10005028 3300028379 Bacteria 12485
281 Ga0268266_10007138 3300028379 Bacteria 10123
282 Ga0268266_10382339 3300028379 Bacteria 1328
283 Ga0268265_10029278 3300028380 Bacteria 3951
284 Ga0268265_10048256 3300028380 Bacteria 3195
285 Ga0268265_10129276 3300028380 Bacteria 2096
286 Ga0268265_10142823 3300028380 Bacteria 2006
287 Ga0268264_10002455 3300028381 Bacteria 16293
288 Ga0268264_10150404 3300028381 Bacteria 2086
289 Ga0265339_10026208 3300031249 Bacteria 3340
290 Ga0265342_10025386 3300031712 Bacteria 3726
291 Ga0316576_10070655 3300031727 Bacteria 2575
292 Ga0307416_100109326 3300032002 Bacteria 2431
293 Ga0307415_100029277 3300032126 Bacteria 3517
294 Ga0316585_10028324 3300032137 Bacteria 1752
295 Ga0373934_0003036 3300035086 Bacteria 6130
296 Ga0373932_0034822 3300035112 Bacteria 1421
297 Ga0373953_0029325 3300035117 Bacteria 2127
298 Ga0373956_0017720 3300035119 Bacteria 3008
299 Ga0373957_0008974 3300035120 Bacteria 3260
300 Ga0373943_0028649 3300035170 Bacteria 2626
301 Ga0373946_0063331 3300035171 Bacteria 1579
302 Ga0373955_0007321 3300035172 Bacteria 5070
303 Ga0373962_0017266 3300035242 Bacteria 1869
304 Ga0373924_0076540 3300035410 Bacteria 1418
305 Ga0373933_0044297 3300035724 Bacteria 2635
306 Ga0373937_0000553 3300036401 Bacteria 33171
307 Ga0373937_0015240 3300036401 Bacteria 6796
308 Ga0373937_0188261 3300036401 Bacteria 1939
309 Ga0316582_0009097 3300036647 Bacteria 5375
310 Ga0316582_0048411 3300036647 Bacteria 2687
311 Ga0316584_0002238 3300036712 Bacteria 12138
312 Ga0316584_0064273 3300036712 Bacteria 2748
313 Ga0373925_0084208 3300037068 Bacteria 2423
314 Ga0242420_005530 3300038996 Bacteria 1962
315 Ga0439433_0013676 3300041999 Bacteria 1783
316 Ga0439433_0018572 3300041999 Bacteria 1549
317 Ga0439462_0015901 3300042015 Bacteria 1943
318 Ga0450896_000378 3300042133 Bacteria 4427
319 Ga0439435_0007977 3300042436 Bacteria 2445
320 Ga0453683_0038365 3300044673 Bacteria 3012
321 Ga0451576_0009731 3300045051 Bacteria 11116
322 Ga0451576_0026211 3300045051 Bacteria 6271
323 Ga0451576_0127991 3300045051 Bacteria 2646
324 Ga0451576_0337763 3300045051 Bacteria 1577
325 Ga0495603_0056066 3300046455 Bacteria 2334
326 Ga0495653_0013933 3300046463 Bacteria 6556
327 Ga0495580_0000035 3300046472 Bacteria 73832
328 Ga0495580_0066772 3300046472 Bacteria 2517
329 Ga0495639_0063736 3300046475 Bacteria 1693
330 Ga0495662_0037475 3300046476 Bacteria 2342
331 Ga0495628_0037936 3300046516 Bacteria 3861
332 Ga0495643_0005513 3300046522 Bacteria 8540
333 Ga0495633_0040340 3300046558 Bacteria 2225
334 Ga0495599_0108797 3300046678 Bacteria 1727
335 Ga0495647_0007233 3300046681 Bacteria 3714
336 Ga0495647_0071523 3300046681 Bacteria 1389
337 Ga0495602_0029122 3300048088 Bacteria 5270
338 Ga0496100_0008377 3300048903 Bacteria 5764
339 Ga0496101_0001075 3300048904 Bacteria 16188
340 Ga0496101_0094782 3300048904 Bacteria 2225
341 Ga0496102_0050125 3300048905 Bacteria 3800
342 Ga0496102_0264197 3300048905 Bacteria 1622
343 Ga0496103_0145221 3300048906 Bacteria 1518
344 Ga0496103_0181115 3300048906 Bacteria 1354
345 Ga0496104_0002797 3300048907 Bacteria 15033
346 Ga0496105_0113142 3300048908 Bacteria 2240
347 Ga0496106_0001000 3300048909 Bacteria 20656
