F437481

General Info

Members Datasets Scaffolds Average Seq Length
411 213 411 171

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10001629|Ga0081539_100016297
Length 200
Sequence MSEEQRDIPKEHPEILKGQREIPNAVPRLPVDGRKPGGFVRRLLIVALRLALIVSLVGAGWLVYRQLPVTSSSLITDSRGKTNLQIVLRQPDGGGPALDVDISLFPVDLVAVRHEYFSEPRAGKRLEDFLKERMKGRTPVSTRLDKQGHGSVVLPPGSWWLLAKLSGDEELEWRLPVTVAGANQVIELTPQNAYTRSKTF

Samples

Sample ID Description Type Environment
1 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
163 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
164 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
165 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
166 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
167 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
171 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
172 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
173 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
177 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
178 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
179 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
180 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
181 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
182 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
185 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
186 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
189 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
193 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
194 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
195 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
196 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
197 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
198 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
199 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
200 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
201 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
202 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.43
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1002455 3300000531 Bacteria 1022
2 JGI24751J29686_10000013 3300002459 Bacteria 113565
3 rootH2_10224229 3300003320 Bacteria 1830
4 Ga0065704_10005075 3300005289 Unclassified 4976
5 Ga0065712_10012337 3300005290 Bacteria 2975
6 Ga0065715_10013179 3300005293 Bacteria 1915
7 Ga0065715_10113603 3300005293 Bacteria 2483
8 Ga0070676_10659575 3300005328 Unclassified 760
9 Ga0070670_100032480 3300005331 Bacteria 4496
10 Ga0070670_101167004 3300005331 Bacteria 703
11 Ga0068869_100022585 3300005334 Bacteria 4337
12 Ga0068869_100247540 3300005334 Bacteria 1422
13 Ga0070680_100000139 3300005336 Bacteria 44398
14 Ga0070689_100000520 3300005340 Bacteria 22774
15 Ga0070687_100111651 3300005343 Bacteria 1548
16 Ga0070661_100283105 3300005344 Bacteria 1287
17 Ga0070692_10001914 3300005345 Bacteria 7859
18 Ga0070692_10036942 3300005345 Bacteria 2481
19 Ga0070692_10092539 3300005345 Bacteria 1645
20 Ga0070669_100163006 3300005353 Bacteria 1734
21 Ga0070669_100641797 3300005353 Bacteria 893
22 Ga0070671_100723834 3300005355 Bacteria 864
23 Ga0070674_101243200 3300005356 Unclassified 662
24 Ga0070673_100196086 3300005364 Bacteria 1737
25 Ga0070673_100319195 3300005364 Bacteria 1372
26 Ga0070673_100554081 3300005364 Bacteria 1045
27 Ga0070659_100000997 3300005366 Bacteria 20800
28 Ga0070659_101383362 3300005366 Bacteria 625
29 Ga0070709_10560421 3300005434 Bacteria 875
30 Ga0070701_10058075 3300005438 Bacteria 2029
31 Ga0070705_100359854 3300005440 Bacteria 1064
32 Ga0070700_100016396 3300005441 Bacteria 4220
33 Ga0070694_100007993 3300005444 Bacteria 6463
34 Ga0070694_100010270 3300005444 Bacteria 5769
35 Ga0070694_100032847 3300005444 Bacteria 3410
36 Ga0070694_100186651 3300005444 Bacteria 1537
37 Ga0070694_100386561 3300005444 Bacteria 1093
38 Ga0070708_100000712 3300005445 Bacteria 25260
39 Ga0070662_100110572 3300005457 Bacteria 2093
40 Ga0070681_10000652 3300005458 Bacteria 28661
41 Ga0070681_10025235 3300005458 Bacteria 5978
42 Ga0070681_10033900 3300005458 Bacteria 5127
43 Ga0070681_10620266 3300005458 Unclassified 996
44 Ga0068867_100230582 3300005459 Bacteria 1497
45 Ga0070685_10944678 3300005466 Unclassified 644
46 Ga0070706_100000019 3300005467 Bacteria 166483
47 Ga0070706_100071143 3300005467 Bacteria 3216
48 Ga0070706_100796273 3300005467 Bacteria 875
49 Ga0070707_100049275 3300005468 Unclassified 4037
50 Ga0070698_100027198 3300005471 Bacteria 5950
51 Ga0070698_100337079 3300005471 Bacteria 1439
52 Ga0070699_100000762 3300005518 Bacteria 29755
53 Ga0070699_100009442 3300005518 Bacteria 8453
54 Ga0070699_100560544 3300005518 Bacteria 1040
55 Ga0070679_100000059 3300005530 Bacteria 81792
56 Ga0070679_100044574 3300005530 Bacteria 4419
57 Ga0070679_100511126 3300005530 Bacteria 1145
58 Ga0070697_100024734 3300005536 Bacteria 4782
59 Ga0070697_100060265 3300005536 Unclassified 3093
60 Ga0068853_100183786 3300005539 Bacteria 1897
61 Ga0068853_101028990 3300005539 Bacteria 793
62 Ga0070672_100417590 3300005543 Bacteria 1152
63 Ga0070672_100714140 3300005543 Bacteria 878
64 Ga0070695_100202766 3300005545 Bacteria 1418
65 Ga0070695_100254617 3300005545 Bacteria 1279
66 Ga0070695_100310974 3300005545 Bacteria 1168
67 Ga0070695_100346683 3300005545 Bacteria 1111
68 Ga0070695_100536001 3300005545 Unclassified 910
69 Ga0070696_100054719 3300005546 Bacteria 2781
70 Ga0070696_100095392 3300005546 Bacteria 2124
71 Ga0070696_100105913 3300005546 Bacteria 2021
72 Ga0070696_100123152 3300005546 Unclassified 1879
73 Ga0070696_100454852 3300005546 Bacteria 1011
74 Ga0070693_100033313 3300005547 Bacteria 2842
75 Ga0070693_100041037 3300005547 Bacteria 2601
76 Ga0070693_100069385 3300005547 Bacteria 2072
77 Ga0070693_100131609 3300005547 Bacteria 1564
78 Ga0070693_100347614 3300005547 Unclassified 1014
79 Ga0070693_100618516 3300005547 Unclassified 784
80 Ga0070704_100084802 3300005549 Bacteria 2343
81 Ga0070704_100106072 3300005549 Unclassified 2128
82 Ga0070704_100123597 3300005549 Bacteria 1993
