F437241

General Info

Members Datasets Scaffolds Average Seq Length
410 236 820 350

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10076870|Ga0157371_100768702
Length 376
Sequence MRGSATRTDRRDTRVARFDSRAASGAPIADASDASAETITIAVDTMGGDYGPPVTVAAALAFLAKTPRARVILVGRENEVRQAVAANRTIASDRVVVQAASEVVEMREPPADALRRKKDSSMRVAINLVKDGAAQACVSAGNTGALMAISRFVLKTLPGIDRPAIASQLPTRTGVTTALDLGANVNCTPAQLVQFAVMGSALAAAVDGIERPTVGLLNIGEEDIKGNDVVKQTGELLKASDLNYYGNVDVIVCDGFVGNVALKTSEGLALMLSDFLREEFTRNPLRKLLVVFALPAIKAFKRRVDPRRYNGATLIGLKGIVVKSHGSADVFAFQQALKKAYAEAANGVLERIARRLAAMPVPAQASAGGAGSIVDA

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
147 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
159 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
160 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
161 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
176 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
177 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
178 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
179 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
180 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 1.22
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10076870 3300013102 Bacteria 2364
2 Ga0070658_10361691 3300005327 Bacteria 1243
3 Ga0070676_10119490 3300005328 Bacteria 1652
4 Ga0070690_100000663 3300005330 Bacteria 17521
5 Ga0070690_100021422 3300005330 Bacteria 3947
6 Ga0070690_100074507 3300005330 Bacteria 2211
7 Ga0070670_100002410 3300005331 Bacteria 15422
8 Ga0070670_100066202 3300005331 Bacteria 3100
9 Ga0070670_100138988 3300005331 Bacteria 2100
10 Ga0070670_100171844 3300005331 Bacteria 1880
11 Ga0068869_100015701 3300005334 Bacteria 5088
12 Ga0068869_100026901 3300005334 Bacteria 4006
13 Ga0070666_10009291 3300005335 Bacteria 6126
14 Ga0070680_100054478 3300005336 Bacteria 3266
15 Ga0070682_100026423 3300005337 Bacteria 3474
16 Ga0068868_100003318 3300005338 Bacteria 11198
17 Ga0070660_100081683 3300005339 Bacteria 2537
18 Ga0070689_100042780 3300005340 Bacteria 3479
19 Ga0070689_100365911 3300005340 Bacteria 1212
20 Ga0070691_10013345 3300005341 Bacteria 3763
21 Ga0070687_100095580 3300005343 Bacteria 1652
22 Ga0070668_100020508 3300005347 Bacteria 4989
23 Ga0070668_100079802 3300005347 Bacteria 2563
24 Ga0070668_100170634 3300005347 Bacteria 1771
25 Ga0070669_100025721 3300005353 Bacteria 4228
26 Ga0070675_100005401 3300005354 Bacteria 9769
27 Ga0070675_100078783 3300005354 Bacteria 2745
28 Ga0070675_100328662 3300005354 Bacteria 1352
29 Ga0070671_100007426 3300005355 Bacteria 8761
30 Ga0070671_100076279 3300005355 Bacteria 2800
31 Ga0070671_100148617 3300005355 Bacteria 1978
32 Ga0070671_100254582 3300005355 Bacteria 1492
33 Ga0070674_100000849 3300005356 Bacteria 15841
34 Ga0070674_100003283 3300005356 Bacteria 9048
35 Ga0070674_100024026 3300005356 Bacteria 3953
36 Ga0070673_100003793 3300005364 Bacteria 9483
37 Ga0070673_100013347 3300005364 Bacteria 5678
38 Ga0070673_100111649 3300005364 Bacteria 2268
39 Ga0070673_100113528 3300005364 Bacteria 2250
40 Ga0070688_100004797 3300005365 Bacteria 7070
41 Ga0070688_100085079 3300005365 Bacteria 2055
