F437444

General Info

Members Datasets Scaffolds Average Seq Length
411 197 822 108

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100089715|Ga0068869_1000897154
Length 107
Sequence MAGEDSGGRVTHTVRLDRLIGRRVVTANNRPLGRLEECRVERRASAWVVTEWVVGSAGLLERLGLGARLVFGLSRGSSYIIRWDQLDLSDPEKPRLSCPIADLRRAS

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
135 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
147 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
148 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
149 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
150 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
151 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
152 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
153 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
154 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
155 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
156 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
157 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
158 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
159 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
162 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
163 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
164 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
165 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
166 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
167 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
168 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
169 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
170 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
171 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
172 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
173 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
176 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
177 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
178 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
181 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
182 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
183 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
184 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
185 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
186 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
187 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
188 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
189 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
190 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
191 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 2.68
Rhizosphere 96.84
Stem 0
Stem Tuber 0
Unclassified 38.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100089715 3300005334 Unclassified 2309
2 Ga0065712_10070116 3300005290 Bacteria 6314
3 Ga0065712_10107999 3300005290 Bacteria 1884
4 Ga0065715_10028697 3300005293 Bacteria 1478
5 Ga0065715_10040405 3300005293 Bacteria 1070
6 Ga0065715_10109531 3300005293 Bacteria 2664
7 Ga0065715_10827626 3300005293 Unclassified 571
8 Ga0065715_11063911 3300005293 Unclassified 529
9 Ga0065707_10026315 3300005295 Bacteria 1217
10 Ga0070676_10942624 3300005328 Bacteria 645
11 Ga0070670_100000098 3300005331 Bacteria 80608
12 Ga0070670_100018812 3300005331 Bacteria 5922
13 Ga0070670_100062944 3300005331 Unclassified 3184
14 Ga0070670_101819588 3300005331 Bacteria 561
15 Ga0068869_100020141 3300005334 Bacteria 4569
16 Ga0068869_100641402 3300005334 Unclassified 901
17 Ga0068869_101556191 3300005334 Unclassified 588
18 Ga0070680_101266582 3300005336 Bacteria 638
19 Ga0070682_100062269 3300005337 Bacteria 2363
20 Ga0068868_101588072 3300005338 Unclassified 614
21 Ga0070660_101283150 3300005339 Unclassified 621
22 Ga0070689_100614271 3300005340 Bacteria 943
23 Ga0070689_100805545 3300005340 Unclassified 826
24 Ga0070687_100389826 3300005343 Unclassified 910
25 Ga0070661_100789872 3300005344 Bacteria 778
26 Ga0070692_10213360 3300005345 Unclassified 1137
27 Ga0070669_100052385 3300005353 Bacteria 2986
28 Ga0070675_100562754 3300005354 Bacteria 1032
29 Ga0070675_102133674 3300005354 Unclassified 516
30 Ga0070671_101247885 3300005355 Bacteria 655
31 Ga0070673_100411375 3300005364 Bacteria 1211