83 Ga0068855_100900850 3300005563 Bacteria 934
84 Ga0070664_100002145 3300005564 Bacteria 15812
85 Ga0070664_100403137 3300005564 Bacteria 1251
86 Ga0068857_100036958 3300005577 Bacteria 4325
87 Ga0068857_100113682 3300005577 Bacteria 2434
88 Ga0068857_101326748 3300005577 Bacteria 699
89 Ga0068857_101762625 3300005577 Unclassified 606
90 Ga0068854_100381409 3300005578 Bacteria 1162
91 Ga0068854_101135053 3300005578 Bacteria 698
92 Ga0068856_100008069 3300005614 Bacteria 10276
93 Ga0068856_100261964 3300005614 Unclassified 1744
94 Ga0070702_100454686 3300005615 Unclassified 930
95 Ga0070702_100522199 3300005615 Unclassified 876
96 Ga0070702_100787614 3300005615 Bacteria 734
97 Ga0068859_100050397 3300005617 Bacteria 4182
98 Ga0068859_100103366 3300005617 Unclassified 2907
99 Ga0068859_100167040 3300005617 Bacteria 2280
100 Ga0068859_100415747 3300005617 Bacteria 1441
101 Ga0068859_100483644 3300005617 Bacteria 1333
102 Ga0068859_100563108 3300005617 Bacteria 1234
103 Ga0068864_100045933 3300005618 Bacteria 3747
104 Ga0068864_100673743 3300005618 Unclassified 1008
105 Ga0068861_100028204 3300005719 Bacteria 4096
106 Ga0068861_100044381 3300005719 Bacteria 3343
107 Ga0068861_100389696 3300005719 Unclassified 1233
108 Ga0068861_100612191 3300005719 Bacteria 1001
109 Ga0068861_101967781 3300005719 Unclassified 582
110 Ga0068851_10045470 3300005834 Bacteria 2219
111 Ga0068851_10660791 3300005834 Unclassified 640
112 Ga0068870_10082529 3300005840 Bacteria 1780
113 Ga0068863_100007143 3300005841 Bacteria 10955
114 Ga0068863_100463062 3300005841 Bacteria 1245
115 Ga0068860_100067147 3300005843 Bacteria 3408
116 Ga0068860_100120526 3300005843 Bacteria 2512
117 Ga0068860_100129313 3300005843 Unclassified 2422
118 Ga0068860_100130407 3300005843 Bacteria 2412
119 Ga0068860_100443198 3300005843 Unclassified 1290
120 Ga0068862_100565396 3300005844 Bacteria 1087
121 Ga0081539_10000783 3300005985 Bacteria 61928
122 Ga0081539_10001629 3300005985 Bacteria 36707
123 Ga0075427_10026017 3300006194 Unclassified 946
124 Ga0097621_100151118 3300006237 Unclassified 1991
125 Ga0097621_100741982 3300006237 Unclassified 906
126 Ga0068871_100714996 3300006358 Unclassified 918
127 Ga0068871_100940073 3300006358 Unclassified 803
128 Ga0075428_100202806 3300006844 Bacteria 2144
129 Ga0075428_100604277 3300006844 Unclassified 1171
130 Ga0075430_100027060 3300006846 Bacteria 4875
131 Ga0075431_100128805 3300006847 Unclassified 2611
132 Ga0075431_100236852 3300006847 Bacteria 1858
133 Ga0075433_10199575 3300006852 Bacteria 1779
134 Ga0075433_10244564 3300006852 Unclassified 1593
135 Ga0075434_100077273 3300006871 Bacteria 3324
136 Ga0075434_100551212 3300006871 Bacteria 1172
137 Ga0075434_101452105 3300006871 Unclassified 695
138 Ga0075429_100590310 3300006880 Unclassified 973
139 Ga0075436_100005320 3300006914 Bacteria 8850
140 Ga0097620_100050399 3300006931 Bacteria 4182
141 Ga0097620_100103363 3300006931 Unclassified 2907
142 Ga0097620_100167039 3300006931 Bacteria 2280
143 Ga0097620_100415751 3300006931 Bacteria 1441
144 Ga0097620_100483642 3300006931 Bacteria 1333
145 Ga0097620_100563049 3300006931 Bacteria 1234
146 Ga0075435_100049155 3300007076 Bacteria 3390
147 Ga0105240_10052115 3300009093 Bacteria 5145
148 Ga0111539_10014870 3300009094 Bacteria 9704
149 Ga0111539_10033381 3300009094 Bacteria 6248
150 Ga0111539_11043716 3300009094 Bacteria 950
151 Ga0105245_11116257 3300009098 Unclassified 835
152 Ga0105247_10030660 3300009101 Bacteria 3260
153 Ga0105247_10106565 3300009101 Bacteria 1798
154 Ga0114129_10007505 3300009147 Bacteria 15532
155 Ga0114129_10119945 3300009147 Bacteria 3622
156 Ga0114129_10134085 3300009147 Unclassified 3399
157 Ga0114129_10385206 3300009147 Bacteria 1851
158 Ga0114129_10745894 3300009147 Bacteria 1254
159 Ga0105243_10138318 3300009148 Unclassified 2075
160 Ga0105241_10058362 3300009174 Bacteria 2964
161 Ga0105241_10082407 3300009174 Bacteria 2521
162 Ga0105241_10122415 3300009174 Bacteria 2097
163 Ga0105241_10232702 3300009174 Unclassified 1554
164 Ga0105241_10974663 3300009174 Unclassified 792
165 Ga0105241_11153396 3300009174 Unclassified 732
166 Ga0105241_11637396 3300009174 Bacteria 624
167 Ga0105242_10111081 3300009176 Bacteria 2336
168 Ga0105242_10705657 3300009176 Bacteria 988
169 Ga0105248_10027885 3300009177 Bacteria 6287
170 Ga0105248_10117341 3300009177 Bacteria 3002
171 Ga0105248_10315667 3300009177 Bacteria 1760
172 Ga0105248_10442307 3300009177 Bacteria 1464
173 Ga0105248_11517430 3300009177 Unclassified 759
174 Ga0105248_11581914 3300009177 Bacteria 742
175 Ga0105237_10002452 3300009545 Bacteria 23028
176 Ga0105237_10103590 3300009545 Bacteria 2838
177 Ga0105238_10121394 3300009551 Unclassified 2592
178 Ga0105238_10382135 3300009551 Bacteria 1400
179 Ga0105249_10073103 3300009553 Bacteria 3171
180 Ga0105239_10246922 3300010375 Bacteria 2004
181 Ga0105246_10190482 3300011119 Bacteria 1587
182 Ga0157373_10001793 3300013100 Bacteria 16329
183 Ga0157373_10393406 3300013100 Bacteria 993
184 Ga0157371_11023765 3300013102 Unclassified 631
185 Ga0157378_10261980 3300013297 Bacteria 1659
186 Ga0157378_11253319 3300013297 Unclassified 782
187 Ga0163162_10000506 3300013306 Bacteria 36273
188 Ga0163162_10096655 3300013306 Bacteria 3042
189 Ga0163162_10131414 3300013306 Unclassified 2612
190 Ga0157372_10003813 3300013307 Bacteria 16192
191 Ga0157372_11119741 3300013307 Unclassified 911
192 Ga0163163_10002674 3300014325 Bacteria 15066
193 Ga0163163_10286952 3300014325 Bacteria 1698
194 Ga0163163_10454508 3300014325 Bacteria 1341
195 Ga0157377_10102738 3300014745 Bacteria 1706
196 Ga0157377_10226951 3300014745 Bacteria 1199
197 Ga0157377_10408280 3300014745 Bacteria 927
198 Ga0157379_10039651 3300014968 Bacteria 4203
199 Ga0157379_10531779 3300014968 Unclassified 1092
200 Ga0182005_1082136 3300015265 Unclassified 890
201 Ga0207656_10030417 3300025321 Bacteria 2231
202 Ga0207653_10192281 3300025885 Unclassified 767
203 Ga0207710_10001678 3300025900 Bacteria 10757
204 Ga0207710_10126749 3300025900 Bacteria 1223
205 Ga0207647_10056977 3300025904 Bacteria 2396
