F437728

General Info

Members Datasets Scaffolds Average Seq Length
412 230 400 279

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100163622|Ga0070705_1001636222
Length 306
Sequence LEKERCPFAYYTFCLSEFALGWEQHKLSEMNSVQQTSAAARFHSLHESGCFVLPNPWDIGTAIYLERLGFKALATTSAGFAFSRGKPDGGVPRDEMLAHIREIVEATALPVNADFMTGYADEPEGVATNVRLCVATGVAGLSIEDNSQNPAAPLYEKKLAVERIRAARAAIDDSKSGVVLTGRCEAWLVGDRNPLPTALDRLAAYADAGADCLYAPGVSDPNEIAQIVKTVAPKPVNVLVSGFNHQLPLAQLADLGVRRISVGSGLALAAWGAFLRAAKDISANGTFNHLADNASSADLNELFRNK

Samples

Sample ID Description Type Environment
1 2643221733 Bosea sp. Root381 Isolate Unclassified
2 2643221734 Bosea sp. Root670 Isolate Unclassified
3 2643221736 Bosea sp. Root483D1 Isolate Unclassified
4 2818991467 Bosea vestrisii 3192 Isolate Unclassified
5 2841760612 Bosea sp. Tri-49 Isolate Nodule
6 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
7 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
8 2844104063 Bosea sp. Tri-39 Isolate Nodule
9 2851182111 Bosea sp. Tri-44 Isolate Nodule
10 2851246043 Bosea sp. Tri-54 Isolate Nodule
11 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
12 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 0
Isolates 2.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 1.7
Rhizoplane 4.85
Rhizosphere 85.92
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1000546 3300002126 Bacteria 3505
2 JGI25151J46595_10000069 3300003187 Bacteria 139420
3 Ga0055526_1000017 3300003771 Bacteria 210613
4 Ga0055526_1000427 3300003771 Bacteria 33902
5 Ga0055524_1001121 3300003775 Bacteria 16157
6 Ga0055524_1032336 3300003775 Bacteria 1486
7 Ga0065165_1000313 3300005262 Bacteria 79494
8 Ga0065704_10175159 3300005289 Bacteria 1268
9 Ga0065712_10003138 3300005290 Bacteria 5586
10 Ga0065712_10003833 3300005290 Bacteria 3957
11 Ga0065712_10017333 3300005290 Bacteria 2137
12 Ga0065712_10018195 3300005290 Bacteria 2394
13 Ga0065712_10202860 3300005290 Bacteria 1093
14 Ga0065715_10014643 3300005293 Bacteria 2727
15 Ga0065715_10047914 3300005293 Unclassified 1213
16 Ga0065715_10090035 3300005293 Bacteria 7849
17 Ga0065715_10099263 3300005293 Bacteria 3420
18 Ga0065715_10146587 3300005293 Unclassified 1781
19 Ga0065715_10156092 3300005293 Bacteria 1675
20 Ga0065715_10171577 3300005293 Bacteria 1543
21 Ga0065715_10234877 3300005293 Bacteria 1218
22 Ga0065707_10111524 3300005295 Bacteria 2392
23 Ga0070683_100162329 3300005329 Unclassified 2120
24 Ga0070683_100343018 3300005329 Bacteria 1422
25 Ga0070683_100641949 3300005329 Bacteria 1016
26 Ga0070690_100032354 3300005330 Unclassified 3266
27 Ga0070670_100400130 3300005331 Unclassified 1212
28 Ga0070666_10103026 3300005335 Bacteria 1969
29 Ga0070680_100470583 3300005336 Bacteria 1074
30 Ga0070682_100177298 3300005337 Unclassified 1486
31 Ga0068868_100088133 3300005338 Bacteria 2497
32 Ga0068868_100312165 3300005338 Bacteria 1338
33 Ga0070689_100080326 3300005340 Bacteria 2559
34 Ga0070689_100171218 3300005340 Bacteria 1759
35 Ga0070689_100356110 3300005340 Bacteria 1229
36 Ga0070661_100332126 3300005344 Bacteria 1189
37 Ga0070675_100051180 3300005354 Bacteria 3394
38 Ga0070675_100193283 3300005354 Bacteria 1764
39 Ga0070671_100121190 3300005355 Bacteria 2201
40 Ga0070673_100007657 3300005364 Bacteria 7143
41 Ga0070673_100043789 3300005364 Unclassified 3462
42 Ga0070673_100241517 3300005364 Bacteria 1571
43 Ga0070673_100293636 3300005364 Bacteria 1429
44 Ga0070688_100011821 3300005365 Bacteria 4867
45 Ga0070667_100047769 3300005367 Bacteria 3602
46 Ga0070709_10009826 3300005434 Bacteria 5286
47 Ga0070709_10091151 3300005434 Bacteria 2011
48 Ga0070709_10122698 3300005434 Bacteria 1763
49 Ga0070714_100033717 3300005435 Unclassified 4283
50 Ga0070713_100011423 3300005436 Bacteria 6468
51 Ga0070713_100034397 3300005436 Bacteria 4070
52 Ga0070710_10018825 3300005437 Bacteria 3558
53 Ga0070711_100077408 3300005439 Bacteria 2360
54 Ga0070705_100163622 3300005440 Bacteria 1490
55 Ga0070694_100044968 3300005444 Unclassified 2957
56 Ga0070694_100061392 3300005444 Bacteria 2565
57 Ga0070694_100078445 3300005444 Bacteria 2291
58 Ga0070694_100103187 3300005444 Unclassified 2020
59 Ga0070708_100119129 3300005445 Bacteria 2433
60 Ga0070708_100494754 3300005445 Bacteria 1153
61 Ga0070708_100526523 3300005445 Unclassified 1115
62 Ga0070678_100089287 3300005456 Bacteria 2358
63 Ga0070678_100103919 3300005456 Bacteria 2208
64 Ga0070681_10550013 3300005458 Bacteria 1068
65 Ga0068867_100090710 3300005459 Unclassified 2319
66 Ga0068867_100560091 3300005459 Bacteria 991
67 Ga0070685_10002216 3300005466 Bacteria 10022
68 Ga0070685_10073065 3300005466 Bacteria 2037
69 Ga0070706_100120994 3300005467 Bacteria 2440
70 Ga0070706_100150116 3300005467 Unclassified 2175
71 Ga0070706_100169827 3300005467 Unclassified 2036
72 Ga0070707_100003316 3300005468 Bacteria 15205
73 Ga0070707_100031968 3300005468 Bacteria 5014
74 Ga0070707_100118295 3300005468 Bacteria 2572
75 Ga0070707_100378285 3300005468 Unclassified 1376
76 Ga0070707_100410287 3300005468 Bacteria 1315
77 Ga0070707_100429733 3300005468 Unclassified 1281
78 Ga0070698_100002293 3300005471 Bacteria 21174
79 Ga0070698_100018666 3300005471 Bacteria 7300
80 Ga0070698_100073388 3300005471 Bacteria 3428
81 Ga0070699_100440050 3300005518 Bacteria 1181
82 Ga0070679_100280020 3300005530 Unclassified 1620
83 Ga0070697_100035405 3300005536 Bacteria 4027
84 Ga0070697_100079123 3300005536 Bacteria 2706
85 Ga0070697_100106963 3300005536 Bacteria 2327
86 Ga0070672_100121683 3300005543 Bacteria 2137
87 Ga0070686_100018034 3300005544 Bacteria 4136
88 Ga0070686_100033734 3300005544 Bacteria 3147
89 Ga0070695_100000047 3300005545 Bacteria 47076
90 Ga0070695_100114255 3300005545 Bacteria 1838
91 Ga0070665_100038126 3300005548 Unclassified 4831
92 Ga0070665_100160836 3300005548 Unclassified 2248
93 Ga0070665_100165944 3300005548 Bacteria 2210
94 Ga0068854_100100918 3300005578 Bacteria 2164