32 Ga0070673_102075891 3300005364 Bacteria 540
33 Ga0070688_100488856 3300005365 Unclassified 926
34 Ga0070659_100305649 3300005366 Unclassified 1327
35 Ga0070659_100945099 3300005366 Unclassified 755
36 Ga0070703_10002822 3300005406 Bacteria 4977
37 Ga0070703_10317383 3300005406 Bacteria 655
38 Ga0070701_10131893 3300005438 Bacteria 1420
39 Ga0070701_11069619 3300005438 Unclassified 566
40 Ga0070705_100003263 3300005440 Bacteria 7977
41 Ga0070705_100026739 3300005440 Unclassified 3144
42 Ga0070705_100434710 3300005440 Unclassified 981
43 Ga0070705_100468174 3300005440 Bacteria 949
44 Ga0070694_100003204 3300005444 Bacteria 9765
45 Ga0070694_100135593 3300005444 Bacteria 1783
46 Ga0070694_101111392 3300005444 Unclassified 660
47 Ga0070694_101202077 3300005444 Unclassified 635
48 Ga0070663_101434186 3300005455 Unclassified 612
49 Ga0070681_10006697 3300005458 Bacteria 11209
50 Ga0070681_11650422 3300005458 Unclassified 567
51 Ga0068867_100469200 3300005459 Bacteria 1076
52 Ga0068867_101084686 3300005459 Unclassified 730
53 Ga0068853_100749727 3300005539 Bacteria 933
54 Ga0068853_101000825 3300005539 Bacteria 805
55 Ga0068853_101523476 3300005539 Unclassified 647
56 Ga0070672_100131284 3300005543 Bacteria 2059
57 Ga0070695_100157074 3300005545 Bacteria 1593
58 Ga0070695_100309608 3300005545 Unclassified 1170
59 Ga0070695_100324029 3300005545 Unclassified 1146
60 Ga0070695_100408865 3300005545 Bacteria 1031
61 Ga0070696_100007127 3300005546 Bacteria 7467
62 Ga0070696_100138602 3300005546 Bacteria 1775
63 Ga0070696_100186432 3300005546 Unclassified 1542
64 Ga0070696_100272128 3300005546 Bacteria 1288
65 Ga0070693_100058373 3300005547 Bacteria 2233
66 Ga0070693_100179417 3300005547 Bacteria 1362
67 Ga0070693_100274168 3300005547 Bacteria 1127
68 Ga0070665_102423557 3300005548 Unclassified 527
69 Ga0070704_100451596 3300005549 Bacteria 1107
70 Ga0070704_101211766 3300005549 Unclassified 689
71 Ga0068855_100173280 3300005563 Bacteria 2442
72 Ga0068855_100475447 3300005563 Bacteria 1361
73 Ga0068857_100235948 3300005577 Unclassified 1673
74 Ga0068857_100449220 3300005577 Unclassified 1205
75 Ga0068857_102148944 3300005577 Bacteria 548
76 Ga0068857_102407113 3300005577 Unclassified 517
77 Ga0068854_100243828 3300005578 Bacteria 1432
78 Ga0068854_100407905 3300005578 Unclassified 1126
79 Ga0068854_101107275 3300005578 Bacteria 706
80 Ga0068854_101680027 3300005578 Unclassified 580
81 Ga0070702_100010707 3300005615 Bacteria 4531
82 Ga0070702_100107358 3300005615 Bacteria 1724
83 Ga0070702_100715964 3300005615 Bacteria 765
84 Ga0070702_100749396 3300005615 Unclassified 750
85 Ga0068859_100015823 3300005617 Bacteria 7579
86 Ga0068859_100044701 3300005617 Bacteria 4450
87 Ga0068859_100059047 3300005617 Bacteria 3864
88 Ga0068859_100081829 3300005617 Plasmid 3271
89 Ga0068859_100232185 3300005617 Bacteria 1933
90 Ga0068859_100299364 3300005617 Bacteria 1702
91 Ga0068859_100541512 3300005617 Unclassified 1259
92 Ga0068859_101001741 3300005617 Bacteria 917
93 Ga0068859_101620744 3300005617 Bacteria 715
94 Ga0068864_100002682 3300005618 Bacteria 14675
95 Ga0068864_100028771 3300005618 Bacteria 4701
96 Ga0068864_100547621 3300005618 Bacteria 1118
97 Ga0068864_100584377 3300005618 Bacteria 1082
98 Ga0068864_100691403 3300005618 Bacteria 996
99 Ga0068864_100950104 3300005618 Bacteria 850
100 Ga0068864_102537401 3300005618 Bacteria 519
101 Ga0068866_10210429 3300005718 Bacteria 1167
102 Ga0068851_10001358 3300005834 Bacteria 10679
103 Ga0068851_10898601 3300005834 Unclassified 555
104 Ga0068870_10022734 3300005840 Bacteria 3084
105 Ga0068870_10342255 3300005840 Unclassified 957
106 Ga0068863_100019907 3300005841 Bacteria 6419
107 Ga0068858_100038049 3300005842 Bacteria 4462
108 Ga0068858_100203992 3300005842 Unclassified 1870
109 Ga0068858_100270287 3300005842 Bacteria 1618
110 Ga0068858_100330255 3300005842 Unclassified 1458
111 Ga0068858_101867164 3300005842 Bacteria 594
112 Ga0068860_100106064 3300005843 Unclassified 2683
113 Ga0068860_100172318 3300005843 Bacteria 2090
114 Ga0068860_100234354 3300005843 Bacteria 1784
115 Ga0068860_100630306 3300005843 Bacteria 1079
116 Ga0068862_102487525 3300005844 Unclassified 530
117 Ga0081539_10000119 3300005985 Bacteria 184136
118 Ga0075367_10194949 3300006178 Bacteria 1265