206 Ga0207647_10075338 3300025904 Bacteria 2031
207 Ga0207647_10149388 3300025904 Bacteria 1366
208 Ga0207647_10183159 3300025904 Unclassified 1216
209 Ga0207643_10040350 3300025908 Bacteria 2628
210 Ga0207684_10000079 3300025910 Bacteria 179842
211 Ga0207684_10224153 3300025910 Bacteria 1622
212 Ga0207684_10806885 3300025910 Bacteria 793
213 Ga0207654_10227508 3300025911 Bacteria 1240
214 Ga0207654_10241282 3300025911 Unclassified 1208
215 Ga0207654_10469195 3300025911 Unclassified 885
216 Ga0207707_10000008 3300025912 Bacteria 330313
217 Ga0207707_10049229 3300025912 Bacteria 3671
218 Ga0207707_10243103 3300025912 Bacteria 1564
219 Ga0207695_10188240 3300025913 Bacteria 1982
220 Ga0207695_10202697 3300025913 Bacteria 1897
221 Ga0207671_10002542 3300025914 Bacteria 19413
222 Ga0207671_11217668 3300025914 Unclassified 589
223 Ga0207660_10000437 3300025917 Bacteria 27518
224 Ga0207660_10043834 3300025917 Bacteria 3145
225 Ga0207657_10329920 3300025919 Bacteria 1205
226 Ga0207649_10076995 3300025920 Bacteria 2148
227 Ga0207649_10615483 3300025920 Bacteria 836
228 Ga0207652_10000085 3300025921 Bacteria 101176
229 Ga0207652_10026033 3300025921 Unclassified 4869
230 Ga0207652_10368419 3300025921 Bacteria 1297
231 Ga0207646_10192059 3300025922 Unclassified 1844
232 Ga0207646_10209581 3300025922 Bacteria 1760
233 Ga0207681_10461060 3300025923 Bacteria 1035
234 Ga0207694_10008469 3300025924 Bacteria 7763
235 Ga0207650_10000001 3300025925 Bacteria 1545726
236 Ga0207650_10139248 3300025925 Unclassified 1906
237 Ga0207650_10269592 3300025925 Bacteria 1383
238 Ga0207644_10017704 3300025931 Bacteria 4817
239 Ga0207644_10207405 3300025931 Unclassified 1548
240 Ga0207690_10079965 3300025932 Bacteria 2280
241 Ga0207706_10175371 3300025933 Bacteria 1883
242 Ga0207709_10413708 3300025935 Unclassified 1034
243 Ga0207670_10016298 3300025936 Bacteria 4463
244 Ga0207669_11442431 3300025937 Unclassified 586
245 Ga0207704_10172805 3300025938 Bacteria 1552
246 Ga0207665_10623725 3300025939 Unclassified 843
247 Ga0207691_10200758 3300025940 Bacteria 1736
248 Ga0207711_10017312 3300025941 Bacteria 5988
249 Ga0207711_10020880 3300025941 Bacteria 5466
250 Ga0207711_10836632 3300025941 Bacteria 857
251 Ga0207689_10209555 3300025942 Bacteria 1610
252 Ga0207679_10071855 3300025945 Bacteria 2612
253 Ga0207679_10092920 3300025945 Bacteria 2338
254 Ga0207679_10148977 3300025945 Bacteria 1902
255 Ga0207667_11090911 3300025949 Bacteria 782
256 Ga0207651_10065607 3300025960 Bacteria 2547
257 Ga0207651_10087126 3300025960 Bacteria 2272
258 Ga0207651_10154717 3300025960 Unclassified 1790
259 Ga0207712_10012801 3300025961 Bacteria 5365
260 Ga0207640_10131325 3300025981 Bacteria 1811
261 Ga0207640_10194272 3300025981 Bacteria 1532
262 Ga0207640_10745530 3300025981 Bacteria 844
263 Ga0207703_10172510 3300026035 Bacteria 1903
264 Ga0207703_10792069 3300026035 Unclassified 905
265 Ga0207639_10083876 3300026041 Bacteria 2530
266 Ga0207639_10290472 3300026041 Bacteria 1441
267 Ga0207639_10479929 3300026041 Bacteria 1133
268 Ga0207639_10767702 3300026041 Bacteria 897
269 Ga0207708_10001910 3300026075 Bacteria 15394
270 Ga0207708_10052463 3300026075 Bacteria 3106
271 Ga0207702_10226166 3300026078 Unclassified 1746
272 Ga0207702_11485422 3300026078 Bacteria 671
273 Ga0207676_10140707 3300026095 Bacteria 2065
274 Ga0207676_10240313 3300026095 Bacteria 1624
275 Ga0207674_10002177 3300026116 Bacteria 24786
276 Ga0207674_10532662 3300026116 Unclassified 1135
277 Ga0207675_100477341 3300026118 Unclassified 1239
278 Ga0207675_100989477 3300026118 Unclassified 859
279 Ga0207428_10083419 3300027907 Bacteria 2492
280 Ga0268264_10030508 3300028381 Bacteria 4419
281 Ga0268264_10054414 3300028381 Bacteria 3342
282 Ga0268264_10153247 3300028381 Bacteria 2069
283 Ga0268264_10269954 3300028381 Unclassified 1589
284 Ga0307408_100053455 3300031548 Bacteria 2916
285 Ga0307408_100546663 3300031548 Unclassified 1021
286 Ga0307413_10050646 3300031824 Bacteria 2497
287 Ga0307413_10857508 3300031824 Unclassified 768
288 Ga0307406_10003651 3300031901 Bacteria 8381
289 Ga0307406_10304586 3300031901 Unclassified 1226
290 Ga0307412_10026184 3300031911 Bacteria 3622
291 Ga0307412_10136054 3300031911 Bacteria 1793
292 Ga0307416_100120273 3300032002 Bacteria 2338
293 Ga0307416_100269224 3300032002 Bacteria 1671
294 Ga0307416_100373676 3300032002 Unclassified 1452
295 Ga0307414_10002794 3300032004 Bacteria 9192
296 Ga0307414_10334284 3300032004 Unclassified 1294
297 Ga0307414_11250438 3300032004 Bacteria 688
298 Ga0307411_10004628 3300032005 Bacteria 6625
299 Ga0307415_100063379 3300032126 Bacteria 2568
300 Ga0307415_100185262 3300032126 Bacteria 1637
301 Ga0373952_0052405 3300035092 Bacteria 977
302 Ga0373939_0101501 3300035114 Bacteria 988
303 Ga0373941_0043874 3300035115 Bacteria 1393
304 Ga0373942_0006156 3300035207 Unclassified 2769
305 Ga0395900_0104225 3300037418 Bacteria 2914
306 Ga0395900_0182496 3300037418 Bacteria 2132
307 Ga0395898_0015621 3300037466 Bacteria 7783
308 Ga0395898_0041835 3300037466 Bacteria 4524
309 Ga0395898_0160235 3300037466 Bacteria 2152
310 Ga0395898_0563245 3300037466 Unclassified 1082
311 Ga0395901_0111582 3300038443 Bacteria 2872
312 Ga0395901_0228634 3300038443 Bacteria 1943
313 Ga0395901_0437083 3300038443 Bacteria 1340
314 Ga0242420_013818 3300038996 Bacteria 1379
315 Ga0242420_013910 3300038996 Bacteria 1376
316 Ga0439448_0014612 3300042005 Unclassified 2371
317 Ga0439455_0006850 3300042012 Bacteria 2386
318 Ga0439458_0001329 3300042157 Bacteria 6241
319 Ga0495629_0408934 3300046459 Unclassified 922
320 Ga0495658_0062570 3300046683 Unclassified 2140
321 Ga0496104_0363902 3300048907 Bacteria 1359
322 Ga0496104_0494711 3300048907 Bacteria 1134
323 Ga0496108_0942718 3300048911 Bacteria 739
324 Ga0496109_0679506 3300048912 Bacteria 967
325 Ga0496111_0629358 3300048914 Unclassified 784
326 Ga0496112_0092496 3300048915 Bacteria 2994
327 Ga0496112_0191386 3300048915 Bacteria 2008
328 Ga0496112_0311933 3300048915 Bacteria 1518
329 Ga0496113_0068052 3300048916 Bacteria 2702
330 Ga0496113_0806374 3300048916 Unclassified 746