95 Ga0068854_100193424 3300005578 Bacteria 1595
96 Ga0068856_100080967 3300005614 Bacteria 3221
97 Ga0068856_100270351 3300005614 Bacteria 1716
98 Ga0068859_100023259 3300005617 Bacteria 6218
99 Ga0068859_100103079 3300005617 Unclassified 2911
100 Ga0068859_100339281 3300005617 Bacteria 1597
101 Ga0068859_100651268 3300005617 Bacteria 1145
102 Ga0068864_100046459 3300005618 Unclassified 3725
103 Ga0068864_100176299 3300005618 Bacteria 1952
104 Ga0068866_10013786 3300005718 Bacteria 3554
105 Ga0068861_100005495 3300005719 Bacteria 8590
106 Ga0068858_100095028 3300005842 Bacteria 2777
107 Ga0081455_10000821 3300005937 Bacteria 39932
108 Ga0081455_10001298 3300005937 Bacteria 31030
109 Ga0081455_10008534 3300005937 Bacteria 10635
110 Ga0081455_10013325 3300005937 Bacteria 8135
111 Ga0081540_1001338 3300005983 Bacteria 21463
112 Ga0081539_10000491 3300005985 Bacteria 83392
113 Ga0081539_10005204 3300005985 Bacteria 13486
114 Ga0070717_10040498 3300006028 Unclassified 3795
115 Ga0070717_10096137 3300006028 Bacteria 2508
116 Ga0070717_10182355 3300006028 Unclassified 1831
117 Ga0075365_10184796 3300006038 Bacteria 1458
118 Ga0070716_100101449 3300006173 Bacteria 1765
119 Ga0070716_100308284 3300006173 Unclassified 1104
120 Ga0070712_100318811 3300006175 Unclassified 1263
121 Ga0097621_100007550 3300006237 Bacteria 7787
122 Ga0097621_100133008 3300006237 Bacteria 2119
123 Ga0097621_100201372 3300006237 Bacteria 1728
124 Ga0097621_100442822 3300006237 Bacteria 1169
125 Ga0068871_100005360 3300006358 Bacteria 8987
126 Ga0068871_100062483 3300006358 Bacteria 3044
127 Ga0068871_100430555 3300006358 Bacteria 1179
128 Ga0075428_100281630 3300006844 Unclassified 1789
129 Ga0075433_10058614 3300006852 Bacteria 3368
130 Ga0075434_100153889 3300006871 Bacteria 2319
131 Ga0075434_100251334 3300006871 Bacteria 1787
132 Ga0075429_100087527 3300006880 Bacteria 2715
133 Ga0068865_100021961 3300006881 Bacteria 4156
134 Ga0068865_100495460 3300006881 Bacteria 1018
135 Ga0097620_100023259 3300006931 Bacteria 6218
136 Ga0097620_100103081 3300006931 Unclassified 2911
137 Ga0097620_100339273 3300006931 Bacteria 1597
138 Ga0097620_100651266 3300006931 Bacteria 1145
139 Ga0075435_100470198 3300007076 Bacteria 1085
140 Ga0105245_10311588 3300009098 Bacteria 1548
141 Ga0105247_10015072 3300009101 Bacteria 4636
142 Ga0114129_10007513 3300009147 Bacteria 15525
143 Ga0105241_10013096 3300009174 Bacteria 6083
144 Ga0105242_10002005 3300009176 Bacteria 16032
145 Ga0105242_10028237 3300009176 Unclassified 4465
146 Ga0105248_10009581 3300009177 Bacteria 10660
147 Ga0105248_10036754 3300009177 Bacteria 5477
148 Ga0105248_10477554 3300009177 Bacteria 1405
149 Ga0105238_10337390 3300009551 Bacteria 1495
150 Ga0105249_10035564 3300009553 Bacteria 4517
151 Ga0105249_10686824 3300009553 Unclassified 1083
152 Ga0105249_10846004 3300009553 Unclassified 980
153 Ga0105239_10510600 3300010375 Bacteria 1367
154 Ga0105246_10006703 3300011119 Bacteria 7039
155 Ga0105246_10143629 3300011119 Bacteria 1798
156 Ga0157373_10269220 3300013100 Bacteria 1206
157 Ga0157371_10216377 3300013102 Bacteria 1375
158 Ga0157369_10167356 3300013105 Bacteria 2317
159 Ga0171462_1008 3300013250 Bacteria 384318
160 Ga0157374_10028151 3300013296 Bacteria 5075
161 Ga0157374_10046088 3300013296 Bacteria 4036
162 Ga0157374_10069488 3300013296 Bacteria 3316
163 Ga0157374_10076620 3300013296 Unclassified 3162
164 Ga0157374_10108942 3300013296 Bacteria 2662
165 Ga0157374_10217681 3300013296 Unclassified 1873
166 Ga0157374_10460793 3300013296 Unclassified 1273
167 Ga0157374_10859995 3300013296 Unclassified 924
168 Ga0157378_10013357 3300013297 Bacteria 7178
169 Ga0157378_10013952 3300013297 Bacteria 7028
170 Ga0157378_10034697 3300013297 Bacteria 4461
171 Ga0157378_10042315 3300013297 Bacteria 4043
172 Ga0157378_10050093 3300013297 Unclassified 3716
173 Ga0157378_10130963 3300013297 Unclassified 2322
174 Ga0157378_10131364 3300013297 Unclassified 2318
175 Ga0157378_10460267 3300013297 Bacteria 1264
176 Ga0163162_10013449 3300013306 Bacteria 7988
177 Ga0163162_10014033 3300013306 Bacteria 7830
178 Ga0163162_10014522 3300013306 Bacteria 7695
179 Ga0163162_10032721 3300013306 Bacteria 5164
180 Ga0163162_10075081 3300013306 Bacteria 3440
181 Ga0163162_10101562 3300013306 Bacteria 2968
182 Ga0157375_10031008 3300013308 Bacteria 5047
183 Ga0157375_10034452 3300013308 Bacteria 4824
184 Ga0157375_10065687 3300013308 Bacteria 3617
185 Ga0163163_10001701 3300014325 Bacteria 18589
186 Ga0163163_10003216 3300014325 Bacteria 13838
187 Ga0163163_10479830 3300014325 Unclassified 1304
188 Ga0157380_10087700 3300014326 Bacteria 2559
189 Ga0157380_10578536 3300014326 Bacteria 1107
190 Ga0157379_10272708 3300014968 Bacteria 1539
191 Ga0157379_10362311 3300014968 Bacteria 1329
192 Ga0157376_10108490 3300014969 Bacteria 2439
193 Ga0163161_10010192 3300017792 Bacteria 6506
194 Ga0207666_1000060 3300025271 Bacteria 19738
195 Ga0209130_1000209 3300025284 Bacteria 78300
196 Ga0207673_1000335 3300025290 Unclassified 4734
197 Ga0209675_1000307 3300025291 Bacteria 44268
198 Ga0209676_1032274 3300025292 Bacteria 1577
199 Ga0209025_1000008 3300025294 Bacteria 1130876
200 Ga0209025_1003608 3300025294 Bacteria 14413
201 Ga0209025_1042591 3300025294 Bacteria 1926
202 Ga0209564_1000015 3300025295 Bacteria 615324
203 Ga0209564_1000031 3300025295 Bacteria 494703
204 Ga0209256_1000205 3300025299 Bacteria 111530
205 Ga0209256_1001439 3300025299 Bacteria 24645
206 Ga0207697_10003946 3300025315 Bacteria 7213
207 Ga0207697_10005547 3300025315 Bacteria 5849
208 Ga0207697_10011128 3300025315 Bacteria 3814
209 Ga0207692_10010977 3300025898 Bacteria 3834
210 Ga0207710_10014535 3300025900 Bacteria 3321
211 Ga0207699_10022654 3300025906 Unclassified 3407
212 Ga0207699_10024024 3300025906 Bacteria 3327
213 Ga0207684_10004029 3300025910 Bacteria 14037