348 Ga0496106_0035560 3300048909 Bacteria 3725
349 Ga0496107_0000562 3300048910 Bacteria 20773
350 Ga0496107_0033551 3300048910 Bacteria 3673
351 Ga0496109_0024955 3300048912 Bacteria 5322
352 Ga0496110_0242065 3300048913 Bacteria 1641
353 Ga0496112_0367138 3300048915 Bacteria 1381
354 Ga0496114_0013581 3300048917 Bacteria 6532
355 Ga0496114_0212454 3300048917 Bacteria 1697
356 Ga0501036_0015089 3300049572 Bacteria 6448
357 Ga0501040_0000223 3300049576 Bacteria 33236
358 Ga0501041_0000648 3300049577 Bacteria 18262
359 Ga0501042_0012420 3300049578 Bacteria 5770
360 Ga0501043_0022616 3300049579 Bacteria 4929
361 Ga0501046_0002558 3300049580 Bacteria 17022
362 Ga0501047_0137236 3300049581 Bacteria 2326
363 Ga0501048_0014060 3300049582 Bacteria 5932
364 Ga0501048_0201527 3300049582 Bacteria 1411
365 Ga0501069_0087300 3300049585 Bacteria 1762
366 Ga0501072_0063116 3300049588 Bacteria 2922
367 Ga0501074_0043962 3300049590 Bacteria 3234
368 Ga0501075_0000117 3300049591 Bacteria 38564
369 Ga0501075_0109012 3300049591 Bacteria 2105
370 Ga0501076_0000179 3300049592 Bacteria 37508
371 Ga0501079_0005861 3300049741 Bacteria 9193
372 Ga0501080_0055574 3300049742 Bacteria 3688
373 Ga0501081_0000681 3300049743 Bacteria 19567
374 Ga0501045_0083613 3300049824 Bacteria 2355
375 Ga0501045_0105220 3300049824 Bacteria 2091
376 Ga0501045_0260324 3300049824 Bacteria 1291
377 nmdc:mga00v17_84739_c1 3300050491 Bacteria 1984
378 nmdc:mga0k408_23749_c1 3300050493 Bacteria 3462
379 nmdc:mga05p37_136753_c1 3300050507 Bacteria 3004
380 nmdc:mga05p37_180_c1 3300050507 Bacteria 61836
381 nmdc:mga05p37_28845_c1 3300050507 Bacteria 6770
382 nmdc:mga05p37_33311_c1 3300050507 Bacteria 6310
383 nmdc:mga05p37_39442_c1 3300050507 Bacteria 5799
384 nmdc:mga05p37_533566_c1 3300050507 Bacteria 1340
385 nmdc:mga05p37_7608_c1 3300050507 Bacteria 12783
386 nmdc:mga09592_147652_c1 3300050508 Bacteria 2028
387 nmdc:mga06r32_115187_c1 3300050510 Bacteria 2647
388 nmdc:mga06r32_54912_c1 3300050510 Bacteria 3820
389 nmdc:mga08y16_182700_c1 3300050511 Bacteria 2177
390 nmdc:mga08y16_38269_c1 3300050511 Bacteria 5037
391 nmdc:mga08y16_882_c1 3300050511 Bacteria 28902
392 nmdc:mga08y16_9113_c1 3300050511 Bacteria 10420
393 nmdc:mga0n895_18778_c1 3300050512 Bacteria 6407
394 nmdc:mga0n895_2081_c1 3300050512 Bacteria 15412
395 nmdc:mga0n895_86721_c1 3300050512 Bacteria 3127
396 nmdc:mga0n895_88108_c1 3300050512 Bacteria 3103
397 nmdc:mga0rr50_1958_c1 3300050513 Bacteria 11429
398 nmdc:mga0rr50_22186_c1 3300050513 Bacteria 4352
399 nmdc:mga0rr50_276509_c1 3300050513 Bacteria 1400
400 nmdc:mga0rr50_311752_c1 3300050513 Bacteria 1318
401 nmdc:mga08x19_178971_c1 3300050514 Bacteria 1447
402 nmdc:mga08x19_75849_c1 3300050514 Bacteria 2199
403 nmdc:mga0a205_160736_c1 3300050515 Bacteria 2143
404 nmdc:mga0a205_20413_c1 3300050515 Bacteria 6249
405 nmdc:mga0a205_2862_c1 3300050515 Bacteria 15266
406 nmdc:mga0a205_29059_c1 3300050515 Bacteria 5289
407 Ga0495595_0123174 3300053084 Bacteria 1264
408 Ga0495619_0138914 3300053085 Bacteria 1672
409 Ga0501084_0000669 3300054114 Bacteria 26157
410 Ga0501082_0002179 3300060353 Bacteria 17180
411 Ga0501082_0107557 3300060353 Bacteria 2413
412 Ga0530510_0000261 3300061734 Bacteria 33225
413 Ga0070708_100059115