331 Ga0501291_001239 3300049514 Bacteria 2945
332 Ga0501291_004668 3300049514 Unclassified 1756
333 Ga0501292_004553 3300049515 Bacteria 1899
334 Ga0501292_005926 3300049515 Unclassified 1721
335 Ga0501296_005236 3300049519 Unclassified 1440
336 Ga0501297_008880 3300049520 Unclassified 1114
337 Ga0501298_002525 3300049521 Bacteria 2771
338 Ga0501298_008207 3300049521 Unclassified 1749
339 Ga0501299_005123 3300049522 Bacteria 1998
340 Ga0501038_0016873 3300049574 Bacteria 6610
341 Ga0501077_0039751 3300049593 Bacteria 2997
342 Ga0501077_0360342 3300049593 Bacteria 928
343 Ga0501198_004703 3300049649 Bacteria 1902
344 Ga0501198_048325 3300049649 Unclassified 753
345 Ga0501198_053790 3300049649 Unclassified 723
346 Ga0501202_008112 3300049652 Bacteria 1909
347 Ga0501202_065489 3300049652 Unclassified 829
348 Ga0501207_000932 3300049654 Bacteria 3522
349 Ga0501207_016332 3300049654 Unclassified 1150
350 Ga0501209_025270 3300049656 Bacteria 1455
351 Ga0501217_001739 3300049661 Bacteria 4158
352 Ga0501217_007802 3300049661 Bacteria 2300
353 Ga0501217_012154 3300049661 Bacteria 1915
354 Ga0501223_004147 3300049663 Bacteria 3122
355 Ga0501223_006284 3300049663 Bacteria 2464
356 Ga0501223_008794 3300049663 Bacteria 2056
357 Ga0501224_000630 3300049664 Bacteria 4341
358 Ga0501227_002440 3300049665 Bacteria 4104
359 Ga0501227_002526 3300049665 Bacteria 4042
360 Ga0501230_112206 3300049667 Unclassified 597
361 Ga0501233_103099 3300049668 Unclassified 756
362 Ga0501235_015477 3300049669 Bacteria 1682
363 Ga0501235_031436 3300049669 Unclassified 1199
364 Ga0501240_045470 3300049673 Unclassified 741
365 Ga0501243_003923 3300049675 Bacteria 2219
366 Ga0501243_037892 3300049675 Unclassified 840
367 Ga0501249_019795 3300049679 Unclassified 1462
368 Ga0501250_002164 3300049680 Bacteria 1747
369 Ga0501255_029412 3300049684 Unclassified 757
370 Ga0501257_029653 3300049686 Bacteria 1315
371 Ga0501225_0000657 3300049705 Bacteria 10764
372 Ga0501225_0045814 3300049705 Unclassified 1211
373 Ga0501229_016931 3300049706 Unclassified 950
374 Ga0501234_001847 3300049707 Bacteria 3344
375 Ga0501234_044195 3300049707 Unclassified 733
376 Ga0501079_0050345 3300049741 Bacteria 3216
377 Ga0501083_0462843 3300049744 Bacteria 825
378 Ga0501264_020269 3300049761 Unclassified 702
379 Ga0501268_019248 3300049765 Bacteria 1154
380 Ga0501268_034032 3300049765 Unclassified 934
381 Ga0501268_150625 3300049765 Unclassified 536
382 Ga0501270_019354 3300049767 Unclassified 1019
383 Ga0501272_006277 3300049769 Bacteria 1269
384 Ga0501273_028605 3300049770 Unclassified 785
385 Ga0501275_023389 3300049772 Unclassified 775
386 Ga0501279_024268 3300049775 Unclassified 877
387 Ga0501283_026101 3300049779 Unclassified 960
388 Ga0501204_007436 3300049850 Viruses 1233
389 Ga0501212_005291 3300049851 Unclassified 1698
390 Ga0501226_004677 3300049853 Bacteria 1578
391 nmdc:mga05p37_15372_c1 3300050507 Bacteria 9195
392 nmdc:mga05p37_49287_c1 3300050507 Bacteria 5180
393 nmdc:mga05p37_493762_c1 3300050507 Unclassified 1407
394 nmdc:mga09592_207803_c1 3300050508 Bacteria 1696
395 nmdc:mga09592_26460_c1 3300050508 Bacteria 4806
396 nmdc:mga0qj67_216565_c1 3300050509 Bacteria 1555
397 nmdc:mga06r32_197803_c1 3300050510 Bacteria 1997
398 nmdc:mga06r32_226875_c1 3300050510 Bacteria 1856
399 nmdc:mga08y16_1865729_c1 3300050511 Unclassified 553
400 nmdc:mga08y16_68253_c1 3300050511 Bacteria 3707
401 nmdc:mga0n895_1077794_c1 3300050512 Unclassified 782
402 nmdc:mga0n895_1882045_c1 3300050512 Unclassified 558
403 nmdc:mga0rr50_151068_c1 3300050513 Bacteria 1877
404 nmdc:mga0rr50_429992_c1 3300050513 Bacteria 1117
405 nmdc:mga08x19_1646_c2 3300050514 Bacteria 4644
406 nmdc:mga0a205_103911_c1 3300050515 Bacteria 2740
407 nmdc:mga0a205_122128_c1 3300050515 Bacteria 2504
408 nmdc:mga0a205_509366_c1 3300050515 Bacteria 1060
409 nmdc:mga0a205_94478_c1 3300050515 Bacteria 2889
410 Ga0501084_0554547 3300054114 Unclassified 971
411 Ga0530510_0045059 3300061734 Bacteria 3187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100084802 Ga0070704_1000848022 141
2 3300013307 Ga0157372_11119741 Ga0157372_111197411 141
3 3300050507 nmdc:mga05p37_493762_c1 nmdc:mga05p37_493762_c1_10_441 143
4 3300005345 Ga0070692_10092539 Ga0070692_100925393 152
5 3300005457 Ga0070662_100110572 Ga0070662_1001105722 152
6 3300005364 Ga0070673_100554081 Ga0070673_1005540812 159
7 3300009174 Ga0105241_10082407 Ga0105241_100824072 159
8 3300025960 Ga0207651_10154717 Ga0207651_101547172 159
9 3300002459 JGI24751J29686_10000013 JGI24751J29686_1000001340 161
10 3300049668 Ga0501233_103099 Ga0501233_103099_31_519 161
11 3300049707 Ga0501234_044195 Ga0501234_044195_215_703 161
12 3300049765 Ga0501268_150625 Ga0501268_150625_14_502 161
13 3300005328 Ga0070676_10659575 Ga0070676_106595752 163
14 3300005331 Ga0070670_101167004 Ga0070670_1011670041 163
15 3300005334 Ga0068869_100247540 Ga0068869_1002475402 163
16 3300005343 Ga0070687_100111651 Ga0070687_1001116511 163
17 3300005344 Ga0070661_100283105 Ga0070661_1002831052 163
18 3300005364 Ga0070673_100196086 Ga0070673_1001960861 163
19 3300005366 Ga0070659_100000997 Ga0070659_10000099710 163
20 3300005440 Ga0070705_100359854 Ga0070705_1003598542 163
21 3300005458 Ga0070681_10025235 Ga0070681_100252354 163
22 3300005530 Ga0070679_100044574 Ga0070679_1000445745 163
23 3300005539 Ga0068853_100183786 Ga0068853_1001837862 163
24 3300005563 Ga0068855_100900850 Ga0068855_1009008502 163
25 3300005564 Ga0070664_100002145 Ga0070664_1000021458 163
26 3300005577 Ga0068857_100036958 Ga0068857_1000369586 163
27 3300005577 Ga0068857_101762625 Ga0068857_1017626251 163
28 3300005618 Ga0068864_100045933 Ga0068864_1000459335 163
29 3300005719 Ga0068861_100389696 Ga0068861_1003896962 163
30 3300005719 Ga0068861_101967781 Ga0068861_1019677811 163
31 3300005843 Ga0068860_100120526 Ga0068860_1001205262 163
32 3300005843 Ga0068860_100443198 Ga0068860_1004431982 163
33 3300006237 Ga0097621_100741982 Ga0097621_1007419822 163
34 3300006846 Ga0075430_100027060 Ga0075430_1000270603 163
35 3300006847 Ga0075431_100128805 Ga0075431_1001288053 163