214 Ga0207684_10177501 3300025910 Unclassified 1836
215 Ga0207684_10458754 3300025910 Unclassified 1094
216 Ga0207707_10060246 3300025912 Bacteria 3302
217 Ga0207707_10201361 3300025912 Bacteria 1736
218 Ga0207707_10434159 3300025912 Bacteria 1125
219 Ga0207693_10012349 3300025915 Bacteria 6901
220 Ga0207693_10067067 3300025915 Unclassified 2810
221 Ga0207693_10072899 3300025915 Bacteria 2688
222 Ga0207693_10080537 3300025915 Bacteria 2549
223 Ga0207663_10128846 3300025916 Unclassified 1745
224 Ga0207663_10181358 3300025916 Unclassified 1504
225 Ga0207662_10046472 3300025918 Bacteria 2568
226 Ga0207652_10404202 3300025921 Unclassified 1232
227 Ga0207646_10003977 3300025922 Bacteria 16388
228 Ga0207646_10073586 3300025922 Unclassified 3052
229 Ga0207646_10184638 3300025922 Unclassified 1883
230 Ga0207646_10198732 3300025922 Bacteria 1811
231 Ga0207646_10219428 3300025922 Bacteria 1718
232 Ga0207646_10306798 3300025922 Unclassified 1434
233 Ga0207659_10093976 3300025926 Bacteria 2246
234 Ga0207659_10441549 3300025926 Bacteria 1095
235 Ga0207687_10440978 3300025927 Unclassified 1078
236 Ga0207700_10009849 3300025928 Bacteria 5996
237 Ga0207664_10287734 3300025929 Unclassified 1443
238 Ga0207644_10004708 3300025931 Bacteria 8865
239 Ga0207644_10076031 3300025931 Unclassified 2469
240 Ga0207644_10091235 3300025931 Bacteria 2271
241 Ga0207644_10191601 3300025931 Bacteria 1608
242 Ga0207706_10114235 3300025933 Bacteria 2375
243 Ga0207686_10000244 3300025934 Bacteria 41692
244 Ga0207686_10121827 3300025934 Bacteria 1776
245 Ga0207670_10092322 3300025936 Bacteria 2143
246 Ga0207665_10104800 3300025939 Bacteria 1980
247 Ga0207665_10237085 3300025939 Bacteria 1343
248 Ga0207665_10315129 3300025939 Unclassified 1172
249 Ga0207691_10530506 3300025940 Bacteria 999
250 Ga0207711_10028347 3300025941 Unclassified 4711
251 Ga0207711_10031977 3300025941 Bacteria 4446
252 Ga0207711_10237068 3300025941 Bacteria 1672
253 Ga0207689_10016790 3300025942 Bacteria 6197
254 Ga0207689_10098570 3300025942 Unclassified 2401
255 Ga0207661_10057364 3300025944 Bacteria 3131
256 Ga0207661_10593826 3300025944 Bacteria 1016
257 Ga0207651_10127922 3300025960 Bacteria 1939
258 Ga0207651_10137344 3300025960 Bacteria 1882
259 Ga0207651_10359498 3300025960 Bacteria 1228
260 Ga0207640_10253641 3300025981 Bacteria 1367
261 Ga0207658_10203826 3300025986 Unclassified 1653
262 Ga0207677_10008053 3300026023 Bacteria 5869
263 Ga0207677_10226515 3300026023 Bacteria 1503
264 Ga0207678_10033490 3300026067 Unclassified 4475
265 Ga0207641_10076627 3300026088 Bacteria 2891
266 Ga0207641_10234321 3300026088 Bacteria 1708
267 Ga0207648_10177482 3300026089 Bacteria 1884
268 Ga0207676_10014860 3300026095 Bacteria 5608
269 Ga0207676_10035265 3300026095 Bacteria 3795
270 Ga0207675_100008831 3300026118 Bacteria 9457
271 Ga0207675_100021542 3300026118 Bacteria 6003
272 Ga0207683_10285209 3300026121 Bacteria 1509
273 Ga0209974_10041030 3300027876 Bacteria 1541
274 Ga0209974_10073867 3300027876 Unclassified 1166
275 Ga0268266_10062448 3300028379 Bacteria 3215
276 Ga0268266_10483407 3300028379 Unclassified 1181
277 Ga0265338_10113002 3300028800 Bacteria 2183
278 Ga0265325_10000034 3300031241 Bacteria 99371
279 Ga0307513_10061415 3300031456 Bacteria 3979
280 Ga0265313_10014189 3300031595 Bacteria 4724
281 Ga0307508_10087222 3300031616 Bacteria 2705
282 Ga0316575_10130269 3300031665 Bacteria 1032
283 Ga0307409_100601593 3300031995 Bacteria 1087
284 Ga0373944_0020982 3300035089 Bacteria 1887
285 Ga0373936_0049119 3300035113 Bacteria 1704
286 Ga0373953_0023538 3300035117 Bacteria 2332
287 Ga0373956_0032151 3300035119 Bacteria 2301
288 Ga0373955_0002392 3300035172 Bacteria 8177
289 Ga0373961_0000331 3300035241 Bacteria 20829
290 Ga0316574_0042245 3300035398 Bacteria 2812
291 Ga0373924_0068552 3300035410 Bacteria 1493
292 Ga0373931_0135618 3300035691 Unclassified 1421
293 Ga0373935_0010471 3300035692 Bacteria 5563
294 Ga0373935_0093198 3300035692 Bacteria 1975
295 Ga0373935_0097104 3300035692 Bacteria 1937
296 Ga0373935_0100131 3300035692 Bacteria 1909
297 Ga0373935_0463244 3300035692 Bacteria 917
298 Ga0373927_0087162 3300035695 Bacteria 2027
299 Ga0373947_0065766 3300035725 Bacteria 2212
300 Ga0373947_0139788 3300035725 Bacteria 1552
301 Ga0373937_0009476 3300036401 Bacteria 8464
302 Ga0373937_0436483 3300036401 Bacteria 1243
303 Ga0373925_0010358 3300037068 Bacteria 6765
304 Ga0373925_0043005 3300037068 Bacteria 3352
305 Ga0373925_0139853 3300037068 Bacteria 1894
306 Ga0395900_0003404 3300037418 Bacteria 17183
307 Ga0395900_0330334 3300037418 Unclassified 1503
308 Ga0395900_0388677 3300037418 Unclassified 1362
309 Ga0395898_0002466 3300037466 Bacteria 21819
310 Ga0395898_0434612 3300037466 Bacteria 1251
311 Ga0395905_0006324 3300037471 Bacteria 11938
312 Ga0395901_0009278 3300038443 Bacteria 9974
313 Ga0395901_0276716 3300038443 Unclassified 1745
314 Ga0451837_1021094 3300041494 Bacteria 1001
315 Ga0466963_0096728 3300044694 Bacteria 2017
316 Ga0466967_0063337 3300045976 Unclassified 3286
317 Ga0495592_0007319 3300046454 Bacteria 8256
318 Ga0495592_0029596 3300046454 Bacteria 4147
319 Ga0495592_0030759 3300046454 Bacteria 4061
320 Ga0495603_0000724 3300046455 Bacteria 18727
321 Ga0495629_0000719 3300046459 Bacteria 26837
322 Ga0495651_0012492 3300046462 Bacteria 6550
323 Ga0495651_0013744 3300046462 Bacteria 6259
324 Ga0495653_0249321 3300046463 Bacteria 1179
325 Ga0495582_0049370 3300046473 Bacteria 2317
326 Ga0495662_0165931 3300046476 Bacteria 1088
327 Ga0495664_0025537 3300046477 Bacteria 3440
328 Ga0495664_0029615 3300046477 Bacteria 3203
329 Ga0495608_0025947 3300046511 Bacteria 4000
330 Ga0495610_0033559 3300046512 Bacteria 2652
331 Ga0495628_0007599 3300046516 Bacteria 9369
332 Ga0495652_0044983 3300046529 Bacteria 3799
333 Ga0495640_0215821 3300046533 Bacteria 1211
334 Ga0495587_0026604 3300046536 Bacteria 3527