119 Ga0068871_100145274 3300006358 Bacteria 2019
120 Ga0075428_100248939 3300006844 Unclassified 1916
121 Ga0075433_10001076 3300006852 Bacteria 19643
122 Ga0075433_10045029 3300006852 Bacteria 3834
123 Ga0075433_10087034 3300006852 Bacteria 2759
124 Ga0075433_10114939 3300006852 Unclassified 2388
125 Ga0075433_10183081 3300006852 Bacteria 1864
126 Ga0075434_100010654 3300006871 Bacteria 8630
127 Ga0097620_100015824 3300006931 Bacteria 7579
128 Ga0097620_100044703 3300006931 Bacteria 4450
129 Ga0097620_100059058 3300006931 Bacteria 3864
130 Ga0097620_100081830 3300006931 Plasmid 3271
131 Ga0097620_100232201 3300006931 Bacteria 1933
132 Ga0097620_100299340 3300006931 Bacteria 1702
133 Ga0097620_100541597 3300006931 Unclassified 1259
134 Ga0097620_101001716 3300006931 Bacteria 917
135 Ga0097620_101620666 3300006931 Bacteria 715
136 Ga0105240_10096752 3300009093 Unclassified 3597
137 Ga0105240_11261600 3300009093 Unclassified 780
138 Ga0105240_12559392 3300009093 Unclassified 527
139 Ga0111539_10049890 3300009094 Bacteria 4988
140 Ga0105245_11326621 3300009098 Unclassified 769
141 Ga0105245_12675462 3300009098 Unclassified 552
142 Ga0105245_12811234 3300009098 Unclassified 539
143 Ga0105247_10000841 3300009101 Bacteria 23337
144 Ga0105247_10008706 3300009101 Bacteria 6186
145 Ga0105247_10017097 3300009101 Bacteria 4354
146 Ga0105247_10483938 3300009101 Bacteria 899
147 Ga0114129_10028076 3300009147 Bacteria 7972
148 Ga0114129_10251719 3300009147 Bacteria 2371
149 Ga0114129_11179744 3300009147 Bacteria 955
150 Ga0114129_12841411 3300009147 Bacteria 574
151 Ga0105243_10014264 3300009148 Bacteria 6013
152 Ga0105243_10455691 3300009148 Bacteria 1201
153 Ga0105243_11270959 3300009148 Unclassified 752
154 Ga0105241_10003816 3300009174 Bacteria 11170
155 Ga0105241_10076223 3300009174 Bacteria 2614
156 Ga0105241_10489133 3300009174 Bacteria 1095
157 Ga0105241_10836362 3300009174 Bacteria 850
158 Ga0105241_11269329 3300009174 Bacteria 700
159 Ga0105242_10023657 3300009176 Unclassified 4843
160 Ga0105242_10624354 3300009176 Bacteria 1044
161 Ga0105242_10693064 3300009176 Bacteria 996
162 Ga0105242_10836949 3300009176 Bacteria 914
163 Ga0105248_10048428 3300009177 Bacteria 4768
164 Ga0105248_10633369 3300009177 Bacteria 1206
165 Ga0105248_10814059 3300009177 Unclassified 1054
166 Ga0105248_11256723 3300009177 Bacteria 837
167 Ga0105237_10000199 3300009545 Bacteria 85277
168 Ga0105237_11297611 3300009545 Bacteria 734
169 Ga0105238_10006163 3300009551 Bacteria 11903
170 Ga0105238_10182322 3300009551 Bacteria 2076
171 Ga0105238_10925088 3300009551 Unclassified 891
172 Ga0105239_10736067 3300010375 Bacteria 1128
173 Ga0105239_10736392 3300010375 Unclassified 1128
174 Ga0105246_10458887 3300011119 Bacteria 1073
175 Ga0157373_10005740 3300013100 Bacteria 9295
176 Ga0157373_10568715 3300013100 Unclassified 823
177 Ga0157373_10879426 3300013100 Bacteria 664
178 Ga0157373_11552070 3300013100 Unclassified 506
179 Ga0157374_11532926 3300013296 Bacteria 690
180 Ga0157378_10575806 3300013297 Bacteria 1134
181 Ga0157378_10965019 3300013297 Bacteria 885
182 Ga0157378_12855909 3300013297 Bacteria 535
183 Ga0163162_10618660 3300013306 Bacteria 1208
184 Ga0157372_10390310 3300013307 Bacteria 1622
185 Ga0157372_12381019 3300013307 Unclassified 608
186 Ga0157375_10472306 3300013308 Bacteria 1419
187 Ga0157375_13408154 3300013308 Unclassified 529
188 Ga0163163_10000465 3300014325 Bacteria 36944
189 Ga0163163_10023226 3300014325 Bacteria 5883
190 Ga0157377_10184930 3300014745 Bacteria 1313
191 Ga0157379_10007512 3300014968 Bacteria 9434
192 Ga0157379_10029754 3300014968 Bacteria 4856
193 Ga0157379_10167793 3300014968 Bacteria 1982
194 Ga0163161_11835749 3300017792 Bacteria 539
195 Ga0207656_10001285 3300025321 Bacteria 8249
196 Ga0207653_10005858 3300025885 Bacteria 3834
197 Ga0207710_10000563 3300025900 Bacteria 22203
198 Ga0207710_10112462 3300025900 Bacteria 1294
199 Ga0207680_10599401 3300025903 Unclassified 788
200 Ga0207647_10063381 3300025904 Bacteria 2248
201 Ga0207647_10439960 3300025904 Bacteria 731
202 Ga0207645_10549295 3300025907 Unclassified 783
203 Ga0207643_10028739 3300025908 Bacteria 3090
204 Ga0207643_10054064 3300025908 Unclassified 2282
205 Ga0207654_10280516 3300025911 Bacteria 1127