36 3300009094 Ga0111539_10014870 Ga0111539_100148708 163
37 3300009094 Ga0111539_11043716 Ga0111539_110437162 163
38 3300009147 Ga0114129_10134085 Ga0114129_101340853 163
39 3300009177 Ga0105248_11517430 Ga0105248_115174301 163
40 3300013102 Ga0157371_11023765 Ga0157371_110237652 163
41 3300013297 Ga0157378_11253319 Ga0157378_112533192 163
42 3300013306 Ga0163162_10000506 Ga0163162_100005063 163
43 3300014325 Ga0163163_10286952 Ga0163163_102869522 163
44 3300025904 Ga0207647_10075338 Ga0207647_100753382 163
45 3300025912 Ga0207707_10049229 Ga0207707_100492292 163
46 3300025917 Ga0207660_10043834 Ga0207660_100438344 163
47 3300025919 Ga0207657_10329920 Ga0207657_103299203 163
48 3300025920 Ga0207649_10076995 Ga0207649_100769953 163
49 3300025921 Ga0207652_10026033 Ga0207652_100260334 163
50 3300025932 Ga0207690_10079965 Ga0207690_100799654 163
51 3300025933 Ga0207706_10175371 Ga0207706_101753713 163
52 3300025945 Ga0207679_10092920 Ga0207679_100929204 163
53 3300025949 Ga0207667_11090911 Ga0207667_110909112 163
54 3300025960 Ga0207651_10087126 Ga0207651_100871265 163
55 3300025981 Ga0207640_10194272 Ga0207640_101942721 163
56 3300026041 Ga0207639_10290472 Ga0207639_102904722 163
57 3300026095 Ga0207676_10240313 Ga0207676_102403132 163
58 3300026116 Ga0207674_10002177 Ga0207674_1000217712 163
59 3300026118 Ga0207675_100477341 Ga0207675_1004773412 163
60 3300027907 Ga0207428_10083419 Ga0207428_100834192 163
61 3300028381 Ga0268264_10054414 Ga0268264_100544142 163
62 3300049593 Ga0501077_0039751 Ga0501077_0039751_1877_2377 163
63 3300050508 nmdc:mga09592_207803_c1 nmdc:mga09592_207803_c1_745_1245 163
64 3300050509 nmdc:mga0qj67_216565_c1 nmdc:mga0qj67_216565_c1_193_693 163
65 3300050510 nmdc:mga06r32_197803_c1 nmdc:mga06r32_197803_c1_1082_1582 163
66 3300050511 nmdc:mga08y16_1865729_c1 nmdc:mga08y16_1865729_c1_13_504 163
67 3300050511 nmdc:mga08y16_68253_c1 nmdc:mga08y16_68253_c1_1946_2446 163
68 3300005289 Ga0065704_10005075 Ga0065704_100050752 164
69 3300005336 Ga0070680_100000139 Ga0070680_1000001397 164
70 3300005356 Ga0070674_101243200 Ga0070674_1012432001 164
71 3300005458 Ga0070681_10000652 Ga0070681_1000065218 164
72 3300005530 Ga0070679_100000059 Ga0070679_1000000595 164
73 3300005536 Ga0070697_100060265 Ga0070697_1000602652 164
74 3300005545 Ga0070695_100254617 Ga0070695_1002546171 164
75 3300005545 Ga0070695_100536001 Ga0070695_1005360012 164
76 3300005546 Ga0070696_100123152 Ga0070696_1001231522 164
77 3300005547 Ga0070693_100347614 Ga0070693_1003476142 164
78 3300005614 Ga0068856_100008069 Ga0068856_1000080697 164
79 3300005617 Ga0068859_100415747 Ga0068859_1004157472 164
80 3300005834 Ga0068851_10660791 Ga0068851_106607911 164
81 3300006237 Ga0097621_100151118 Ga0097621_1001511182 164
82 3300006852 Ga0075433_10244564 Ga0075433_102445642 164
83 3300006871 Ga0075434_100551212 Ga0075434_1005512122 164
84 3300006871 Ga0075434_101452105 Ga0075434_1014521052 164
85 3300006931 Ga0097620_100415751 Ga0097620_1004157513 164
86 3300009174 Ga0105241_10232702 Ga0105241_102327022 164
87 3300009177 Ga0105248_10027885 Ga0105248_100278853 164
88 3300010375 Ga0105239_10246922 Ga0105239_102469222 164
89 3300013297 Ga0157378_10261980 Ga0157378_102619803 164
90 3300025912 Ga0207707_10000008 Ga0207707_1000000816 164
91 3300025917 Ga0207660_10000437 Ga0207660_1000043716 164
92 3300025921 Ga0207652_10000085 Ga0207652_1000008572 164
93 3300025922 Ga0207646_10192059 Ga0207646_101920592 164
94 3300025925 Ga0207650_10139248 Ga0207650_101392482 164
95 3300025931 Ga0207644_10017704 Ga0207644_100177046 164
96 3300025931 Ga0207644_10207405 Ga0207644_102074052 164
97 3300025937 Ga0207669_11442431 Ga0207669_114424311 164
98 3300025941 Ga0207711_10017312 Ga0207711_100173124 164
99 3300026041 Ga0207639_10083876 Ga0207639_100838763 164
100 3300046459 Ga0495629_0408934 Ga0495629_0408934_93_587 164
101 3300046683 Ga0495658_0062570 Ga0495658_0062570_1554_2048 164
102 3300049741 Ga0501079_0050345 Ga0501079_0050345_1270_1773 164
103 3300049744 Ga0501083_0462843 Ga0501083_0462843_160_663 164
104 3300050508 nmdc:mga09592_26460_c1 nmdc:mga09592_26460_c1_2421_2915 164
105 3300050512 nmdc:mga0n895_1882045_c1 nmdc:mga0n895_1882045_c1_28_522 164
106 3300050513 nmdc:mga0rr50_429992_c1 nmdc:mga0rr50_429992_c1_286_786 164
107 3300050515 nmdc:mga0a205_103911_c1 nmdc:mga0a205_103911_c1_2105_2599 164
108 3300054114 Ga0501084_0554547 Ga0501084_0554547_397_900 164
109 3300061734 Ga0530510_0045059 Ga0530510_0045059_2199_2702 164
110 3300007076 Ga0075435_100049155 Ga0075435_1000491552 165
111 3300009147 Ga0114129_10385206 Ga0114129_103852062 165
112 3300050513 nmdc:mga0rr50_151068_c1 nmdc:mga0rr50_151068_c1_1122_1622 165
113 3300005530 Ga0070679_100511126 Ga0070679_1005111262 166
114 3300005543 Ga0070672_100417590 Ga0070672_1004175902 166
115 3300005547 Ga0070693_100033313 Ga0070693_1000333133 166
116 3300005577 Ga0068857_100113682 Ga0068857_1001136823 166
117 3300005614 Ga0068856_100261964 Ga0068856_1002619641 166
118 3300005618 Ga0068864_100673743 Ga0068864_1006737431 166
119 3300009093 Ga0105240_10052115 Ga0105240_100521155 166
120 3300009101 Ga0105247_10106565 Ga0105247_101065651 166
121 3300009177 Ga0105248_10442307 Ga0105248_104423073 166
122 3300009545 Ga0105237_10103590 Ga0105237_101035902 166
123 3300025885 Ga0207653_10192281 Ga0207653_101922811 166
124 3300025913 Ga0207695_10202697 Ga0207695_102026973 166
125 3300025914 Ga0207671_11217668 Ga0207671_112176681 166
126 3300025920 Ga0207649_10615483 Ga0207649_106154831 166
127 3300025921 Ga0207652_10368419 Ga0207652_103684192 166
128 3300026041 Ga0207639_10479929 Ga0207639_104799293 166
129 3300026078 Ga0207702_10226166 Ga0207702_102261663 166
130 3300026095 Ga0207676_10140707 Ga0207676_101407072 166
131 3300048912 Ga0496109_0679506 Ga0496109_0679506_435_935 166
132 3300005444 Ga0070694_100032847 Ga0070694_1000328472 167
133 3300005445 Ga0070708_100000712 Ga0070708_1000007129 167
134 3300005458 Ga0070681_10033900 Ga0070681_100339002 167
135 3300005467 Ga0070706_100071143 Ga0070706_1000711432 167
136 3300005467 Ga0070706_100796273 Ga0070706_1007962732 167