42 Ga0070659_100306156 3300005366 Bacteria 1326
43 Ga0070667_100059817 3300005367 Bacteria 3223
44 Ga0070709_10011237 3300005434 Bacteria 4982
45 Ga0070709_10109241 3300005434 Bacteria 1856
46 Ga0070714_100015940 3300005435 Bacteria 6060
47 Ga0070714_100063326 3300005435 Bacteria 3180
48 Ga0070710_10013486 3300005437 Bacteria 4097
49 Ga0070711_100010909 3300005439 Bacteria 5632
50 Ga0070705_100004135 3300005440 Bacteria 7090
51 Ga0070705_100040024 3300005440 Bacteria 2663
52 Ga0070700_100041309 3300005441 Bacteria 2827
53 Ga0070700_100092695 3300005441 Bacteria 1974
54 Ga0070694_100003424 3300005444 Bacteria 9511
55 Ga0070678_100003725 3300005456 Bacteria 8533
56 Ga0070678_100095158 3300005456 Bacteria 2295
57 Ga0070678_100380254 3300005456 Bacteria 1221
58 Ga0070662_100001488 3300005457 Bacteria 14416
59 Ga0070681_10018763 3300005458 Bacteria 6922
60 Ga0068867_100000256 3300005459 Bacteria 35009
61 Ga0068867_100015574 3300005459 Bacteria 5395
62 Ga0068867_100021703 3300005459 Bacteria 4582
63 Ga0068867_100029458 3300005459 Bacteria 3955
64 Ga0068867_100121602 3300005459 Bacteria 2019
65 Ga0070685_10001663 3300005466 Bacteria 11684
66 Ga0070685_10033650 3300005466 Bacteria 2881
67 Ga0070706_100023351 3300005467 Bacteria 5696
68 Ga0070707_100144503 3300005468 Bacteria 2315
69 Ga0070698_100050063 3300005471 Bacteria 4261
70 Ga0070699_100040613 3300005518 Bacteria 4027
71 Ga0070699_100090727 3300005518 Bacteria 2671
72 Ga0070679_100470024 3300005530 Bacteria 1202
73 Ga0070684_100030061 3300005535 Bacteria 4612
74 Ga0070684_100327891 3300005535 Bacteria 1407
75 Ga0070672_100000540 3300005543 Bacteria 22218
76 Ga0070672_100004237 3300005543 Bacteria 9375
77 Ga0070672_100217290 3300005543 Bacteria 1602
78 Ga0070686_100027883 3300005544 Bacteria 3421
79 Ga0070695_100204716 3300005545 Bacteria 1413
80 Ga0070696_100003164 3300005546 Bacteria 10956
81 Ga0070696_100035182 3300005546 Bacteria 3447
82 Ga0070693_100005394 3300005547 Bacteria 6134
83 Ga0070693_100030011 3300005547 Bacteria 2969
84 Ga0070665_100001402 3300005548 Bacteria 28337
85 Ga0070665_100111531 3300005548 Bacteria 2737
86 Ga0070704_100032448 3300005549 Bacteria 3523
87 Ga0070704_100059914 3300005549 Bacteria 2718
88 Ga0068855_100209322 3300005563 Bacteria 2192
89 Ga0070664_100065929 3300005564 Bacteria 3091
90 Ga0070664_100151923 3300005564 Bacteria 2044
91 Ga0070664_100314066 3300005564 Bacteria 1419
92 Ga0068854_100009738 3300005578 Bacteria 6211
93 Ga0068854_100022054 3300005578 Bacteria 4331
94 Ga0068856_100002156 3300005614 Bacteria 20390
95 Ga0068856_100173775 3300005614 Bacteria 2167
96 Ga0068856_100251140 3300005614 Bacteria 1784
97 Ga0070702_100024441 3300005615 Bacteria 3223
98 Ga0068852_100108922 3300005616 Bacteria 2515
99 Ga0068852_100161419 3300005616 Bacteria 2093
100 Ga0068852_100226948 3300005616 Bacteria 1779
101 Ga0068852_100361745 3300005616 Bacteria 1419
102 Ga0068864_100004280 3300005618 Bacteria 11735
103 Ga0068864_100006822 3300005618 Bacteria 9354
104 Ga0068866_10000111 3300005718 Bacteria 35189
105 Ga0068866_10001382 3300005718 Bacteria 10464
106 Ga0068866_10081874 3300005718 Bacteria 1735