206 Ga0207654_11027228 3300025911 Unclassified 600
207 Ga0207707_10005841 3300025912 Bacteria 10754
208 Ga0207707_10280619 3300025912 Unclassified 1443
209 Ga0207695_10230652 3300025913 Bacteria 1756
210 Ga0207695_10491469 3300025913 Bacteria 1109
211 Ga0207671_10001814 3300025914 Bacteria 23845
212 Ga0207671_10242047 3300025914 Bacteria 1417
213 Ga0207671_10946498 3300025914 Bacteria 680
214 Ga0207662_10088599 3300025918 Bacteria 1900
215 Ga0207694_10189806 3300025924 Bacteria 1669
216 Ga0207650_10000156 3300025925 Bacteria 81983
217 Ga0207650_10013627 3300025925 Bacteria 5634
218 Ga0207650_10120347 3300025925 Bacteria 2043
219 Ga0207650_10345333 3300025925 Bacteria 1223
220 Ga0207650_11704521 3300025925 Bacteria 534
221 Ga0207687_11064687 3300025927 Unclassified 694
222 Ga0207690_10073952 3300025932 Unclassified 2359
223 Ga0207706_11441778 3300025933 Unclassified 564
224 Ga0207709_10052009 3300025935 Bacteria 2513
225 Ga0207709_11573140 3300025935 Unclassified 546
226 Ga0207709_11721730 3300025935 Unclassified 521
227 Ga0207704_10425370 3300025938 Bacteria 1054
228 Ga0207704_11091206 3300025938 Unclassified 678
229 Ga0207691_10550782 3300025940 Bacteria 978
230 Ga0207691_10624889 3300025940 Bacteria 911
231 Ga0207711_10082595 3300025941 Bacteria 2809
232 Ga0207711_10371092 3300025941 Bacteria 1327
233 Ga0207689_10101069 3300025942 Unclassified 2368
234 Ga0207689_10411990 3300025942 Bacteria 1127
235 Ga0207689_10574568 3300025942 Bacteria 947
236 Ga0207679_10503215 3300025945 Bacteria 1081
237 Ga0207679_11086754 3300025945 Bacteria 734
238 Ga0207679_11103759 3300025945 Unclassified 728
239 Ga0207679_11733353 3300025945 Bacteria 571
240 Ga0207640_10083948 3300025981 Bacteria 2185
241 Ga0207640_10861271 3300025981 Unclassified 789
242 Ga0207640_10862132 3300025981 Unclassified 789
243 Ga0207640_11709198 3300025981 Unclassified 568
244 Ga0207640_12069386 3300025981 Unclassified 516
245 Ga0207677_10585292 3300026023 Unclassified 977
246 Ga0207703_10040173 3300026035 Bacteria 3743
247 Ga0207703_10045389 3300026035 Bacteria 3535
248 Ga0207703_10117011 3300026035 Bacteria 2283
249 Ga0207703_10134753 3300026035 Bacteria 2137
250 Ga0207703_10765755 3300026035 Bacteria 920
251 Ga0207639_10420030 3300026041 Bacteria 1209
252 Ga0207639_10873318 3300026041 Unclassified 840
253 Ga0207678_10962181 3300026067 Unclassified 755
254 Ga0207678_11427629 3300026067 Bacteria 612
255 Ga0207708_10009787 3300026075 Bacteria 7111
256 Ga0207641_10157840 3300026088 Unclassified 2060
257 Ga0207641_10775098 3300026088 Unclassified 948
258 Ga0207641_11211858 3300026088 Bacteria 755
259 Ga0207641_11598375 3300026088 Bacteria 654
260 Ga0207648_10119700 3300026089 Bacteria 2314
261 Ga0207648_10908290 3300026089 Unclassified 823
262 Ga0207676_10201123 3300026095 Unclassified 1760
263 Ga0207676_10247509 3300026095 Bacteria 1603
264 Ga0207676_10597247 3300026095 Bacteria 1060
265 Ga0207676_10808597 3300026095 Bacteria 915
266 Ga0207676_11029834 3300026095 Unclassified 812
267 Ga0207676_11070379 3300026095 Bacteria 796
268 Ga0207676_11184367 3300026095 Bacteria 757
269 Ga0207676_11425371 3300026095 Unclassified 689
270 Ga0207676_12466135 3300026095 Unclassified 517
271 Ga0207674_10117920 3300026116 Bacteria 2625
272 Ga0207674_10586509 3300026116 Bacteria 1077
273 Ga0207674_10680223 3300026116 Bacteria 993
274 Ga0207674_10952544 3300026116 Bacteria 827
275 Ga0207674_11254427 3300026116 Unclassified 711
276 Ga0207674_11578713 3300026116 Unclassified 625
277 Ga0207674_11680062 3300026116 Bacteria 603
278 Ga0207675_100147504 3300026118 Bacteria 2238
279 Ga0207675_100787576 3300026118 Unclassified 963
280 Ga0207698_11996471 3300026142 Unclassified 594
281 Ga0207698_12686019 3300026142 Unclassified 507
282 Ga0207428_10532068 3300027907 Unclassified 851
283 Ga0268266_11979651 3300028379 Unclassified 556
284 Ga0268265_10806890 3300028380 Bacteria 915
285 Ga0268264_10045416 3300028381 Bacteria 3647
286 Ga0268264_10075759 3300028381 Unclassified 2861
287 Ga0268264_11147076 3300028381 Bacteria 786
288 Ga0268264_12694065 3300028381 Unclassified 501
289 Ga0307408_100003938 3300031548 Bacteria 10115
290 Ga0307408_100069644 3300031548 Bacteria 2595
291 Ga0307405_10004763 3300031731 Bacteria 6465
292 Ga0307413_10112242 3300031824 Bacteria 1827