137 3300005468 Ga0070707_100049275 Ga0070707_1000492752 167
138 3300005471 Ga0070698_100027198 Ga0070698_1000271982 167
139 3300005471 Ga0070698_100337079 Ga0070698_1003370792 167
140 3300005518 Ga0070699_100000762 Ga0070699_10000076212 167
141 3300005518 Ga0070699_100009442 Ga0070699_1000094423 167
142 3300005536 Ga0070697_100024734 Ga0070697_1000247342 167
143 3300005545 Ga0070695_100202766 Ga0070695_1002027662 167
144 3300005546 Ga0070696_100054719 Ga0070696_1000547193 167
145 3300005547 Ga0070693_100131609 Ga0070693_1001316092 167
146 3300005549 Ga0070704_100123597 Ga0070704_1001235973 167
147 3300005564 Ga0070664_100403137 Ga0070664_1004031372 167
148 3300005617 Ga0068859_100103366 Ga0068859_1001033664 167
149 3300005719 Ga0068861_100028204 Ga0068861_1000282043 167
150 3300006358 Ga0068871_100940073 Ga0068871_1009400731 167
151 3300006871 Ga0075434_100077273 Ga0075434_1000772733 167
152 3300006931 Ga0097620_100103363 Ga0097620_1001033634 167
153 3300009174 Ga0105241_10122415 Ga0105241_101224152 167
154 3300009174 Ga0105241_10974663 Ga0105241_109746632 167
155 3300009174 Ga0105241_11153396 Ga0105241_111533961 167
156 3300009176 Ga0105242_10705657 Ga0105242_107056572 167
157 3300009177 Ga0105248_10315667 Ga0105248_103156672 167
158 3300013100 Ga0157373_10393406 Ga0157373_103934062 167
159 3300014745 Ga0157377_10408280 Ga0157377_104082801 167
160 3300025910 Ga0207684_10224153 Ga0207684_102241532 167
161 3300025910 Ga0207684_10806885 Ga0207684_108068851 167
162 3300025911 Ga0207654_10227508 Ga0207654_102275082 167
163 3300025912 Ga0207707_10243103 Ga0207707_102431032 167
164 3300025922 Ga0207646_10209581 Ga0207646_102095811 167
165 3300025942 Ga0207689_10209555 Ga0207689_102095553 167
166 3300025945 Ga0207679_10071855 Ga0207679_100718553 167
167 3300031548 Ga0307408_100053455 Ga0307408_1000534552 167
168 3300031824 Ga0307413_10050646 Ga0307413_100506461 167
169 3300031901 Ga0307406_10003651 Ga0307406_100036511 167
170 3300031911 Ga0307412_10026184 Ga0307412_100261845 167
171 3300032002 Ga0307416_100120273 Ga0307416_1001202733 167
172 3300032002 Ga0307416_100373676 Ga0307416_1003736762 167
173 3300032004 Ga0307414_10002794 Ga0307414_100027943 167
174 3300032004 Ga0307414_11250438 Ga0307414_112504381 167
175 3300032005 Ga0307411_10004628 Ga0307411_100046285 167
176 3300032126 Ga0307415_100063379 Ga0307415_1000633791 167
177 3300032126 Ga0307415_100185262 Ga0307415_1001852621 167
178 3300035114 Ga0373939_0101501 Ga0373939_0101501_52_555 167
179 3300035115 Ga0373941_0043874 Ga0373941_0043874_37_540 167
180 3300037418 Ga0395900_0104225 Ga0395900_0104225_1310_1813 167
181 3300037466 Ga0395898_0015621 Ga0395898_0015621_4688_5191 167
182 3300037466 Ga0395898_0160235 Ga0395898_0160235_729_1232 167
183 3300037466 Ga0395898_0563245 Ga0395898_0563245_347_865 167
184 3300038443 Ga0395901_0111582 Ga0395901_0111582_221_724 167
185 3300038443 Ga0395901_0228634 Ga0395901_0228634_73_576 167
186 3300042005 Ga0439448_0014612 Ga0439448_0014612_540_1043 167
187 3300042012 Ga0439455_0006850 Ga0439455_0006850_1277_1780 167
188 3300042157 Ga0439458_0001329 Ga0439458_0001329_1418_1921 167
189 3300048907 Ga0496104_0363902 Ga0496104_0363902_481_1002 167
190 3300048914 Ga0496111_0629358 Ga0496111_0629358_157_678 167
191 3300048915 Ga0496112_0311933 Ga0496112_0311933_157_678 167
192 3300048916 Ga0496113_0806374 Ga0496113_0806374_150_671 167
193 3300049514 Ga0501291_004668 Ga0501291_004668_643_1161 167
194 3300049515 Ga0501292_005926 Ga0501292_005926_1059_1577 167
195 3300049521 Ga0501298_002525 Ga0501298_002525_1843_2361 167
196 3300049649 Ga0501198_004703 Ga0501198_004703_106_609 167
197 3300049652 Ga0501202_008112 Ga0501202_008112_1048_1551 167
198 3300049654 Ga0501207_000932 Ga0501207_000932_1619_2122 167
199 3300049656 Ga0501209_025270 Ga0501209_025270_279_782 167
200 3300049661 Ga0501217_001739 Ga0501217_001739_603_1121 167
201 3300049663 Ga0501223_004147 Ga0501223_004147_2512_3015 167
202 3300049663 Ga0501223_006284 Ga0501223_006284_1627_2145 167
203 3300049664 Ga0501224_000630 Ga0501224_000630_2948_3451 167
204 3300049665 Ga0501227_002440 Ga0501227_002440_3558_4061 167
205 3300049669 Ga0501235_031436 Ga0501235_031436_477_980 167
206 3300049675 Ga0501243_003923 Ga0501243_003923_1638_2141 167
207 3300049686 Ga0501257_029653 Ga0501257_029653_86_604 167
208 3300049705 Ga0501225_0000657 Ga0501225_0000657_1683_2186 167
209 3300049707 Ga0501234_001847 Ga0501234_001847_2762_3265 167
210 3300049761 Ga0501264_020269 Ga0501264_020269_35_553 167
211 3300049765 Ga0501268_019248 Ga0501268_019248_375_893 167
212 3300049765 Ga0501268_034032 Ga0501268_034032_395_898 167
213 3300049770 Ga0501273_028605 Ga0501273_028605_164_682 167
214 3300049853 Ga0501226_004677 Ga0501226_004677_876_1379 167
215 3300050512 nmdc:mga0n895_1077794_c1 nmdc:mga0n895_1077794_c1_205_708 167
216 3300050515 nmdc:mga0a205_94478_c1 nmdc:mga0a205_94478_c1_1021_1524 167
217 3300005458 Ga0070681_10620266 Ga0070681_106202662 168
218 3300005547 Ga0070693_100041037 Ga0070693_1000410372 168
219 3300006844 Ga0075428_100604277 Ga0075428_1006042771 168
220 3300006847 Ga0075431_100236852 Ga0075431_1002368522 168
221 3300006880 Ga0075429_100590310 Ga0075429_1005903101 168
222 3300025939 Ga0207665_10623725 Ga0207665_106237251 168
223 3300049574 Ga0501038_0016873 Ga0501038_0016873_6027_6542 168
224 3300050510 nmdc:mga06r32_226875_c1 nmdc:mga06r32_226875_c1_1110_1628 168
225 3300049514 Ga0501291_001239 Ga0501291_001239_1412_1939 169
226 3300049519 Ga0501296_005236 Ga0501296_005236_767_1294 169
227 3300049520 Ga0501297_008880 Ga0501297_008880_439_966 169
228 3300049521 Ga0501298_008207 Ga0501298_008207_344_871 169
229 3300049522 Ga0501299_005123 Ga0501299_005123_465_992 169
230 3300049654 Ga0501207_016332 Ga0501207_016332_421_948 169
231 3300049680 Ga0501250_002164 Ga0501250_002164_297_824 169
232 3300049684 Ga0501255_029412 Ga0501255_029412_82_609 169
233 3300049767 Ga0501270_019354 Ga0501270_019354_465_992 169
234 3300049769 Ga0501272_006277 Ga0501272_006277_608_1135 169
235 3300049772 Ga0501275_023389 Ga0501275_023389_236_763 169