335 Ga0495645_0024294 3300046543 Bacteria 4396
336 Ga0495667_0030069 3300046559 Bacteria 3652
337 Ga0495667_0308130 3300046559 Unclassified 1003
338 Ga0495634_0137471 3300046642 Bacteria 1554
339 Ga0495635_0031653 3300046663 Bacteria 3671
340 Ga0495635_0031898 3300046663 Bacteria 3656
341 Ga0495657_0027472 3300046675 Bacteria 4015
342 Ga0495657_0082183 3300046675 Bacteria 2082
343 Ga0495599_0010664 3300046678 Bacteria 5625
344 Ga0495623_0010359 3300046679 Bacteria 6036
345 Ga0495623_0047573 3300046679 Bacteria 2723
346 Ga0495658_0000263 3300046683 Bacteria 29804
347 Ga0495613_0003749 3300046689 Bacteria 11390
348 Ga0495600_0006193 3300046809 Bacteria 7256
349 Ga0495581_0008547 3300047315 Bacteria 5935
350 Ga0495604_0011060 3300047317 Bacteria 7162
351 Ga0495604_0035957 3300047317 Bacteria 3907
352 Ga0495674_0053634 3300047319 Bacteria 3543
353 Ga0495674_0062783 3300047319 Bacteria 3234
354 Ga0495676_0075662 3300047321 Bacteria 2574
355 Ga0495680_0000064 3300047322 Bacteria 89681
356 Ga0495684_0138269 3300047471 Bacteria 1827
357 Ga0495614_0089209 3300048089 Bacteria 1340
358 Ga0496101_0022463 3300048904 Bacteria 4343
359 Ga0496104_0000317 3300048907 Bacteria 42918
360 Ga0496104_0060353 3300048907 Bacteria 3593
361 Ga0496104_0078119 3300048907 Bacteria 3154
362 Ga0496104_0292198 3300048907 Bacteria 1542
363 Ga0496105_0000485 3300048908 Bacteria 26121
364 Ga0496108_0341843 3300048911 Bacteria 1306
365 Ga0496108_0474412 3300048911 Bacteria 1093
366 Ga0496109_0268568 3300048912 Bacteria 1607
367 Ga0496109_0277880 3300048912 Bacteria 1578
368 Ga0496112_0050740 3300048915 Unclassified 4069
369 Ga0496112_0056393 3300048915 Bacteria 3866
370 Ga0496114_0000008 3300048917 Bacteria 420692
371 Ga0496114_0087395 3300048917 Unclassified 2643
372 Ga0496114_0125518 3300048917 Unclassified 2212
373 Ga0496114_0126742 3300048917 Bacteria 2201
374 Ga0496114_0189119 3300048917 Unclassified 1801
375 Ga0496115_0065627 3300048918 Bacteria 2932
376 Ga0496115_0071695 3300048918 Bacteria 2810
377 Ga0496115_0104961 3300048918 Unclassified 2319
378 Ga0496117_0077094 3300048920 Bacteria 2207
379 Ga0496120_0131522 3300048923 Bacteria 1281
380 Ga0496122_0039648 3300048925 Bacteria 3753
381 Ga0496126_0140098 3300048929 Bacteria 2083
382 Ga0501034_0378784 3300049571 Bacteria 1340
383 Ga0501225_0009710 3300049705 Bacteria 2737
384 nmdc:mga05p37_217458_c2 3300050507 Bacteria 1757
385 nmdc:mga05p37_550693_c1 3300050507 Unclassified 1313
386 nmdc:mga05p37_67109_c1 3300050507 Bacteria 4413
387 nmdc:mga09592_118341_c1 3300050508 Bacteria 2274
388 nmdc:mga0n895_124440_c1 3300050512 Unclassified 2601
389 nmdc:mga0n895_310851_c1 3300050512 Bacteria 1597
390 nmdc:mga0a205_173767_c1 3300050515 Bacteria 2050
391 nmdc:mga0a205_213847_c1 3300050515 Bacteria 1815
392 nmdc:mga0sz30_84784_c1 3300050516 Bacteria 1374
393 Ga0495601_0000521 3300053077 Bacteria 20312
394 Ga0495601_0135892 3300053077 Bacteria 1603
395 Ga0495612_0002143 3300053078 Bacteria 8120
396 Ga0495619_0005497 3300053085 Bacteria 8037
397 Ga0495619_0072690 3300053085 Bacteria 2303
398 Ga0495619_0262071 3300053085 Unclassified 1198
399 Ga0500639_094513 3300053163 Bacteria 1483
400 Ga0500636_0009252 3300053177 Bacteria 5727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10061415 Ga0307513_100614153 245
2 iso_pu_bacteria 2851182111 2851186396 250
3 3300035398 Ga0316574_0042245 Ga0316574_0042245_1684_2511 253
4 3300005293 Ga0065715_10099263 Ga0065715_100992633 255
5 3300005329 Ga0070683_100162329 Ga0070683_1001623293 255
6 3300005364 Ga0070673_100043789 Ga0070673_1000437894 255
7 3300005614 Ga0068856_100080967 Ga0068856_1000809671 255
8 3300006028 Ga0070717_10040498 Ga0070717_100404981 255
9 3300006175 Ga0070712_100318811 Ga0070712_1003188111 255
10 3300025315 Ga0207697_10003946 Ga0207697_100039462 255
11 3300025906 Ga0207699_10022654 Ga0207699_100226543 255
12 3300025915 Ga0207693_10012349 Ga0207693_100123492 255
13 3300025928 Ga0207700_10009849 Ga0207700_100098492 255
14 3300025929 Ga0207664_10287734 Ga0207664_102877342 255
15 3300025960 Ga0207651_10127922 Ga0207651_101279223 255
16 3300026067 Ga0207678_10033490 Ga0207678_100334903 255
17 3300035725 Ga0373947_0065766 Ga0373947_0065766_1426_2193 255
18 3300006028 Ga0070717_10182355 Ga0070717_101823553 256
19 3300013297 Ga0157378_10034697 Ga0157378_100346974 256
20 3300025912 Ga0207707_10201361 Ga0207707_102013612 256
21 3300027876 Ga0209974_10041030 Ga0209974_100410302 256
22 3300005444 Ga0070694_100061392 Ga0070694_1000613922 261
23 3300005295 Ga0065707_10111524 Ga0065707_101115245 263
24 3300005467 Ga0070706_100169827 Ga0070706_1001698272 263
25 3300005471 Ga0070698_100002293 Ga0070698_10000229314 263
26 3300005548 Ga0070665_100160836 Ga0070665_1001608362 263
27 3300005983 Ga0081540_1001338 Ga0081540_100133818 263
28 3300025315 Ga0207697_10005547 Ga0207697_100055474 263
29 3300025915 Ga0207693_10072899 Ga0207693_100728992 263
30 3300005466 Ga0070685_10002216 Ga0070685_1000221611 264
31 3300050512 nmdc:mga0n895_310851_c1 nmdc:mga0n895_310851_c1_572_1384 268
32 3300005937 Ga0081455_10008534 Ga0081455_1000853415 269
33 3300005617 Ga0068859_100103079 Ga0068859_1001030794 270
34 3300006931 Ga0097620_100103081 Ga0097620_1001030814 270
35 3300025941 Ga0207711_10028347 Ga0207711_100283476 270
36 3300049705 Ga0501225_0009710 Ga0501225_0009710_836_1657 270
37 iso_pu_bacteria 2643221733 2644730119 270
38 iso_pu_bacteria 2643221734 2644737115 270
39 iso_pu_bacteria 2643221736 2644746183 270
40 iso_pu_bacteria 2818991467 2819720017 270
41 iso_pu_bacteria 2841760612 2841766131 270
42 iso_pu_bacteria 2841911363 2841911476 270
43 iso_pu_bacteria 2841917233 2841917939 270
44 iso_pu_bacteria 2844104063 2844105897 270
45 iso_pu_bacteria 2851246043 2851246253 270
46 iso_pu_bacteria 2917699015 2917703986 270
47 iso_pu_bacteria 8057529695 8057531521 270
48 3300031665 Ga0316575_10130269 Ga0316575_101302691 271