293 Ga0307410_10100838 3300031852 Bacteria 2069
294 Ga0307406_10056123 3300031901 Bacteria 2520
295 Ga0307407_10204973 3300031903 Bacteria 1324
296 Ga0307409_100319101 3300031995 Bacteria 1453
297 Ga0307416_101055816 3300032002 Unclassified 916
298 Ga0307416_102182703 3300032002 Unclassified 655
299 Ga0307414_10001159 3300032004 Bacteria 13522
300 Ga0307414_10332244 3300032004 Bacteria 1298
301 Ga0307411_10029299 3300032005 Unclassified 3359
302 Ga0307415_100040643 3300032126 Bacteria 3082
303 Ga0307415_100705938 3300032126 Bacteria 911
304 Ga0373951_0185593 3300035091 Bacteria 599
305 Ga0373961_0101091 3300035241 Bacteria 934
306 Ga0373931_0295364 3300035691 Bacteria 999
307 Ga0395900_1195071 3300037418 Unclassified 676
308 Ga0395898_0430274 3300037466 Bacteria 1258
309 Ga0395901_0471784 3300038443 Bacteria 1281
310 Ga0242422_00500 3300038699 Bacteria 2501
311 Ga0242420_004461 3300038996 Bacteria 2117
312 Ga0439448_0046530 3300042005 Bacteria 1414
313 Ga0451577_0528863 3300042876 Bacteria 1071
314 Ga0451576_1262003 3300045051 Unclassified 771
315 Ga0496104_0015076 3300048907 Bacteria 6995
316 Ga0496106_0117794 3300048909 Unclassified 2073
317 Ga0496107_0285677 3300048910 Bacteria 1228
318 Ga0496108_0006370 3300048911 Bacteria 9567
319 Ga0496108_0234264 3300048911 Unclassified 1597
320 Ga0496110_1481392 3300048913 Unclassified 588
321 Ga0496112_0036864 3300048915 Bacteria 4770
322 Ga0496112_0754833 3300048915 Bacteria 899
323 Ga0496112_0892592 3300048915 Unclassified 811
324 Ga0496113_0011385 3300048916 Bacteria 5930
325 Ga0496113_0523767 3300048916 Unclassified 951
326 Ga0501291_042570 3300049514 Unclassified 803
327 Ga0501292_010425 3300049515 Unclassified 1391
328 Ga0501292_055122 3300049515 Unclassified 711
329 Ga0501295_165680 3300049518 Unclassified 551
330 Ga0501303_012581 3300049526 Unclassified 817
331 Ga0501303_062735 3300049526 Unclassified 511
332 Ga0501198_007272 3300049649 Bacteria 1590
333 Ga0501198_024421 3300049649 Unclassified 978
334 Ga0501199_004548 3300049650 Bacteria 1368
335 Ga0501201_049270 3300049651 Unclassified 522
336 Ga0501202_012489 3300049652 Bacteria 1603
337 Ga0501202_032584 3300049652 Unclassified 1094
338 Ga0501202_072777 3300049652 Unclassified 795
339 Ga0501206_006374 3300049653 Bacteria 1533
340 Ga0501206_064703 3300049653 Bacteria 607
341 Ga0501207_025062 3300049654 Unclassified 976
342 Ga0501208_005845 3300049655 Bacteria 1535
343 Ga0501209_014087 3300049656 Bacteria 1748
344 Ga0501209_033210 3300049656 Bacteria 1323
345 Ga0501216_016729 3300049660 Unclassified 1247
346 Ga0501216_033609 3300049660 Bacteria 957
347 Ga0501217_003896 3300049661 Unclassified 3039
348 Ga0501217_005830 3300049661 Unclassified 2590
349 Ga0501217_128215 3300049661 Bacteria 742
350 Ga0501217_280554 3300049661 Unclassified 545
351 Ga0501223_002735 3300049663 Bacteria 3877
352 Ga0501223_004286 3300049663 Unclassified 3064
353 Ga0501224_047059 3300049664 Unclassified 657
354 Ga0501227_001899 3300049665 Bacteria 4631
355 Ga0501227_003302 3300049665 Bacteria 3502
356 Ga0501230_001431 3300049667 Unclassified 2840
357 Ga0501233_000236 3300049668 Bacteria 8343
358 Ga0501233_033931 3300049668 Unclassified 1168
359 Ga0501233_039619 3300049668 Unclassified 1102
360 Ga0501233_169775 3300049668 Unclassified 619
361 Ga0501235_000935 3300049669 Bacteria 6034
362 Ga0501235_014434 3300049669 Unclassified 1741
363 Ga0501236_057967 3300049670 Unclassified 681
364 Ga0501239_016906 3300049672 Unclassified 865
365 Ga0501243_003158 3300049675 Unclassified 2435
366 Ga0501243_079810 3300049675 Unclassified 635
367 Ga0501247_048477 3300049677 Unclassified 624
368 Ga0501249_098257 3300049679 Unclassified 699
369 Ga0501250_001592 3300049680 Bacteria 1910
370 Ga0501251_019871 3300049681 Unclassified 883
371 Ga0501252_045149 3300049682 Unclassified 650
372 Ga0501257_013742 3300049686 Bacteria 1858
373 Ga0501257_038580 3300049686 Unclassified 1168
374 Ga0501257_111571 3300049686 Unclassified 725
375 Ga0501257_121244 3300049686 Unclassified 700
376 Ga0501259_022386 3300049688 Unclassified 1135
377 Ga0501260_010467 3300049689 Unclassified 931
378 Ga0501260_011356 3300049689 Unclassified 901
379 Ga0501219_015377 3300049703 Unclassified 619
380 Ga0501221_005872 3300049704 Unclassified 2063