236 3300005434 Ga0070709_10560421 Ga0070709_105604212 170
237 3300005545 Ga0070695_100346683 Ga0070695_1003466832 170
238 3300005546 Ga0070696_100105913 Ga0070696_1001059132 170
239 3300005547 Ga0070693_100069385 Ga0070693_1000693851 170
240 3300009147 Ga0114129_10007505 Ga0114129_100075057 170
241 3300050507 nmdc:mga05p37_15372_c1 nmdc:mga05p37_15372_c1_5019_5546 170
242 3300003320 rootH2_10224229 rootH2_102242292 171
243 3300005290 Ga0065712_10012337 Ga0065712_100123372 171
244 3300005293 Ga0065715_10013179 Ga0065715_100131792 171
245 3300005293 Ga0065715_10113603 Ga0065715_101136033 171
246 3300005331 Ga0070670_100032480 Ga0070670_1000324805 171
247 3300005340 Ga0070689_100000520 Ga0070689_1000005205 171
248 3300005353 Ga0070669_100163006 Ga0070669_1001630063 171
249 3300005353 Ga0070669_100641797 Ga0070669_1006417972 171
250 3300005355 Ga0070671_100723834 Ga0070671_1007238342 171
251 3300005364 Ga0070673_100319195 Ga0070673_1003191952 171
252 3300005438 Ga0070701_10058075 Ga0070701_100580752 171
253 3300005441 Ga0070700_100016396 Ga0070700_1000163962 171
254 3300005444 Ga0070694_100386561 Ga0070694_1003865612 171
255 3300005459 Ga0068867_100230582 Ga0068867_1002305822 171
256 3300005466 Ga0070685_10944678 Ga0070685_109446781 171
257 3300005467 Ga0070706_100000019 Ga0070706_10000001986 171
258 3300005543 Ga0070672_100714140 Ga0070672_1007141401 171
259 3300005545 Ga0070695_100310974 Ga0070695_1003109742 171
260 3300005547 Ga0070693_100618516 Ga0070693_1006185162 171
261 3300005549 Ga0070704_100106072 Ga0070704_1001060722 171
262 3300005577 Ga0068857_101326748 Ga0068857_1013267482 171
263 3300005578 Ga0068854_101135053 Ga0068854_1011350532 171
264 3300005615 Ga0070702_100454686 Ga0070702_1004546862 171
265 3300005615 Ga0070702_100522199 Ga0070702_1005221992 171
266 3300005615 Ga0070702_100787614 Ga0070702_1007876141 171
267 3300005617 Ga0068859_100050397 Ga0068859_1000503973 171
268 3300005617 Ga0068859_100167040 Ga0068859_1001670403 171
269 3300005617 Ga0068859_100483644 Ga0068859_1004836443 171
270 3300005617 Ga0068859_100563108 Ga0068859_1005631082 171
271 3300005719 Ga0068861_100044381 Ga0068861_1000443812 171
272 3300005841 Ga0068863_100007143 Ga0068863_1000071438 171
273 3300005841 Ga0068863_100463062 Ga0068863_1004630622 171
274 3300005843 Ga0068860_100067147 Ga0068860_1000671473 171
275 3300005843 Ga0068860_100129313 Ga0068860_1001293132 171
276 3300005843 Ga0068860_100130407 Ga0068860_1001304072 171
277 3300005844 Ga0068862_100565396 Ga0068862_1005653962 171
278 3300005985 Ga0081539_10000783 Ga0081539_1000078339 171
279 3300005985 Ga0081539_10001629 Ga0081539_100016297 171
280 3300006358 Ga0068871_100714996 Ga0068871_1007149962 171
281 3300006852 Ga0075433_10199575 Ga0075433_101995753 171
282 3300006914 Ga0075436_100005320 Ga0075436_1000053204 171
283 3300006931 Ga0097620_100050399 Ga0097620_1000503993 171
284 3300006931 Ga0097620_100167039 Ga0097620_1001670393 171
285 3300006931 Ga0097620_100483642 Ga0097620_1004836422 171
286 3300006931 Ga0097620_100563049 Ga0097620_1005630491 171
287 3300009098 Ga0105245_11116257 Ga0105245_111162572 171
288 3300009101 Ga0105247_10030660 Ga0105247_100306603 171
289 3300009147 Ga0114129_10745894 Ga0114129_107458942 171
290 3300009148 Ga0105243_10138318 Ga0105243_101383182 171
291 3300009174 Ga0105241_11637396 Ga0105241_116373961 171
292 3300009176 Ga0105242_10111081 Ga0105242_101110813 171
293 3300009177 Ga0105248_10117341 Ga0105248_101173413 171
294 3300009177 Ga0105248_11581914 Ga0105248_115819141 171
295 3300009551 Ga0105238_10121394 Ga0105238_101213943 171
296 3300009551 Ga0105238_10382135 Ga0105238_103821352 171
297 3300009553 Ga0105249_10073103 Ga0105249_100731033 171
298 3300013306 Ga0163162_10131414 Ga0163162_101314142 171
299 3300014325 Ga0163163_10002674 Ga0163163_1000267412 171
300 3300014325 Ga0163163_10454508 Ga0163163_104545082 171
301 3300014745 Ga0157377_10102738 Ga0157377_101027383 171
302 3300014745 Ga0157377_10226951 Ga0157377_102269511 171
303 3300014968 Ga0157379_10531779 Ga0157379_105317792 171
304 3300015265 Ga0182005_1082136 Ga0182005_10821362 171
305 3300025900 Ga0207710_10001678 Ga0207710_1000167811 171
306 3300025900 Ga0207710_10126749 Ga0207710_101267493 171
307 3300025904 Ga0207647_10056977 Ga0207647_100569773 171
308 3300025904 Ga0207647_10149388 Ga0207647_101493882 171
309 3300025910 Ga0207684_10000079 Ga0207684_10000079145 171
310 3300025911 Ga0207654_10241282 Ga0207654_102412822 171
311 3300025911 Ga0207654_10469195 Ga0207654_104691951 171
312 3300025913 Ga0207695_10188240 Ga0207695_101882402 171
313 3300025923 Ga0207681_10461060 Ga0207681_104610602 171
314 3300025924 Ga0207694_10008469 Ga0207694_100084697 171
315 3300025925 Ga0207650_10000001 Ga0207650_1000000189 171
316 3300025925 Ga0207650_10269592 Ga0207650_102695922 171
317 3300025935 Ga0207709_10413708 Ga0207709_104137082 171
318 3300025936 Ga0207670_10016298 Ga0207670_100162984 171
319 3300025938 Ga0207704_10172805 Ga0207704_101728053 171
320 3300025940 Ga0207691_10200758 Ga0207691_102007581 171
321 3300025941 Ga0207711_10020880 Ga0207711_100208805 171
322 3300025941 Ga0207711_10836632 Ga0207711_108366321 171
323 3300025945 Ga0207679_10148977 Ga0207679_101489773 171
324 3300025960 Ga0207651_10065607 Ga0207651_100656073 171
325 3300025961 Ga0207712_10012801 Ga0207712_100128012 171
326 3300025981 Ga0207640_10131325 Ga0207640_101313252 171
327 3300026035 Ga0207703_10172510 Ga0207703_101725102 171
328 3300026035 Ga0207703_10792069 Ga0207703_107920692 171
329 3300026041 Ga0207639_10767702 Ga0207639_107677022 171
330 3300026075 Ga0207708_10001910 Ga0207708_1000191011 171
331 3300026078 Ga0207702_11485422 Ga0207702_114854222 171
332 3300026116 Ga0207674_10532662 Ga0207674_105326622 171
333 3300026118 Ga0207675_100989477 Ga0207675_1009894772 171
334 3300028381 Ga0268264_10030508 Ga0268264_100305083 171
335 3300028381 Ga0268264_10153247 Ga0268264_101532472 171
336 3300028381 Ga0268264_10269954 Ga0268264_102699542 171
337 3300031901 Ga0307406_10304586 Ga0307406_103045862 171
338 3300032004 Ga0307414_10334284 Ga0307414_103342842 171