414 Ga0065712_10101377
415 Ga0065715_10205107
416 Ga0065707_10006153
417 Ga0070683_100015996
418 Ga0070683_100147956
419 Ga0070690_100000226
420 Ga0070690_100059000
421 Ga0070670_100013441
422 Ga0070677_10000894
423 Ga0068869_100027359
424 Ga0070666_10000121
425 Ga0070666_10016266
426 Ga0070666_10029269
427 Ga0070666_10233347
428 Ga0068868_100002188
429 Ga0068868_100011306
430 Ga0070660_100075694
431 Ga0070689_100135682
432 Ga0070692_10004001
433 Ga0070668_100002552
434 Ga0070668_100073029
435 Ga0070668_100127902
436 Ga0070669_100004069
437 Ga0070669_100023990
438 Ga0070669_100098033
439 Ga0070675_100003554
440 Ga0070675_100213282
441 Ga0070671_100044995
442 Ga0070674_100060575
443 Ga0070673_100371594
444 Ga0070688_100022254
445 Ga0070659_100007887
446 Ga0070667_100001566
447 Ga0070667_100013433
448 Ga0070667_100068091
449 Ga0070667_100200483
450 Ga0070701_10069824
451 Ga0070705_100120158
452 Ga0070708_100008168
453 Ga0070708_100069093
454 Ga0070708_100131266
455 Ga0070678_100032199
456 Ga0070662_100019656
457 Ga0068867_100002419
458 Ga0068867_100003842
459 Ga0070706_100001285
460 Ga0070706_100002015
461 Ga0070706_100014413
462 Ga0070706_100043206
463 Ga0070706_100129902
464 Ga0070707_100015656
465 Ga0070707_100029824
466 Ga0070698_100000228
467 Ga0070698_100090969
468 Ga0070699_100094116
469 Ga0070699_100114702
470 Ga0070699_100311589
471 Ga0070679_100268899
472 Ga0070684_100015543
473 Ga0070697_100103080
474 Ga0070697_100168507
475 Ga0070672_100001290
476 Ga0070672_100114092
477 Ga0070686_100033722
478 Ga0070695_100054114
479 Ga0070696_100030633
480 Ga0070696_100078035
481 Ga0070665_100040202
482 Ga0070665_100056975
483 Ga0068855_100140850
484 Ga0070664_100012791
485 Ga0070664_100130308
486 Ga0070664_100196323
487 Ga0068857_100011915
488 Ga0068856_100001423
489 Ga0068856_100419018
490 Ga0070702_100078020
491 Ga0070702_100195689
492 Ga0068852_100042032
493 Ga0068852_100231903
494 Ga0068859_100000557
495 Ga0068859_100005279
496 Ga0068859_100009220
497 Ga0068859_100192291
498 Ga0068864_100002377
499 Ga0068864_100003985
500 Ga0068864_100004584
501 Ga0068866_10007381
502 Ga0068861_100011465
503 Ga0068861_100208568
504 Ga0068861_100339886
505 Ga0068870_10002965
506 Ga0068870_10019113
507 Ga0068863_100019105
508 Ga0068863_100028333
509 Ga0068863_100059405
510 Ga0068858_100001113
511 Ga0068858_100005998
512 Ga0068858_100079873
513 Ga0068858_100192605
514 Ga0068860_100001040
515 Ga0068860_100001631
516 Ga0068860_100005809
517 Ga0068860_100058272
518 Ga0068860_100134205
519 Ga0068862_100013095
520 Ga0068862_100020220
521 Ga0068862_100319722
522 Ga0081455_10006267
523 Ga0081539_10000666
524 Ga0075364_10034346
525 Ga0070712_100109623
526 Ga0075362_10002620
527 Ga0075366_10024372
528 Ga0097621_100003493
529 Ga0097621_100109971
530 Ga0097621_100298612
531 Ga0068871_100003478
532 Ga0068871_100021312
533 Ga0068871_100080489
534 Ga0075428_100064296
535 Ga0075428_100076774
536 Ga0075430_100164262
537 Ga0075431_100064448
538 Ga0075433_10001168
539 Ga0075433_10030789
540 Ga0075434_100001601
541 Ga0075434_100007807
542 Ga0075434_100057366
543 Ga0075434_100086107
544 Ga0075434_100086815
545 Ga0075434_100340960
546 Ga0075429_100039165
547 Ga0068865_100021085
548 Ga0068865_100048437