381 Ga0501221_007426 3300049704 Unclassified 1881
382 Ga0501225_0000779 3300049705 Bacteria 9947
383 Ga0501225_0018107 3300049705 Unclassified 1954
384 Ga0501229_005488 3300049706 Unclassified 1559
385 Ga0501229_008722 3300049706 Bacteria 1270
386 Ga0501234_001206 3300049707 Bacteria 4076
387 Ga0501245_015546 3300049708 Bacteria 1146
388 Ga0501263_012125 3300049760 Unclassified 1078
389 Ga0501267_030025 3300049764 Unclassified 637
390 Ga0501268_005252 3300049765 Unclassified 1856
391 Ga0501269_015538 3300049766 Unclassified 936
392 Ga0501273_006788 3300049770 Bacteria 1334
393 Ga0501279_021959 3300049775 Unclassified 914
394 Ga0501283_006862 3300049779 Bacteria 1607
395 Ga0501204_017849 3300049850 Unclassified 902
396 Ga0501204_028442 3300049850 Bacteria 765
397 Ga0501226_000853 3300049853 Bacteria 4084
398 nmdc:mga06z11_163016_c1 3300050494 Unclassified 1275
399 nmdc:mga05p37_1432605_c1 3300050507 Unclassified 693
400 nmdc:mga05p37_205901_c1 3300050507 Bacteria 2380
401 nmdc:mga05p37_74348_c1 3300050507 Bacteria 4182
402 nmdc:mga08y16_132893_c1 3300050511 Unclassified 2587
403 nmdc:mga0n895_2147948_c1 3300050512 Unclassified 514
404 nmdc:mga0n895_609059_c1 3300050512 Unclassified 1094
405 nmdc:mga0n895_89333_c1 3300050512 Bacteria 3082
406 nmdc:mga0rr50_17008_c1 3300050513 Bacteria 4844
407 nmdc:mga0a205_133511_c1 3300050515 Bacteria 2383
408 nmdc:mga0a205_152470_c1 3300050515 Unclassified 2210
409 nmdc:mga0a205_23201_c1 3300050515 Bacteria 5885
410 nmdc:mga0a205_24686_c1 3300050515 Bacteria 5719
411 nmdc:mga0a205_848_c1 3300050515 Bacteria 25049
412 Ga0068869_100089715
413 Ga0065712_10070116
414 Ga0065712_10107999
415 Ga0065715_10028697
416 Ga0065715_10040405
417 Ga0065715_10109531
418 Ga0065715_10827626
419 Ga0065715_11063911
420 Ga0065707_10026315
421 Ga0070676_10942624
422 Ga0070670_100000098
423 Ga0070670_100018812
424 Ga0070670_100062944
425 Ga0070670_101819588
426 Ga0068869_100020141
427 Ga0068869_100641402
428 Ga0068869_101556191
429 Ga0070680_101266582
430 Ga0070682_100062269
431 Ga0068868_101588072
432 Ga0070660_101283150
433 Ga0070689_100614271
434 Ga0070689_100805545
435 Ga0070687_100389826
436 Ga0070661_100789872
437 Ga0070692_10213360
438 Ga0070669_100052385
439 Ga0070675_100562754
440 Ga0070675_102133674
441 Ga0070671_101247885
442 Ga0070673_100411375
443 Ga0070673_102075891
444 Ga0070688_100488856
445 Ga0070659_100305649
446 Ga0070659_100945099
447 Ga0070703_10002822
448 Ga0070703_10317383
449 Ga0070701_10131893
450 Ga0070701_11069619
451 Ga0070705_100003263
452 Ga0070705_100026739
453 Ga0070705_100434710
454 Ga0070705_100468174
455 Ga0070694_100003204
456 Ga0070694_100135593
457 Ga0070694_101111392
458 Ga0070694_101202077
459 Ga0070663_101434186
460 Ga0070681_10006697
461 Ga0070681_11650422
462 Ga0068867_100469200
463 Ga0068867_101084686
464 Ga0068853_100749727
465 Ga0068853_101000825
466 Ga0068853_101523476
467 Ga0070672_100131284
468 Ga0070695_100157074
469 Ga0070695_100309608
470 Ga0070695_100324029
471 Ga0070695_100408865
472 Ga0070696_100007127
473 Ga0070696_100138602
474 Ga0070696_100186432
475 Ga0070696_100272128
476 Ga0070693_100058373
477 Ga0070693_100179417
478 Ga0070693_100274168
479 Ga0070665_102423557
480 Ga0070704_100451596
481 Ga0070704_101211766
482 Ga0068855_100173280
483 Ga0068855_100475447
484 Ga0068857_100235948
485 Ga0068857_100449220
486 Ga0068857_102148944
487 Ga0068857_102407113
488 Ga0068854_100243828
489 Ga0068854_100407905
490 Ga0068854_101107275
491 Ga0068854_101680027
492 Ga0070702_100010707
493 Ga0070702_100107358
494 Ga0070702_100715964
495 Ga0070702_100749396
496 Ga0068859_100015823
497 Ga0068859_100044701
498 Ga0068859_100059047
499 Ga0068859_100081829
500 Ga0068859_100232185
501 Ga0068859_100299364
502 Ga0068859_100541512
503 Ga0068859_101001741
504 Ga0068859_101620744
505 Ga0068864_100002682
506 Ga0068864_100028771
507 Ga0068864_100547621
508 Ga0068864_100584377
509 Ga0068864_100691403
510 Ga0068864_100950104
511 Ga0068864_102537401
512 Ga0068866_10210429
513 Ga0068851_10001358
514 Ga0068851_10898601
515 Ga0068870_10022734
516 Ga0068870_10342255
517 Ga0068863_100019907
518 Ga0068858_100038049
519 Ga0068858_100203992
520 Ga0068858_100270287
521 Ga0068858_100330255
522 Ga0068858_101867164
523 Ga0068860_100106064
524 Ga0068860_100172318