339 3300035092 Ga0373952_0052405 Ga0373952_0052405_408_938 171
340 3300035207 Ga0373942_0006156 Ga0373942_0006156_740_1270 171
341 3300037418 Ga0395900_0182496 Ga0395900_0182496_1579_2094 171
342 3300037466 Ga0395898_0041835 Ga0395898_0041835_2013_2528 171
343 3300038443 Ga0395901_0437083 Ga0395901_0437083_809_1324 171
344 3300038996 Ga0242420_013818 Ga0242420_013818_778_1308 171
345 3300038996 Ga0242420_013910 Ga0242420_013910_197_757 171
346 3300048907 Ga0496104_0494711 Ga0496104_0494711_502_1050 171
347 3300048911 Ga0496108_0942718 Ga0496108_0942718_91_621 171
348 3300048915 Ga0496112_0092496 Ga0496112_0092496_1593_2123 171
349 3300048915 Ga0496112_0191386 Ga0496112_0191386_393_941 171
350 3300049593 Ga0501077_0360342 Ga0501077_0360342_36_569 171
351 3300049649 Ga0501198_053790 Ga0501198_053790_135_650 171
352 3300049661 Ga0501217_012154 Ga0501217_012154_1033_1548 171
353 3300049663 Ga0501223_008794 Ga0501223_008794_146_661 171
354 3300049667 Ga0501230_112206 Ga0501230_112206_67_582 171
355 3300049669 Ga0501235_015477 Ga0501235_015477_1038_1553 171
356 3300049705 Ga0501225_0045814 Ga0501225_0045814_115_630 171
357 3300049779 Ga0501283_026101 Ga0501283_026101_153_668 171
358 3300049850 Ga0501204_007436 Ga0501204_007436_590_1105 171
359 3300050514 nmdc:mga08x19_1646_c2 nmdc:mga08x19_1646_c2_1365_1916 171
360 3300050515 nmdc:mga0a205_122128_c1 nmdc:mga0a205_122128_c1_1052_1600 171
361 3300050515 nmdc:mga0a205_509366_c1 nmdc:mga0a205_509366_c1_342_902 171
362 3300000531 CNBas_1002455 CNBas_10024552 172
363 3300005334 Ga0068869_100022585 Ga0068869_1000225853 172
364 3300005345 Ga0070692_10001914 Ga0070692_100019146 172
365 3300005345 Ga0070692_10036942 Ga0070692_100369422 172
366 3300005366 Ga0070659_101383362 Ga0070659_1013833621 172
367 3300005444 Ga0070694_100007993 Ga0070694_1000079934 172
368 3300005444 Ga0070694_100010270 Ga0070694_1000102703 172
369 3300005444 Ga0070694_100186651 Ga0070694_1001866512 172
370 3300005518 Ga0070699_100560544 Ga0070699_1005605441 172
371 3300005539 Ga0068853_101028990 Ga0068853_1010289901 172
372 3300005546 Ga0070696_100095392 Ga0070696_1000953923 172
373 3300005546 Ga0070696_100454852 Ga0070696_1004548521 172
374 3300005578 Ga0068854_100381409 Ga0068854_1003814092 172
375 3300005719 Ga0068861_100612191 Ga0068861_1006121912 172
376 3300005834 Ga0068851_10045470 Ga0068851_100454702 172
377 3300005840 Ga0068870_10082529 Ga0068870_100825292 172
378 3300006194 Ga0075427_10026017 Ga0075427_100260172 172
379 3300006844 Ga0075428_100202806 Ga0075428_1002028062 172
380 3300009094 Ga0111539_10033381 Ga0111539_100333816 172
381 3300009147 Ga0114129_10119945 Ga0114129_101199454 172
382 3300009174 Ga0105241_10058362 Ga0105241_100583623 172
383 3300009545 Ga0105237_10002452 Ga0105237_1000245213 172
384 3300011119 Ga0105246_10190482 Ga0105246_101904822 172
385 3300013100 Ga0157373_10001793 Ga0157373_1000179310 172
386 3300013306 Ga0163162_10096655 Ga0163162_100966553 172
387 3300013307 Ga0157372_10003813 Ga0157372_1000381310 172
388 3300014968 Ga0157379_10039651 Ga0157379_100396512 172
389 3300025321 Ga0207656_10030417 Ga0207656_100304173 172
390 3300025904 Ga0207647_10183159 Ga0207647_101831593 172
391 3300025908 Ga0207643_10040350 Ga0207643_100403503 172
392 3300025914 Ga0207671_10002542 Ga0207671_100025425 172
393 3300025981 Ga0207640_10745530 Ga0207640_107455301 172
394 3300026075 Ga0207708_10052463 Ga0207708_100524633 172
395 3300031548 Ga0307408_100546663 Ga0307408_1005466632 172
396 3300031824 Ga0307413_10857508 Ga0307413_108575082 172
397 3300031911 Ga0307412_10136054 Ga0307412_101360541 172
398 3300032002 Ga0307416_100269224 Ga0307416_1002692242 172
399 3300048916 Ga0496113_0068052 Ga0496113_0068052_1688_2233 172
400 3300049515 Ga0501292_004553 Ga0501292_004553_82_618 172
401 3300049649 Ga0501198_048325 Ga0501198_048325_120_656 172
402 3300049652 Ga0501202_065489 Ga0501202_065489_148_684 172
403 3300049661 Ga0501217_007802 Ga0501217_007802_871_1407 172
404 3300049665 Ga0501227_002526 Ga0501227_002526_1943_2479 172
405 3300049673 Ga0501240_045470 Ga0501240_045470_117_653 172
406 3300049675 Ga0501243_037892 Ga0501243_037892_273_809 172
407 3300049679 Ga0501249_019795 Ga0501249_019795_769_1305 172
408 3300049706 Ga0501229_016931 Ga0501229_016931_42_578 172
409 3300049775 Ga0501279_024268 Ga0501279_024268_44_580 172
410 3300049851 Ga0501212_005291 Ga0501212_005291_243_779 172
411 3300050507 nmdc:mga05p37_49287_c1 nmdc:mga05p37_49287_c1_2577_3113 172

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xya-assembly1.cif.gz_A crystal structure of a serine protease from streptococcus species 0.7146 51 161
5xyr-assembly1.cif.gz_A crystal structure of a serine protease from streptococcus species 0.7015 51 161
6fwv-assembly2.cif.gz_B the bacillus anthracis tie protein 0.6945 51 161
6fwv-assembly1.cif.gz_A the bacillus anthracis tie protein 0.6834 51 161
6vjb-assembly1.cif.gz_A crystal structure of a catalytically inactive cxc chemokine-degrading protease spycep from streptococcus pyogenes 0.6825 51 171
ID Description Score Start End Superfamily
af_P42787_763_851_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7229 55 161 2.60.40.1120
af_Q54I77_467_541_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.718 54 161 2.60.40.1120
af_Q54I77_467_541_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.6846 54 161 2.60.40.1120
4fxtG01 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.6689 53 161 2.60.40.1120
af_Q9M9H7_342_443_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.6631 53 171 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A6C1QE31-F1-model_v4 Peptidase S8/S53 domain-containing protein 0.8526 110 161 GO:0004252
GO:0006508
AF-A0A7C4VRA9-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.8278 51 161 GO:0016020
AF-A0A843EIZ9-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.8251 52 168
AF-A0A4R7L5R0-F1-model_v4 deleted 0.8184 52 161
AF-A0A7Y7NF29-F1-model_v4 T9SS type A sorting domain-containing protein 0.8172 51 161 GO:0004553
GO:0005975

Feature Viewer

pLDDT pTM Quality
76.44 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map