549 Ga0068865_100088639
550 Ga0075436_100085076
551 Ga0075436_100231343
552 Ga0097620_100000557
553 Ga0097620_100005279
554 Ga0097620_100009220
555 Ga0097620_100192289
556 Ga0075435_100005233
557 Ga0075435_100286674
558 Ga0075435_100287635
559 Ga0075435_100340332
560 Ga0105240_10021507
561 Ga0105240_10217973
562 Ga0111539_10000602
563 Ga0111539_10003359
564 Ga0111539_10013605
565 Ga0111539_10023181
566 Ga0111539_10036481
567 Ga0111539_10179889
568 Ga0105247_10057236
569 Ga0105247_10220120
570 Ga0114129_10000047
571 Ga0114129_10000551
572 Ga0114129_10003876
573 Ga0114129_10004401
574 Ga0114129_10008072
575 Ga0114129_10037167
576 Ga0105243_10074365
577 Ga0105243_10302657
578 Ga0105242_10116767
579 Ga0105242_10236481
580 Ga0105248_10000975
581 Ga0105248_10005765
582 Ga0105248_10048718
583 Ga0105248_10173742
584 Ga0105249_10004028
585 Ga0105246_10235442
586 Ga0157374_10004184
587 Ga0157374_10059715
588 Ga0157378_10042880
589 Ga0157378_10130262
590 Ga0157378_10289001
591 Ga0163162_10043297
592 Ga0163162_10130576
593 Ga0157372_10396886
594 Ga0157375_10002402
595 Ga0157375_10005626
596 Ga0157375_10071186
597 Ga0157375_10340128
598 Ga0157375_10694108
599 Ga0163163_10000071
600 Ga0163163_10004527
601 Ga0163163_10021673
602 Ga0163163_10079173
603 Ga0157379_10000375
604 Ga0157379_10001051
605 Ga0157379_10074287
606 Ga0157379_10084895
607 Ga0157379_10141199
608 Ga0157376_10009377
609 Ga0207697_10003277
610 Ga0207682_10005827
611 Ga0207642_10006772
612 Ga0207710_10057607
613 Ga0207688_10110036
614 Ga0207680_10031524
615 Ga0207680_10032464
616 Ga0207680_10132987
617 Ga0207647_10146034
618 Ga0207645_10010790
619 Ga0207643_10004267
620 Ga0207684_10001309
621 Ga0207684_10039811
622 Ga0207684_10099773
623 Ga0207695_10072219
624 Ga0207695_10153043
625 Ga0207693_10139852
626 Ga0207662_10179240
627 Ga0207652_10065844
628 Ga0207646_10141603
629 Ga0207681_10020557
630 Ga0207681_10024730
631 Ga0207681_10031633
632 Ga0207650_10034169
633 Ga0207650_10066333
634 Ga0207650_10353298
635 Ga0207659_10007908
636 Ga0207659_10010551
637 Ga0207687_10112637
638 Ga0207644_10007205
639 Ga0207644_10050209
640 Ga0207690_10037729
641 Ga0207690_10081197
642 Ga0207706_10009678
643 Ga0207686_10067240
644 Ga0207709_10122877
645 Ga0207670_10100252
646 Ga0207704_10043667
647 Ga0207665_10015788
648 Ga0207691_10000980
649 Ga0207691_10001362
650 Ga0207691_10030404
651 Ga0207691_10057990
652 Ga0207711_10000989
653 Ga0207711_10012750
654 Ga0207711_10262148
655 Ga0207689_10010260
656 Ga0207689_10098034
657 Ga0207661_10011976
658 Ga0207661_10044999
659 Ga0207679_10090048
660 Ga0207712_10048298
661 Ga0207658_10001747
662 Ga0207658_10022906
663 Ga0207658_10164993
664 Ga0207658_10289419
665 Ga0207677_10008427
666 Ga0207703_10013393
667 Ga0207703_10027496
668 Ga0207703_10169028
669 Ga0207678_10038653
670 Ga0207702_10003969
671 Ga0207702_10073122
672 Ga0207641_10001027
673 Ga0207641_10010782
674 Ga0207641_10075342
675 Ga0207641_10293422
676 Ga0207648_10006411
677 Ga0207648_10016430
678 Ga0207676_10090053
679 Ga0207676_10292211
680 Ga0207675_100168094
681 Ga0207683_10010118
682 Ga0207683_10019872
683 Ga0207683_10055724
684 Ga0207698_10308933
685 Ga0209983_1001114
686 Ga0209974_10000056
687 Ga0207428_10001302
688 Ga0207428_10066035