107 Ga0068861_100011849 3300005719 Bacteria 6070
108 Ga0068861_100032033 3300005719 Bacteria 3867
109 Ga0068861_100032646 3300005719 Bacteria 3834
110 Ga0068861_100154686 3300005719 Bacteria 1885
111 Ga0068861_100184994 3300005719 Bacteria 1737
112 Ga0068863_100000521 3300005841 Bacteria 39214
113 Ga0068863_100013369 3300005841 Bacteria 7914
114 Ga0068863_100030593 3300005841 Bacteria 5140
115 Ga0068863_100039196 3300005841 Bacteria 4508
116 Ga0068863_100061727 3300005841 Bacteria 3544
117 Ga0068863_100203936 3300005841 Bacteria 1903
118 Ga0068863_100581468 3300005841 Bacteria 1107
119 Ga0068858_100002595 3300005842 Bacteria 18196
120 Ga0068858_100485254 3300005842 Bacteria 1193
121 Ga0068860_100008943 3300005843 Bacteria 9974
122 Ga0068860_100040632 3300005843 Bacteria 4445
123 Ga0068860_100050603 3300005843 Bacteria 3954
124 Ga0068860_100097384 3300005843 Bacteria 2804
125 Ga0068860_100146051 3300005843 Bacteria 2276
126 Ga0068862_100049489 3300005844 Bacteria 3590
127 Ga0068862_100082247 3300005844 Bacteria 2794
128 Ga0068862_100089201 3300005844 Bacteria 2683
129 Ga0081539_10024164 3300005985 Bacteria 3953
130 Ga0070716_100013437 3300006173 Bacteria 4173
131 Ga0070716_100048511 3300006173 Bacteria 2400
132 Ga0070712_100056552 3300006175 Bacteria 2752
133 Ga0075366_10000775 3300006195 Bacteria 15231
134 Ga0097621_100091571 3300006237 Bacteria 2545
135 Ga0097621_100150221 3300006237 Bacteria 1997
136 Ga0068871_100003044 3300006358 Bacteria 11499
137 Ga0068871_100129580 3300006358 Bacteria 2138
138 Ga0075428_100001491 3300006844 Bacteria 25032
139 Ga0075428_100037517 3300006844 Bacteria 5335
140 Ga0075428_100124532 3300006844 Bacteria 2805
141 Ga0075434_100212235 3300006871 Bacteria 1956
142 Ga0068865_100002406 3300006881 Bacteria 11041
143 Ga0068865_100022202 3300006881 Bacteria 4136
144 Ga0068865_100093517 3300006881 Bacteria 2186
145 Ga0075435_100128033 3300007076 Bacteria 2123
146 Ga0105240_10026009 3300009093 Bacteria 7686
147 Ga0105240_10048016 3300009093 Bacteria 5397
148 Ga0111539_10100853 3300009094 Bacteria 3389
149 Ga0111539_10294385 3300009094 Bacteria 1889
150 Ga0111539_10354724 3300009094 Bacteria 1707
151 Ga0111539_10397834 3300009094 Bacteria 1604
152 Ga0105245_10004684 3300009098 Bacteria 12091
153 Ga0105245_10004874 3300009098 Bacteria 11811
154 Ga0105245_10039160 3300009098 Bacteria 4219
155 Ga0105247_10043301 3300009101 Bacteria 2758
156 Ga0114129_10073649 3300009147 Bacteria 4758
157 Ga0105241_10070761 3300009174 Bacteria 2707
158 Ga0105241_10137555 3300009174 Bacteria 1985
159 Ga0105248_10024569 3300009177 Bacteria 6700
160 Ga0105248_10025777 3300009177 Bacteria 6539
161 Ga0105248_10139857 3300009177 Bacteria 2731
162 Ga0105248_10147620 3300009177 Bacteria 2653
163 Ga0105248_10392314 3300009177 Bacteria 1563
164 Ga0105248_10432186 3300009177 Bacteria 1483
165 Ga0105237_10223446 3300009545 Bacteria 1883
166 Ga0105249_10029527 3300009553 Bacteria 4952
167 Ga0157370_10003417 3300013104 Bacteria 18643
168 Ga0157370_10021458 3300013104 Bacteria 6436
169 Ga0157370_10118240 3300013104 Bacteria 2476
170 Ga0157369_10013944 3300013105 Bacteria 9082