525 Ga0068860_100234354
526 Ga0068860_100630306
527 Ga0068862_102487525
528 Ga0081539_10000119
529 Ga0075367_10194949
530 Ga0068871_100145274
531 Ga0075428_100248939
532 Ga0075433_10001076
533 Ga0075433_10045029
534 Ga0075433_10087034
535 Ga0075433_10114939
536 Ga0075433_10183081
537 Ga0075434_100010654
538 Ga0097620_100015824
539 Ga0097620_100044703
540 Ga0097620_100059058
541 Ga0097620_100081830
542 Ga0097620_100232201
543 Ga0097620_100299340
544 Ga0097620_100541597
545 Ga0097620_101001716
546 Ga0097620_101620666
547 Ga0105240_10096752
548 Ga0105240_11261600
549 Ga0105240_12559392
550 Ga0111539_10049890
551 Ga0105245_11326621
552 Ga0105245_12675462
553 Ga0105245_12811234
554 Ga0105247_10000841
555 Ga0105247_10008706
556 Ga0105247_10017097
557 Ga0105247_10483938
558 Ga0114129_10028076
559 Ga0114129_10251719
560 Ga0114129_11179744
561 Ga0114129_12841411
562 Ga0105243_10014264
563 Ga0105243_10455691
564 Ga0105243_11270959
565 Ga0105241_10003816
566 Ga0105241_10076223
567 Ga0105241_10489133
568 Ga0105241_10836362
569 Ga0105241_11269329
570 Ga0105242_10023657
571 Ga0105242_10624354
572 Ga0105242_10693064
573 Ga0105242_10836949
574 Ga0105248_10048428
575 Ga0105248_10633369
576 Ga0105248_10814059
577 Ga0105248_11256723
578 Ga0105237_10000199
579 Ga0105237_11297611
580 Ga0105238_10006163
581 Ga0105238_10182322
582 Ga0105238_10925088
583 Ga0105239_10736067
584 Ga0105239_10736392
585 Ga0105246_10458887
586 Ga0157373_10005740
587 Ga0157373_10568715
588 Ga0157373_10879426
589 Ga0157373_11552070
590 Ga0157374_11532926
591 Ga0157378_10575806
592 Ga0157378_10965019
593 Ga0157378_12855909
594 Ga0163162_10618660
595 Ga0157372_10390310
596 Ga0157372_12381019
597 Ga0157375_10472306
598 Ga0157375_13408154
599 Ga0163163_10000465
600 Ga0163163_10023226
601 Ga0157377_10184930
602 Ga0157379_10007512
603 Ga0157379_10029754
604 Ga0157379_10167793
605 Ga0163161_11835749
606 Ga0207656_10001285
607 Ga0207653_10005858
608 Ga0207710_10000563
609 Ga0207710_10112462
610 Ga0207680_10599401
611 Ga0207647_10063381
612 Ga0207647_10439960
613 Ga0207645_10549295
614 Ga0207643_10028739
615 Ga0207643_10054064
616 Ga0207654_10280516
617 Ga0207654_11027228
618 Ga0207707_10005841
619 Ga0207707_10280619
620 Ga0207695_10230652
621 Ga0207695_10491469
622 Ga0207671_10001814
623 Ga0207671_10242047
624 Ga0207671_10946498
625 Ga0207662_10088599
626 Ga0207694_10189806
627 Ga0207650_10000156
628 Ga0207650_10013627
629 Ga0207650_10120347
630 Ga0207650_10345333
631 Ga0207650_11704521
632 Ga0207687_11064687
633 Ga0207690_10073952
634 Ga0207706_11441778
635 Ga0207709_10052009
636 Ga0207709_11573140
637 Ga0207709_11721730
638 Ga0207704_10425370
639 Ga0207704_11091206
640 Ga0207691_10550782
641 Ga0207691_10624889
642 Ga0207711_10082595
643 Ga0207711_10371092
644 Ga0207689_10101069
645 Ga0207689_10411990
646 Ga0207689_10574568
647 Ga0207679_10503215
648 Ga0207679_11086754
649 Ga0207679_11103759
650 Ga0207679_11733353
651 Ga0207640_10083948
652 Ga0207640_10861271
653 Ga0207640_10862132
654 Ga0207640_11709198
655 Ga0207640_12069386
656 Ga0207677_10585292
657 Ga0207703_10040173
658 Ga0207703_10045389
659 Ga0207703_10117011
660 Ga0207703_10134753
661 Ga0207703_10765755
662 Ga0207639_10420030
663 Ga0207639_10873318
664 Ga0207678_10962181
665 Ga0207678_11427629
666 Ga0207708_10009787
667 Ga0207641_10157840
668 Ga0207641_10775098
669 Ga0207641_11211858
670 Ga0207641_11598375
671 Ga0207648_10119700
672 Ga0207648_10908290
673 Ga0207676_10201123
674 Ga0207676_10247509
675 Ga0207676_10597247
676 Ga0207676_10808597
677 Ga0207676_11029834
678 Ga0207676_11070379
679 Ga0207676_11184367
680 Ga0207676_11425371
681 Ga0207676_12466135
682 Ga0207674_10117920
683 Ga0207674_10586509
684 Ga0207674_10680223
685 Ga0207674_10952544
686 Ga0207674_11254427
687 Ga0207674_11578713
688 Ga0207674_11680062
689 Ga0207675_100147504
690 Ga0207675_100787576
691 Ga0207698_11996471
692 Ga0207698_12686019
693 Ga0207428_10532068
694 Ga0268266_11979651
695 Ga0268265_10806890
696 Ga0268264_10045416
697 Ga0268264_10075759
698 Ga0268264_11147076
699 Ga0268264_12694065
700 Ga0307408_100003938
701 Ga0307408_100069644
702 Ga0307405_10004763
703 Ga0307413_10112242
704 Ga0307410_10100838
705 Ga0307406_10056123
706 Ga0307407_10204973
707 Ga0307409_100319101
708 Ga0307416_101055816
709 Ga0307416_102182703