49 3300006880 Ga0075429_100087527 Ga0075429_1000875272 272
50 3300031616 Ga0307508_10087222 Ga0307508_100872222 272
51 3300035692 Ga0373935_0097104 Ga0373935_0097104_398_1222 272
52 3300044694 Ga0466963_0096728 Ga0466963_0096728_179_1015 272
53 3300050508 nmdc:mga09592_118341_c1 nmdc:mga09592_118341_c1_784_1635 272
54 3300053163 Ga0500639_094513 Ga0500639_094513_25_861 272
55 3300005444 Ga0070694_100078445 Ga0070694_1000784452 273
56 3300005444 Ga0070694_100103187 Ga0070694_1001031872 273
57 3300005467 Ga0070706_100150116 Ga0070706_1001501161 273
58 3300005468 Ga0070707_100378285 Ga0070707_1003782852 273
59 3300005471 Ga0070698_100073388 Ga0070698_1000733882 273
60 3300005545 Ga0070695_100000047 Ga0070695_10000004713 273
61 3300005617 Ga0068859_100339281 Ga0068859_1003392812 273
62 3300005719 Ga0068861_100005495 Ga0068861_1000054958 273
63 3300005985 Ga0081539_10000491 Ga0081539_1000049131 273
64 3300006173 Ga0070716_100101449 Ga0070716_1001014492 273
65 3300006173 Ga0070716_100308284 Ga0070716_1003082842 273
66 3300006852 Ga0075433_10058614 Ga0075433_100586142 273
67 3300006931 Ga0097620_100339273 Ga0097620_1003392731 273
68 3300009174 Ga0105241_10013096 Ga0105241_100130966 273
69 3300013100 Ga0157373_10269220 Ga0157373_102692202 273
70 3300025922 Ga0207646_10198732 Ga0207646_101987322 273
71 3300025939 Ga0207665_10104800 Ga0207665_101048002 273
72 3300026118 Ga0207675_100008831 Ga0207675_1000088316 273
73 3300037466 Ga0395898_0434612 Ga0395898_0434612_286_1113 273
74 3300048907 Ga0496104_0060353 Ga0496104_0060353_1579_2406 273
75 3300050515 nmdc:mga0a205_213847_c1 nmdc:mga0a205_213847_c1_774_1601 273
76 3300003187 JGI25151J46595_10000069 JGI25151J46595_100000693 274
77 3300003771 Ga0055526_1000017 Ga0055526_100001742 274
78 3300003771 Ga0055526_1000427 Ga0055526_100042736 274
79 3300003775 Ga0055524_1001121 Ga0055524_100112111 274
80 3300003775 Ga0055524_1032336 Ga0055524_10323361 274
81 3300005262 Ga0065165_1000313 Ga0065165_100031345 274
82 3300005329 Ga0070683_100641949 Ga0070683_1006419491 274
83 3300005578 Ga0068854_100193424 Ga0068854_1001934241 274
84 3300006038 Ga0075365_10184796 Ga0075365_101847962 274
85 3300006844 Ga0075428_100281630 Ga0075428_1002816302 274
86 3300006871 Ga0075434_100153889 Ga0075434_1001538892 274
87 3300013250 Ga0171462_1008 Ga0171462_1008341 274
88 3300013296 Ga0157374_10460793 Ga0157374_104607932 274
89 3300025284 Ga0209130_1000209 Ga0209130_100020928 274
90 3300025291 Ga0209675_1000307 Ga0209675_100030725 274
91 3300025292 Ga0209676_1032274 Ga0209676_10322741 274
92 3300025294 Ga0209025_1000008 Ga0209025_100000867 274
93 3300025294 Ga0209025_1003608 Ga0209025_100360813 274
94 3300025294 Ga0209025_1042591 Ga0209025_10425912 274
95 3300025295 Ga0209564_1000015 Ga0209564_1000015122 274
96 3300025295 Ga0209564_1000031 Ga0209564_1000031165 274
97 3300025299 Ga0209256_1000205 Ga0209256_10002058 274
98 3300025299 Ga0209256_1001439 Ga0209256_10014392 274
99 3300025944 Ga0207661_10593826 Ga0207661_105938261 274
100 3300025981 Ga0207640_10253641 Ga0207640_102536411 274
101 3300035691 Ga0373931_0135618 Ga0373931_0135618_540_1364 274
102 3300041494 Ga0451837_1021094 Ga0451837_1021094_13_852 274
103 3300048920 Ga0496117_0077094 Ga0496117_0077094_1228_2067 274
104 3300048923 Ga0496120_0131522 Ga0496120_0131522_208_1047 274
105 3300048925 Ga0496122_0039648 Ga0496122_0039648_2355_3194 274
106 3300048929 Ga0496126_0140098 Ga0496126_0140098_1137_1976 274
107 3300049571 Ga0501034_0378784 Ga0501034_0378784_423_1262 274
108 3300050507 nmdc:mga05p37_550693_c1 nmdc:mga05p37_550693_c1_397_1221 274
109 3300050512 nmdc:mga0n895_124440_c1 nmdc:mga0n895_124440_c1_368_1192 274
110 3300050516 nmdc:mga0sz30_84784_c1 nmdc:mga0sz30_84784_c1_321_1160 274
111 3300005434 Ga0070709_10091151 Ga0070709_100911513 275
112 3300005434 Ga0070709_10122698 Ga0070709_101226983 275
113 3300005436 Ga0070713_100034397 Ga0070713_1000343974 275
114 3300005437 Ga0070710_10018825 Ga0070710_100188252 275
115 3300005439 Ga0070711_100077408 Ga0070711_1000774083 275
116 3300005458 Ga0070681_10550013 Ga0070681_105500131 275
117 3300005468 Ga0070707_100410287 Ga0070707_1004102871 275
118 3300005536 Ga0070697_100079123 Ga0070697_1000791231 275
119 3300005544 Ga0070686_100033734 Ga0070686_1000337341 275
120 3300006028 Ga0070717_10096137 Ga0070717_100961372 275
121 3300006871 Ga0075434_100251334 Ga0075434_1002513342 275
122 3300009553 Ga0105249_10686824 Ga0105249_106868241 275
123 3300013296 Ga0157374_10859995 Ga0157374_108599951 275
124 3300013297 Ga0157378_10131364 Ga0157378_101313642 275
125 3300013306 Ga0163162_10013449 Ga0163162_100134493 275
126 3300014325 Ga0163163_10003216 Ga0163163_100032162 275
127 3300014326 Ga0157380_10087700 Ga0157380_100877002 275
128 3300025898 Ga0207692_10010977 Ga0207692_100109773 275
129 3300025906 Ga0207699_10024024 Ga0207699_100240242 275
130 3300025912 Ga0207707_10434159 Ga0207707_104341591 275
131 3300025915 Ga0207693_10080537 Ga0207693_100805373 275
132 3300025922 Ga0207646_10219428 Ga0207646_102194281 275
133 3300025931 Ga0207644_10191601 Ga0207644_101916012 275
134 3300028800 Ga0265338_10113002 Ga0265338_101130022 275
135 3300031241 Ga0265325_10000034 Ga0265325_1000003445 275
136 3300031595 Ga0265313_10014189 Ga0265313_100141891 275
137 3300031995 Ga0307409_100601593 Ga0307409_1006015931 275
138 3300035089 Ga0373944_0020982 Ga0373944_0020982_123_962 275
139 3300035113 Ga0373936_0049119 Ga0373936_0049119_123_962 275
140 3300035117 Ga0373953_0023538 Ga0373953_0023538_719_1558 275
141 3300035119 Ga0373956_0032151 Ga0373956_0032151_597_1436 275
142 3300035172 Ga0373955_0002392 Ga0373955_0002392_3383_4222 275
143 3300035410 Ga0373924_0068552 Ga0373924_0068552_119_958 275
144 3300035692 Ga0373935_0100131 Ga0373935_0100131_123_962 275
145 3300035725 Ga0373947_0139788 Ga0373947_0139788_542_1381 275