171 Ga0157369_10177709 3300013105 Bacteria 2241
172 Ga0157369_10202848 3300013105 Bacteria 2081
173 Ga0157369_10420158 3300013105 Bacteria 1386
174 Ga0157374_10004205 3300013296 Bacteria 12099
175 Ga0157378_10011028 3300013297 Bacteria 7909
176 Ga0157378_10131730 3300013297 Bacteria 2315
177 Ga0163162_10005749 3300013306 Bacteria 11996
178 Ga0163162_10089202 3300013306 Bacteria 3164
179 Ga0163162_10132258 3300013306 Bacteria 2604
180 Ga0163162_10155565 3300013306 Bacteria 2406
181 Ga0163162_10185493 3300013306 Bacteria 2207
182 Ga0163162_10273808 3300013306 Bacteria 1820
183 Ga0163162_10280110 3300013306 Bacteria 1799
184 Ga0157372_10121697 3300013307 Bacteria 2998
185 Ga0157372_10124982 3300013307 Bacteria 2957
186 Ga0157372_10142087 3300013307 Bacteria 2767
187 Ga0157372_10420462 3300013307 Bacteria 1558
188 Ga0157375_10004845 3300013308 Bacteria 11690
189 Ga0157375_10008010 3300013308 Bacteria 9253
190 Ga0157375_10342056 3300013308 Bacteria 1661
191 Ga0163163_10012458 3300014325 Bacteria 7748
192 Ga0163163_10077301 3300014325 Bacteria 3324
193 Ga0163163_10136927 3300014325 Bacteria 2490
194 Ga0157380_10165784 3300014326 Bacteria 1925
195 Ga0157380_10226945 3300014326 Bacteria 1674
196 Ga0157379_10002212 3300014968 Bacteria 16183
197 Ga0157379_10048186 3300014968 Bacteria 3803
198 Ga0157379_10084652 3300014968 Bacteria 2841
199 Ga0157379_10203847 3300014968 Bacteria 1789
200 Ga0157376_10013723 3300014969 Bacteria 6056
201 Ga0157376_10080261 3300014969 Bacteria 2798
202 Ga0157376_10082831 3300014969 Bacteria 2758
203 Ga0163161_10048389 3300017792 Bacteria 3070
204 Ga0163161_10050320 3300017792 Bacteria 3015
205 Ga0209455_1002641 3300025272 Bacteria 6780
206 Ga0207682_10019568 3300025893 Bacteria 2651
207 Ga0207692_10013715 3300025898 Bacteria 3523
208 Ga0207642_10049020 3300025899 Bacteria 1896
209 Ga0207688_10132607 3300025901 Bacteria 1461
210 Ga0207680_10090547 3300025903 Bacteria 1944
211 Ga0207699_10008810 3300025906 Bacteria 4996
212 Ga0207645_10003112 3300025907 Bacteria 12718
213 Ga0207645_10116237 3300025907 Bacteria 1734
214 Ga0207645_10135159 3300025907 Bacteria 1606
215 Ga0207643_10156465 3300025908 Bacteria 1369
216 Ga0207654_10017266 3300025911 Bacteria 3768
217 Ga0207693_10001071 3300025915 Bacteria 24521
218 Ga0207693_10010413 3300025915 Bacteria 7548
219 Ga0207663_10003519 3300025916 Bacteria 7683
220 Ga0207663_10057216 3300025916 Bacteria 2456
221 Ga0207660_10222935 3300025917 Bacteria 1480
222 Ga0207657_10004018 3300025919 Bacteria 15631
223 Ga0207657_10005722 3300025919 Bacteria 12970
224 Ga0207649_10102705 3300025920 Bacteria 1895
225 Ga0207646_10331540 3300025922 Bacteria 1375
226 Ga0207681_10023773 3300025923 Bacteria 3924
227 Ga0207681_10031822 3300025923 Bacteria 3448
228 Ga0207681_10143974 3300025923 Bacteria 1778
229 Ga0207650_10017867 3300025925 Bacteria 4969
230 Ga0207650_10065111 3300025925 Bacteria 2730
231 Ga0207650_10213129 3300025925 Bacteria 1552
232 Ga0207659_10035023 3300025926 Bacteria 3467
233 Ga0207659_10081738 3300025926 Bacteria 2390
234 Ga0207659_10237740 3300025926 Bacteria 1472
235 Ga0207664_10012932 3300025929 Bacteria 5980
236 Ga0207664_10033142 3300025929 Bacteria 3966