689 Ga0207428_10073156
690 Ga0207428_10078239
691 Ga0207428_10123567
692 Ga0268266_10005028
693 Ga0268266_10007138
694 Ga0268266_10382339
695 Ga0268265_10029278
696 Ga0268265_10048256
697 Ga0268265_10129276
698 Ga0268265_10142823
699 Ga0268264_10002455
700 Ga0268264_10150404
701 Ga0265339_10026208
702 Ga0265342_10025386
703 Ga0316576_10070655
704 Ga0307416_100109326
705 Ga0307415_100029277
706 Ga0316585_10028324
707 Ga0373934_0003036
708 Ga0373932_0034822
709 Ga0373953_0029325
710 Ga0373956_0017720
711 Ga0373957_0008974
712 Ga0373943_0028649
713 Ga0373946_0063331
714 Ga0373955_0007321
715 Ga0373962_0017266
716 Ga0373924_0076540
717 Ga0373933_0044297
718 Ga0373937_0000553
719 Ga0373937_0015240
720 Ga0373937_0188261
721 Ga0316582_0009097
722 Ga0316582_0048411
723 Ga0316584_0002238
724 Ga0316584_0064273
725 Ga0373925_0084208
726 Ga0242420_005530
727 Ga0439433_0013676
728 Ga0439433_0018572
729 Ga0439462_0015901
730 Ga0450896_000378
731 Ga0439435_0007977
732 Ga0453683_0038365
733 Ga0451576_0009731
734 Ga0451576_0026211
735 Ga0451576_0127991
736 Ga0451576_0337763
737 Ga0495603_0056066
738 Ga0495653_0013933
739 Ga0495580_0000035
740 Ga0495580_0066772
741 Ga0495639_0063736
742 Ga0495662_0037475
743 Ga0495628_0037936
744 Ga0495643_0005513
745 Ga0495633_0040340
746 Ga0495599_0108797
747 Ga0495647_0007233
748 Ga0495647_0071523
749 Ga0495602_0029122
750 Ga0496100_0008377
751 Ga0496101_0001075
752 Ga0496101_0094782
753 Ga0496102_0050125
754 Ga0496102_0264197
755 Ga0496103_0145221
756 Ga0496103_0181115
757 Ga0496104_0002797
758 Ga0496105_0113142
759 Ga0496106_0001000
760 Ga0496106_0035560
761 Ga0496107_0000562
762 Ga0496107_0033551
763 Ga0496109_0024955
764 Ga0496110_0242065
765 Ga0496112_0367138
766 Ga0496114_0013581
767 Ga0496114_0212454
768 Ga0501036_0015089
769 Ga0501040_0000223
770 Ga0501041_0000648
771 Ga0501042_0012420
772 Ga0501043_0022616
773 Ga0501046_0002558
774 Ga0501047_0137236
775 Ga0501048_0014060
776 Ga0501048_0201527
777 Ga0501069_0087300
778 Ga0501072_0063116
779 Ga0501074_0043962
780 Ga0501075_0000117
781 Ga0501075_0109012
782 Ga0501076_0000179
783 Ga0501079_0005861
784 Ga0501080_0055574
785 Ga0501081_0000681
786 Ga0501045_0083613
787 Ga0501045_0105220
788 Ga0501045_0260324
789 nmdc:mga00v17_84739_c1
790 nmdc:mga0k408_23749_c1
791 nmdc:mga05p37_136753_c1
792 nmdc:mga05p37_180_c1
793 nmdc:mga05p37_28845_c1
794 nmdc:mga05p37_33311_c1
795 nmdc:mga05p37_39442_c1
796 nmdc:mga05p37_533566_c1
797 nmdc:mga05p37_7608_c1
798 nmdc:mga09592_147652_c1
799 nmdc:mga06r32_115187_c1
800 nmdc:mga06r32_54912_c1
801 nmdc:mga08y16_182700_c1
802 nmdc:mga08y16_38269_c1
803 nmdc:mga08y16_882_c1
804 nmdc:mga08y16_9113_c1
805 nmdc:mga0n895_18778_c1
806 nmdc:mga0n895_2081_c1
807 nmdc:mga0n895_86721_c1
808 nmdc:mga0n895_88108_c1
809 nmdc:mga0rr50_1958_c1
810 nmdc:mga0rr50_22186_c1
811 nmdc:mga0rr50_276509_c1
812 nmdc:mga0rr50_311752_c1
813 nmdc:mga08x19_178971_c1
814 nmdc:mga08x19_75849_c1
815 nmdc:mga0a205_160736_c1
816 nmdc:mga0a205_20413_c1
817 nmdc:mga0a205_2862_c1
818 nmdc:mga0a205_29059_c1
819 Ga0495595_0123174
820 Ga0495619_0138914
821 Ga0501084_0000669
822 Ga0501082_0002179
823 Ga0501082_0107557
824 Ga0530510_0000261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10555