146 3300036401 Ga0373937_0009476 Ga0373937_0009476_7425_8264 275
147 3300037068 Ga0373925_0010358 Ga0373925_0010358_3936_4775 275
148 3300046454 Ga0495592_0007319 Ga0495592_0007319_5618_6457 275
149 3300046459 Ga0495629_0000719 Ga0495629_0000719_19695_20537 275
150 3300046462 Ga0495651_0013744 Ga0495651_0013744_1338_2177 275
151 3300046463 Ga0495653_0249321 Ga0495653_0249321_168_1007 275
152 3300046473 Ga0495582_0049370 Ga0495582_0049370_1435_2277 275
153 3300046476 Ga0495662_0165931 Ga0495662_0165931_64_906 275
154 3300046477 Ga0495664_0025537 Ga0495664_0025537_2414_3253 275
155 3300046511 Ga0495608_0025947 Ga0495608_0025947_751_1590 275
156 3300046516 Ga0495628_0007599 Ga0495628_0007599_3593_4432 275
157 3300046529 Ga0495652_0044983 Ga0495652_0044983_2813_3652 275
158 3300046536 Ga0495587_0026604 Ga0495587_0026604_1254_2093 275
159 3300046543 Ga0495645_0024294 Ga0495645_0024294_2358_3197 275
160 3300046559 Ga0495667_0030069 Ga0495667_0030069_1565_2404 275
161 3300046642 Ga0495634_0137471 Ga0495634_0137471_321_1160 275
162 3300046663 Ga0495635_0031653 Ga0495635_0031653_1986_2825 275
163 3300046663 Ga0495635_0031898 Ga0495635_0031898_2348_3190 275
164 3300046675 Ga0495657_0027472 Ga0495657_0027472_87_926 275
165 3300046678 Ga0495599_0010664 Ga0495599_0010664_2839_3678 275
166 3300046679 Ga0495623_0010359 Ga0495623_0010359_1009_1848 275
167 3300046683 Ga0495658_0000263 Ga0495658_0000263_14236_15078 275
168 3300046689 Ga0495613_0003749 Ga0495613_0003749_6255_7097 275
169 3300046809 Ga0495600_0006193 Ga0495600_0006193_1435_2274 275
170 3300047315 Ga0495581_0008547 Ga0495581_0008547_3129_3971 275
171 3300047317 Ga0495604_0035957 Ga0495604_0035957_864_1703 275
172 3300047319 Ga0495674_0053634 Ga0495674_0053634_93_932 275
173 3300047321 Ga0495676_0075662 Ga0495676_0075662_1578_2420 275
174 3300047322 Ga0495680_0000064 Ga0495680_0000064_18737_19579 275
175 3300047471 Ga0495684_0138269 Ga0495684_0138269_475_1314 275
176 3300048089 Ga0495614_0089209 Ga0495614_0089209_69_911 275
177 3300048907 Ga0496104_0000317 Ga0496104_0000317_35228_36067 275
178 3300048908 Ga0496105_0000485 Ga0496105_0000485_17233_18072 275
179 3300048917 Ga0496114_0126742 Ga0496114_0126742_33_872 275
180 3300048918 Ga0496115_0065627 Ga0496115_0065627_2081_2920 275
181 3300053077 Ga0495601_0000521 Ga0495601_0000521_1132_1971 275
182 3300053077 Ga0495601_0135892 Ga0495601_0135892_592_1431 275
183 3300053078 Ga0495612_0002143 Ga0495612_0002143_2415_3254 275
184 3300053085 Ga0495619_0005497 Ga0495619_0005497_6814_7656 275
185 3300053085 Ga0495619_0072690 Ga0495619_0072690_1200_2039 275
186 3300005289 Ga0065704_10175159 Ga0065704_101751591 276
187 3300005290 Ga0065712_10003833 Ga0065712_100038332 276
188 3300005290 Ga0065712_10202860 Ga0065712_102028601 276
189 3300005293 Ga0065715_10014643 Ga0065715_100146435 276
190 3300005293 Ga0065715_10047914 Ga0065715_100479141 276
191 3300005293 Ga0065715_10090035 Ga0065715_100900356 276
192 3300005331 Ga0070670_100400130 Ga0070670_1004001301 276
193 3300005335 Ga0070666_10103026 Ga0070666_101030263 276
194 3300005336 Ga0070680_100470583 Ga0070680_1004705832 276
195 3300005337 Ga0070682_100177298 Ga0070682_1001772981 276
196 3300005338 Ga0068868_100088133 Ga0068868_1000881332 276
197 3300005344 Ga0070661_100332126 Ga0070661_1003321261 276
198 3300005354 Ga0070675_100193283 Ga0070675_1001932831 276
199 3300005364 Ga0070673_100293636 Ga0070673_1002936361 276
200 3300005367 Ga0070667_100047769 Ga0070667_1000477694 276
201 3300005434 Ga0070709_10009826 Ga0070709_100098261 276
202 3300005435 Ga0070714_100033717 Ga0070714_1000337173 276
203 3300005436 Ga0070713_100011423 Ga0070713_1000114234 276
204 3300005440 Ga0070705_100163622 Ga0070705_1001636222 276
205 3300005445 Ga0070708_100119129 Ga0070708_1001191292 276
206 3300005445 Ga0070708_100526523 Ga0070708_1005265231 276
207 3300005459 Ga0068867_100090710 Ga0068867_1000907102 276
208 3300005459 Ga0068867_100560091 Ga0068867_1005600911 276
209 3300005468 Ga0070707_100031968 Ga0070707_1000319687 276
210 3300005468 Ga0070707_100429733 Ga0070707_1004297331 276
211 3300005530 Ga0070679_100280020 Ga0070679_1002800203 276
212 3300005548 Ga0070665_100038126 Ga0070665_1000381262 276
213 3300005617 Ga0068859_100023259 Ga0068859_1000232597 276
214 3300005618 Ga0068864_100046459 Ga0068864_1000464593 276
215 3300005842 Ga0068858_100095028 Ga0068858_1000950283 276
216 3300005985 Ga0081539_10005204 Ga0081539_100052044 276
217 3300006237 Ga0097621_100007550 Ga0097621_1000075507 276
218 3300006237 Ga0097621_100133008 Ga0097621_1001330082 276
219 3300006358 Ga0068871_100005360 Ga0068871_1000053607 276
220 3300006358 Ga0068871_100062483 Ga0068871_1000624833 276
221 3300006931 Ga0097620_100023259 Ga0097620_1000232593 276
222 3300009098 Ga0105245_10311588 Ga0105245_103115882 276
223 3300009176 Ga0105242_10002005 Ga0105242_1000200519 276
224 3300009176 Ga0105242_10028237 Ga0105242_100282374 276
225 3300009177 Ga0105248_10009581 Ga0105248_100095815 276
226 3300011119 Ga0105246_10143629 Ga0105246_101436292 276
227 3300013105 Ga0157369_10167356 Ga0157369_101673562 276
228 3300013296 Ga0157374_10028151 Ga0157374_100281513 276
229 3300013296 Ga0157374_10069488 Ga0157374_100694884 276
230 3300013296 Ga0157374_10217681 Ga0157374_102176812 276
231 3300013297 Ga0157378_10013952 Ga0157378_100139526 276
232 3300013297 Ga0157378_10050093 Ga0157378_100500932 276
233 3300013297 Ga0157378_10460267 Ga0157378_104602672 276
234 3300013306 Ga0163162_10014522 Ga0163162_100145226 276
235 3300013308 Ga0157375_10034452 Ga0157375_100344521 276
236 3300014325 Ga0163163_10001701 Ga0163163_1000170113 276
237 3300014325 Ga0163163_10479830 Ga0163163_104798302 276
238 3300014968 Ga0157379_10362311 Ga0157379_103623112 276
239 3300014969 Ga0157376_10108490 Ga0157376_101084902 276
240 3300017792 Ga0163161_10010192 Ga0163161_100101926 276
241 3300025910 Ga0207684_10458754 Ga0207684_104587541 276