237 Ga0207644_10011508 3300025931 Bacteria 5856
238 Ga0207690_10113626 3300025932 Bacteria 1954
239 Ga0207706_10001838 3300025933 Bacteria 20815
240 Ga0207706_10023309 3300025933 Bacteria 5560
241 Ga0207686_10000067 3300025934 Bacteria 94339
242 Ga0207686_10002716 3300025934 Bacteria 9600
243 Ga0207709_10014970 3300025935 Bacteria 4294
244 Ga0207709_10064161 3300025935 Bacteria 2305
245 Ga0207669_10003209 3300025937 Bacteria 7066
246 Ga0207704_10000383 3300025938 Bacteria 20322
247 Ga0207704_10005451 3300025938 Bacteria 5867
248 Ga0207665_10013769 3300025939 Bacteria 5319
249 Ga0207691_10007860 3300025940 Bacteria 10272
250 Ga0207691_10014472 3300025940 Bacteria 7522
251 Ga0207691_10021535 3300025940 Bacteria 6086
252 Ga0207711_10000654 3300025941 Bacteria 34558
253 Ga0207711_10000687 3300025941 Bacteria 33408
254 Ga0207689_10028469 3300025942 Bacteria 4676
255 Ga0207689_10125752 3300025942 Bacteria 2109
256 Ga0207679_10129342 3300025945 Bacteria 2023
257 Ga0207667_10024872 3300025949 Bacteria 6566
258 Ga0207667_10206271 3300025949 Bacteria 2015
259 Ga0207651_10101126 3300025960 Bacteria 2139
260 Ga0207651_10193681 3300025960 Bacteria 1623
261 Ga0207651_10241863 3300025960 Bacteria 1471
262 Ga0207712_10000422 3300025961 Bacteria 36283
263 Ga0207712_10031458 3300025961 Bacteria 3575
264 Ga0207668_10055900 3300025972 Bacteria 2746
265 Ga0207668_10124174 3300025972 Bacteria 1960
266 Ga0207640_10001771 3300025981 Bacteria 11596
267 Ga0207640_10016003 3300025981 Bacteria 4353
268 Ga0207658_10004210 3300025986 Bacteria 10022
269 Ga0207658_10173282 3300025986 Bacteria 1780
270 Ga0207677_10000162 3300026023 Bacteria 53309
271 Ga0207677_10057698 3300026023 Bacteria 2668
272 Ga0207708_10004098 3300026075 Bacteria 10723
273 Ga0207708_10262205 3300026075 Bacteria 1395
274 Ga0207702_10032060 3300026078 Bacteria 4383
275 Ga0207702_10036071 3300026078 Bacteria 4135
276 Ga0207702_10037175 3300026078 Bacteria 4074
277 Ga0207641_10004151 3300026088 Bacteria 12624
278 Ga0207641_10155617 3300026088 Bacteria 2073
279 Ga0207648_10000612 3300026089 Bacteria 40038
280 Ga0207648_10004350 3300026089 Bacteria 14571
281 Ga0207648_10071409 3300026089 Bacteria 3025
282 Ga0207648_10080119 3300026089 Bacteria 2849
283 Ga0207676_10004233 3300026095 Bacteria 10135
284 Ga0207676_10150549 3300026095 Bacteria 2003
285 Ga0207674_10108498 3300026116 Bacteria 2752
286 Ga0207675_100009617 3300026118 Bacteria 9046
287 Ga0207675_100011315 3300026118 Bacteria 8351
288 Ga0207675_100020388 3300026118 Bacteria 6179
289 Ga0207675_100223591 3300026118 Bacteria 1814
290 Ga0207675_100231249 3300026118 Bacteria 1784
291 Ga0207683_10001007 3300026121 Bacteria 25719
292 Ga0207683_10041054 3300026121 Bacteria 4039
293 Ga0207683_10134167 3300026121 Bacteria 2228
294 Ga0207698_10109006 3300026142 Bacteria 2316
295 Ga0207698_10456956 3300026142 Bacteria 1234
296 Ga0209974_10043911 3300027876 Bacteria 1490
297 Ga0268266_10030423 3300028379 Bacteria 4587
298 Ga0268265_10087899 3300028380 Bacteria 2474
299 Ga0268264_10123144 3300028381 Bacteria 2288
300 Ga0307408_100056282 3300031548 Bacteria 2851
301 Ga0316575_10074013 3300031665 Bacteria 1370