710 Ga0307414_10001159
711 Ga0307414_10332244
712 Ga0307411_10029299
713 Ga0307415_100040643
714 Ga0307415_100705938
715 Ga0373951_0185593
716 Ga0373961_0101091
717 Ga0373931_0295364
718 Ga0395900_1195071
719 Ga0395898_0430274
720 Ga0395901_0471784
721 Ga0242422_00500
722 Ga0242420_004461
723 Ga0439448_0046530
724 Ga0451577_0528863
725 Ga0451576_1262003
726 Ga0496104_0015076
727 Ga0496106_0117794
728 Ga0496107_0285677
729 Ga0496108_0006370
730 Ga0496108_0234264
731 Ga0496110_1481392
732 Ga0496112_0036864
733 Ga0496112_0754833
734 Ga0496112_0892592
735 Ga0496113_0011385
736 Ga0496113_0523767
737 Ga0501291_042570
738 Ga0501292_010425
739 Ga0501292_055122
740 Ga0501295_165680
741 Ga0501303_012581
742 Ga0501303_062735
743 Ga0501198_007272
744 Ga0501198_024421
745 Ga0501199_004548
746 Ga0501201_049270
747 Ga0501202_012489
748 Ga0501202_032584
749 Ga0501202_072777
750 Ga0501206_006374
751 Ga0501206_064703
752 Ga0501207_025062
753 Ga0501208_005845
754 Ga0501209_014087
755 Ga0501209_033210
756 Ga0501216_016729
757 Ga0501216_033609
758 Ga0501217_003896
759 Ga0501217_005830
760 Ga0501217_128215
761 Ga0501217_280554
762 Ga0501223_002735
763 Ga0501223_004286
764 Ga0501224_047059
765 Ga0501227_001899
766 Ga0501227_003302
767 Ga0501230_001431
768 Ga0501233_000236
769 Ga0501233_033931
770 Ga0501233_039619
771 Ga0501233_169775
772 Ga0501235_000935
773 Ga0501235_014434
774 Ga0501236_057967
775 Ga0501239_016906
776 Ga0501243_003158
777 Ga0501243_079810
778 Ga0501247_048477
779 Ga0501249_098257
780 Ga0501250_001592
781 Ga0501251_019871
782 Ga0501252_045149
783 Ga0501257_013742
784 Ga0501257_038580
785 Ga0501257_111571
786 Ga0501257_121244
787 Ga0501259_022386
788 Ga0501260_010467
789 Ga0501260_011356
790 Ga0501219_015377
791 Ga0501221_005872
792 Ga0501221_007426
793 Ga0501225_0000779
794 Ga0501225_0018107
795 Ga0501229_005488
796 Ga0501229_008722
797 Ga0501234_001206
798 Ga0501245_015546
799 Ga0501263_012125
800 Ga0501267_030025
801 Ga0501268_005252
802 Ga0501269_015538
803 Ga0501273_006788
804 Ga0501279_021959
805 Ga0501283_006862
806 Ga0501204_017849
807 Ga0501204_028442
808 Ga0501226_000853
809 nmdc:mga06z11_163016_c1
810 nmdc:mga05p37_1432605_c1
811 nmdc:mga05p37_205901_c1
812 nmdc:mga05p37_74348_c1
813 nmdc:mga08y16_132893_c1
814 nmdc:mga0n895_2147948_c1
815 nmdc:mga0n895_609059_c1
816 nmdc:mga0n895_89333_c1
817 nmdc:mga0rr50_17008_c1
818 nmdc:mga0a205_133511_c1
819 nmdc:mga0a205_152470_c1
820 nmdc:mga0a205_23201_c1
821 nmdc:mga0a205_24686_c1
822 nmdc:mga0a205_848_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g7f-assembly1.cif.gz_H crystal structure of blastochloris viridis heterodimer mutant reaction center 0.8009 12 93
7q7q-assembly1.cif.gz_HHH lipidic cubic phase serial femtosecond crystallography structure of a photosynthetic reaction centre 0.7893 12 93
7q7p-assembly1.cif.gz_HHH lipidic cubic phase serial femtosecond crystallography structure of a photosynthetic reaction centre 0.7877 12 93
5b5n-assembly2.cif.gz_t crystal structure of the ba-substituted lh1-rc complex from tch. tepidum 0.787 11 93
4rcr-assembly1.cif.gz_H structure of the reaction center from rhodobacter sphaeroides r-26 and 2.4.1: protein-cofactor (bacteriochlorophyll, bacteriopheophytin, and carotenoid) interactions 0.7858 12 89
ID Description Score Start End Superfamily
af_Q4CTW2_96_636_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8249 27 46 3.50.50.60
af_A0A2R8QBC4_2164_2430_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7872 25 46 3.40.50.300
1dxrH02 Alpha Beta;Alpha-Beta Complex;Photosynthetic Reaction Center; Chain H, domain 2;Photosynthetic Reaction Center, subunit H, domain 2 0.7726 12 93 3.90.50.10
1pm3B00 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.7564 4 93 2.30.30.240
af_Q6H8A9_21_179_2.170.150.80 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;NAC domain 0.7504 29 46 2.170.150.80
ID Description Score Start End GO Terms
AF-A0A1I5VHJ9-F1-model_v4 PRC-barrel domain-containing protein 0.9354 2 100
AF-A0A529HT73-F1-model_v4 deleted 0.9247 27 100
AF-A0A3S3M4S7-F1-model_v4 PRC-barrel domain containing protein 0.9222 3 101
AF-A0A3S3M4S7-F1-model_v4 PRC-barrel domain containing protein 0.905 3 101
AF-A0A7I0K4A5-F1-model_v4 PRC-barrel domain containing protein 0.8903 2 109

Map