242 3300025912 Ga0207707_10060246 Ga0207707_100602462 276
243 3300025915 Ga0207693_10067067 Ga0207693_100670672 276
244 3300025916 Ga0207663_10181358 Ga0207663_101813581 276
245 3300025921 Ga0207652_10404202 Ga0207652_104042021 276
246 3300025922 Ga0207646_10184638 Ga0207646_101846381 276
247 3300025922 Ga0207646_10306798 Ga0207646_103067982 276
248 3300025927 Ga0207687_10440978 Ga0207687_104409781 276
249 3300025931 Ga0207644_10076031 Ga0207644_100760312 276
250 3300025934 Ga0207686_10000244 Ga0207686_1000024450 276
251 3300025934 Ga0207686_10121827 Ga0207686_101218272 276
252 3300025939 Ga0207665_10237085 Ga0207665_102370852 276
253 3300025939 Ga0207665_10315129 Ga0207665_103151291 276
254 3300025941 Ga0207711_10237068 Ga0207711_102370682 276
255 3300025942 Ga0207689_10098570 Ga0207689_100985701 276
256 3300025960 Ga0207651_10359498 Ga0207651_103594981 276
257 3300025986 Ga0207658_10203826 Ga0207658_102038262 276
258 3300026023 Ga0207677_10008053 Ga0207677_100080536 276
259 3300026088 Ga0207641_10234321 Ga0207641_102343212 276
260 3300026089 Ga0207648_10177482 Ga0207648_101774822 276
261 3300026095 Ga0207676_10014860 Ga0207676_100148606 276
262 3300027876 Ga0209974_10073867 Ga0209974_100738672 276
263 3300028379 Ga0268266_10483407 Ga0268266_104834072 276
264 3300035241 Ga0373961_0000331 Ga0373961_0000331_5236_6093 276
265 3300035692 Ga0373935_0093198 Ga0373935_0093198_953_1786 276
266 3300035692 Ga0373935_0463244 Ga0373935_0463244_14_844 276
267 3300035695 Ga0373927_0087162 Ga0373927_0087162_513_1346 276
268 3300036401 Ga0373937_0436483 Ga0373937_0436483_22_867 276
269 3300037068 Ga0373925_0043005 Ga0373925_0043005_1595_2428 276
270 3300046559 Ga0495667_0308130 Ga0495667_0308130_101_931 276
271 3300046675 Ga0495657_0082183 Ga0495657_0082183_883_1713 276
272 3300048904 Ga0496101_0022463 Ga0496101_0022463_294_1124 276
273 3300048907 Ga0496104_0078119 Ga0496104_0078119_656_1486 276
274 3300048911 Ga0496108_0474412 Ga0496108_0474412_52_882 276
275 3300048912 Ga0496109_0268568 Ga0496109_0268568_668_1498 276
276 3300048915 Ga0496112_0050740 Ga0496112_0050740_2030_2860 276
277 3300048917 Ga0496114_0087395 Ga0496114_0087395_1633_2463 276
278 3300048918 Ga0496115_0104961 Ga0496115_0104961_474_1304 276
279 3300053085 Ga0495619_0262071 Ga0495619_0262071_327_1157 276
280 3300005293 Ga0065715_10146587 Ga0065715_101465871 277
281 3300005293 Ga0065715_10171577 Ga0065715_101715772 277
282 3300005444 Ga0070694_100044968 Ga0070694_1000449684 277
283 3300005445 Ga0070708_100494754 Ga0070708_1004947541 277
284 3300005467 Ga0070706_100120994 Ga0070706_1001209942 277
285 3300005468 Ga0070707_100003316 Ga0070707_10000331615 277
286 3300005468 Ga0070707_100118295 Ga0070707_1001182952 277
287 3300005471 Ga0070698_100018666 Ga0070698_1000186664 277
288 3300005518 Ga0070699_100440050 Ga0070699_1004400501 277
289 3300005536 Ga0070697_100035405 Ga0070697_1000354053 277
290 3300005545 Ga0070695_100114255 Ga0070695_1001142551 277
291 3300005618 Ga0068864_100176299 Ga0068864_1001762992 277
292 3300005937 Ga0081455_10000821 Ga0081455_1000082131 277
293 3300005937 Ga0081455_10001298 Ga0081455_1000129834 277
294 3300005937 Ga0081455_10013325 Ga0081455_1001332510 277
295 3300006881 Ga0068865_100495460 Ga0068865_1004954601 277
296 3300007076 Ga0075435_100470198 Ga0075435_1004701981 277
297 3300009147 Ga0114129_10007513 Ga0114129_100075137 277
298 3300009553 Ga0105249_10846004 Ga0105249_108460041 277
299 3300013296 Ga0157374_10046088 Ga0157374_100460882 277
300 3300013297 Ga0157378_10013357 Ga0157378_100133575 277
301 3300013297 Ga0157378_10130963 Ga0157378_101309632 277
302 3300013306 Ga0163162_10101562 Ga0163162_101015623 277
303 3300013308 Ga0157375_10065687 Ga0157375_100656874 277
304 3300025910 Ga0207684_10004029 Ga0207684_100040294 277
305 3300025910 Ga0207684_10177501 Ga0207684_101775012 277
306 3300025916 Ga0207663_10128846 Ga0207663_101288462 277
307 3300025922 Ga0207646_10003977 Ga0207646_1000397711 277
308 3300025922 Ga0207646_10073586 Ga0207646_100735863 277
309 3300025931 Ga0207644_10004708 Ga0207644_100047087 277
310 3300035692 Ga0373935_0010471 Ga0373935_0010471_2166_2999 277
311 3300037068 Ga0373925_0139853 Ga0373925_0139853_427_1260 277
312 3300037418 Ga0395900_0003404 Ga0395900_0003404_7121_8032 277
313 3300037418 Ga0395900_0330334 Ga0395900_0330334_103_939 277
314 3300037418 Ga0395900_0388677 Ga0395900_0388677_269_1105 277
315 3300037466 Ga0395898_0002466 Ga0395898_0002466_12476_13387 277
316 3300037471 Ga0395905_0006324 Ga0395905_0006324_10352_11188 277
317 3300038443 Ga0395901_0009278 Ga0395901_0009278_7121_8032 277
318 3300038443 Ga0395901_0276716 Ga0395901_0276716_676_1512 277
319 3300048917 Ga0496114_0000008 Ga0496114_0000008_344926_345774 277
320 3300050507 nmdc:mga05p37_67109_c1 nmdc:mga05p37_67109_c1_3262_4098 277
321 3300009101 Ga0105247_10015072 Ga0105247_100150723 278
322 3300025900 Ga0207710_10014535 Ga0207710_100145352 278
323 3300005290 Ga0065712_10017333 Ga0065712_100173332 279
324 3300005293 Ga0065715_10234877 Ga0065715_102348771 279
325 3300005340 Ga0070689_100171218 Ga0070689_1001712182 279
326 3300005364 Ga0070673_100241517 Ga0070673_1002415171 279
327 3300005456 Ga0070678_100103919 Ga0070678_1001039192 279
328 3300005536 Ga0070697_100106963 Ga0070697_1001069632 279
329 3300005544 Ga0070686_100018034 Ga0070686_1000180344 279
330 3300005578 Ga0068854_100100918 Ga0068854_1001009183 279
331 3300005617 Ga0068859_100651268 Ga0068859_1006512681 279
332 3300005718 Ga0068866_10013786 Ga0068866_100137863 279
333 3300006237 Ga0097621_100201372 Ga0097621_1002013723 279
334 3300006358 Ga0068871_100430555 Ga0068871_1004305552 279
335 3300006881 Ga0068865_100021961 Ga0068865_1000219612 279
336 3300006931 Ga0097620_100651266 Ga0097620_1006512661 279
337 3300009177 Ga0105248_10036754 Ga0105248_100367545 279