MraY_sig1

Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1

118

129

0.97

PF00953

Glycos_transf_4

Glycosyl transferase family 4

148

336

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oz6-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7495 22 327
6oyh-assembly2.cif.gz_C crystal structure of mray bound to carbacaprazamycin 0.7452 20 327
6oyh-assembly4.cif.gz_D crystal structure of mray bound to carbacaprazamycin 0.7441 22 327
8g01-assembly1.cif.gz_E yes complex - e. coli mray, protein e id21, e. coli slyd 0.7415 1 329
8g01-assembly1.cif.gz_E yes complex - e. coli mray, protein e id21, e. coli slyd 0.7395 1 329
ID Description Score Start End Superfamily
af_H2KZQ1_21_234_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2946 23 249 1.20.1250.20
af_H2KZQ1_21_234_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.27 23 249 1.20.1250.20
af_Q03567_11_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2565 30 256 1.20.1250.20
af_Q69JW3_306_526_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2558 30 256 1.20.1250.20
af_Q8IL62_347_573_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2518 3 254 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A353C6Z0-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9234 1 136 GO:0005886
GO:0008963
GO:0044038
GO:0051992
GO:0071555
AF-A0A447TMI9-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9113 1 146 GO:0005524
GO:0008963
GO:0009058
GO:0016020
GO:0016881
GO:0051992
AF-N1UNJ7-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1 0.9094 1 146 GO:0005886
GO:0016780
GO:0044038
GO:0071555
AF-A0A7V7XDZ9-F1-model_v4 deleted 0.905 1 146
AF-A0A800CE25-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase 0.9047 1 138 GO:0005886
GO:0008963
GO:0044038
GO:0071555

Map