338 3300009553 Ga0105249_10035564 Ga0105249_100355644 279
339 3300011119 Ga0105246_10006703 Ga0105246_100067037 279
340 3300013296 Ga0157374_10076620 Ga0157374_100766205 279
341 3300013306 Ga0163162_10032721 Ga0163162_100327214 279
342 3300014326 Ga0157380_10578536 Ga0157380_105785361 279
343 3300025918 Ga0207662_10046472 Ga0207662_100464723 279
344 3300025926 Ga0207659_10441549 Ga0207659_104415491 279
345 3300025942 Ga0207689_10016790 Ga0207689_100167901 279
346 3300026088 Ga0207641_10076627 Ga0207641_100766274 279
347 3300026095 Ga0207676_10035265 Ga0207676_100352655 279
348 3300026118 Ga0207675_100021542 Ga0207675_1000215426 279
349 3300046512 Ga0495610_0033559 Ga0495610_0033559_183_1037 279
350 3300053177 Ga0500636_0009252 Ga0500636_0009252_3049_3903 279
351 3300009177 Ga0105248_10477554 Ga0105248_104775542 281
352 3300013306 Ga0163162_10014033 Ga0163162_100140334 281
353 3300014968 Ga0157379_10272708 Ga0157379_102727082 281
354 3300025941 Ga0207711_10031977 Ga0207711_100319771 281
355 3300046454 Ga0495592_0029596 Ga0495592_0029596_379_1251 281
356 3300046454 Ga0495592_0030759 Ga0495592_0030759_2093_2959 281
357 3300046455 Ga0495603_0000724 Ga0495603_0000724_13745_14623 281
358 3300046462 Ga0495651_0012492 Ga0495651_0012492_2539_3405 281
359 3300046477 Ga0495664_0029615 Ga0495664_0029615_1625_2491 281
360 3300046533 Ga0495640_0215821 Ga0495640_0215821_96_962 281
361 3300046679 Ga0495623_0047573 Ga0495623_0047573_1367_2233 281
362 3300047317 Ga0495604_0011060 Ga0495604_0011060_2289_3155 281
363 3300047319 Ga0495674_0062783 Ga0495674_0062783_332_1198 281
364 3300048907 Ga0496104_0292198 Ga0496104_0292198_426_1292 281
365 3300048917 Ga0496114_0125518 Ga0496114_0125518_1178_2044 281
366 3300048918 Ga0496115_0071695 Ga0496115_0071695_1557_2423 281
367 3300002126 JGI24035J26624_1000546 JGI24035J26624_10005462 282
368 3300005290 Ga0065712_10003138 Ga0065712_100031388 282
369 3300005290 Ga0065712_10018195 Ga0065712_100181952 282
370 3300005293 Ga0065715_10156092 Ga0065715_101560921 282
371 3300005329 Ga0070683_100343018 Ga0070683_1003430181 282
372 3300005330 Ga0070690_100032354 Ga0070690_1000323541 282
373 3300005338 Ga0068868_100312165 Ga0068868_1003121652 282
374 3300005340 Ga0070689_100080326 Ga0070689_1000803262 282
375 3300005340 Ga0070689_100356110 Ga0070689_1003561101 282
376 3300005354 Ga0070675_100051180 Ga0070675_1000511803 282
377 3300005355 Ga0070671_100121190 Ga0070671_1001211902 282
378 3300005364 Ga0070673_100007657 Ga0070673_1000076579 282
379 3300005365 Ga0070688_100011821 Ga0070688_1000118213 282
380 3300005456 Ga0070678_100089287 Ga0070678_1000892871 282
381 3300005466 Ga0070685_10073065 Ga0070685_100730652 282
382 3300005543 Ga0070672_100121683 Ga0070672_1001216831 282
383 3300005548 Ga0070665_100165944 Ga0070665_1001659442 282
384 3300005614 Ga0068856_100270351 Ga0068856_1002703512 282
385 3300006237 Ga0097621_100442822 Ga0097621_1004428221 282
386 3300009551 Ga0105238_10337390 Ga0105238_103373902 282
387 3300010375 Ga0105239_10510600 Ga0105239_105106001 282
388 3300013102 Ga0157371_10216377 Ga0157371_102163772 282
389 3300013296 Ga0157374_10108942 Ga0157374_101089423 282
390 3300013297 Ga0157378_10042315 Ga0157378_100423152 282
391 3300013306 Ga0163162_10075081 Ga0163162_100750811 282
392 3300013308 Ga0157375_10031008 Ga0157375_100310083 282
393 3300025271 Ga0207666_1000060 Ga0207666_100006018 282
394 3300025290 Ga0207673_1000335 Ga0207673_10003353 282
395 3300025315 Ga0207697_10011128 Ga0207697_100111282 282
396 3300025926 Ga0207659_10093976 Ga0207659_100939762 282
397 3300025931 Ga0207644_10091235 Ga0207644_100912352 282
398 3300025933 Ga0207706_10114235 Ga0207706_101142353 282
399 3300025936 Ga0207670_10092322 Ga0207670_100923222 282
400 3300025940 Ga0207691_10530506 Ga0207691_105305061 282
401 3300025944 Ga0207661_10057364 Ga0207661_100573643 282
402 3300025960 Ga0207651_10137344 Ga0207651_101373442 282
403 3300026023 Ga0207677_10226515 Ga0207677_102265151 282
404 3300026121 Ga0207683_10285209 Ga0207683_102852092 282
405 3300028379 Ga0268266_10062448 Ga0268266_100624483 282
406 3300045976 Ga0466967_0063337 Ga0466967_0063337_2317_3168 282
407 3300048911 Ga0496108_0341843 Ga0496108_0341843_413_1261 282
408 3300048912 Ga0496109_0277880 Ga0496109_0277880_319_1167 282
409 3300048915 Ga0496112_0056393 Ga0496112_0056393_1586_2434 282
410 3300048917 Ga0496114_0189119 Ga0496114_0189119_205_1053 282
411 3300050507 nmdc:mga05p37_217458_c2 nmdc:mga05p37_217458_c2_697_1548 282
412 3300050515 nmdc:mga0a205_173767_c1 nmdc:mga0a205_173767_c1_474_1325 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

42

282

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9784 4 274
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9746 3 273
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9506 4 274
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9402 3 273
4mg4-assembly1.cif.gz_A crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9125 5 250
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9759 3 233 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9676 3 233 3.20.20.60
4lsbB02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.939 236 273 6.10.250.2750
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9381 4 233 3.20.20.60
4lsbA02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9363 236 274 6.10.250.2750
ID Description Score Start End GO Terms
AF-A0A7W1YYI0-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9973 3 274 GO:0016829
AF-A0A2V6EBL6-F1-model_v4 2-methylisocitrate lyase 0.9967 1 274 GO:0016829
AF-A0A2V6MCM0-F1-model_v4 2-methylisocitrate lyase 0.9967 16 273 GO:0016829
AF-A0A7V9ZD53-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9964 4 275 GO:0016829
AF-A0A2V5JFE8-F1-model_v4 2-methylisocitrate lyase 0.995 113 274 GO:0016829

Feature Viewer

pLDDT pTM Quality
94.75 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map