302 Ga0316579_10002969 3300031691 Bacteria 6514
303 Ga0316576_10178637 3300031727 Bacteria 1601
304 Ga0307405_10008243 3300031731 Bacteria 5270
305 Ga0307413_10076442 3300031824 Bacteria 2128
306 Ga0307410_10001317 3300031852 Bacteria 11086
307 Ga0307410_10003681 3300031852 Bacteria 7747
308 Ga0307410_10015892 3300031852 Bacteria 4474
309 Ga0307407_10101875 3300031903 Bacteria 1784
310 Ga0307412_10024753 3300031911 Bacteria 3709
311 Ga0307409_100000903 3300031995 Bacteria 13753
312 Ga0307409_100033243 3300031995 Bacteria 3751
313 Ga0307416_100001846 3300032002 Bacteria 11816
314 Ga0307411_10038089 3300032005 Bacteria 3029
315 Ga0307411_10057937 3300032005 Bacteria 2561
316 Ga0307415_100124756 3300032126 Bacteria 1938
317 Ga0316583_10078875 3300032133 Bacteria 1151
318 Ga0316585_10013211 3300032137 Bacteria 2457
319 Ga0316580_10046208 3300032139 Bacteria 1342
320 Ga0316593_10000525 3300032168 Bacteria 7119
321 Ga0316593_10020250 3300032168 Bacteria 2066
322 Ga0316587_1006532 3300033529 Bacteria 1784
323 Ga0373923_0012195 3300035111 Bacteria 3170
324 Ga0373953_0010810 3300035117 Bacteria 3187
325 Ga0373956_0091192 3300035119 Bacteria 1406
326 Ga0373957_0003932 3300035120 Bacteria 4463
327 Ga0373943_0137457 3300035170 Bacteria 1313
328 Ga0373955_0007947 3300035172 Bacteria 4900
329 Ga0316574_0002338 3300035398 Bacteria 9472
330 Ga0373927_0028659 3300035695 Bacteria 3632
331 Ga0373947_0028975 3300035725 Bacteria 3248
332 Ga0316582_0023032 3300036647 Bacteria 3706
333 Ga0316582_0085096 3300036647 Bacteria 2071
334 Ga0316584_0005919 3300036712 Bacteria 8252
335 Ga0316584_0120525 3300036712 Bacteria 1960
336 Ga0373925_0056678 3300037068 Bacteria 2935
337 Ga0316581_0000600 3300037588 Bacteria 7125
338 Ga0400488_18372 3300038741 Bacteria 11596
339 Ga0400488_48824 3300038741 Bacteria 1711
340 Ga0400487_41427 3300039110 Bacteria 4185
341 Ga0450890_007972 3300042127 Bacteria 1354
342 Ga0439444_0006131 3300042437 Bacteria 1807
343 Ga0439460_0017845 3300042461 Bacteria 1905
344 Ga0451577_0004271 3300042876 Bacteria 15192
345 Ga0453683_0011624 3300044673 Bacteria 5799
346 Ga0453684_0219265 3300044712 Bacteria 2205
347 Ga0451576_0076265 3300045051 Bacteria 3489
348 Ga0451576_0439947 3300045051 Bacteria 1368
349 Ga0495603_0060228 3300046455 Unclassified 2243
350 Ga0495603_0144096 3300046455 Unclassified 1385
351 Ga0495651_0122664 3300046462 Bacteria 1907
352 Ga0495580_0053971 3300046472 Bacteria 2835
353 Ga0495580_0063047 3300046472 Bacteria 2600
354 Ga0495582_0003184 3300046473 Bacteria 9225
355 Ga0495639_0005560 3300046475 Bacteria 5429
356 Ga0495664_0070077 3300046477 Bacteria 2093
357 Ga0495666_0044056 3300046526 Bacteria 2155
358 Ga0495665_0027733 3300046531 Bacteria 3038
359 Ga0495640_0077328 3300046533 Bacteria 2219
360 Ga0495587_0040696 3300046536 Bacteria 2776
361 Ga0495621_0018731 3300046539 Bacteria 2252
362 Ga0495645_0038238 3300046543 Bacteria 3500
363 Ga0495622_0074884 3300046557 Unclassified 1561
364 Ga0495667_0143889 3300046559 Bacteria 1536
365 Ga0495634_0137142 3300046642 Bacteria 1556
366 Ga0495635_0034539 3300046663 Bacteria 3507
367 Ga0495599_0041162 3300046678 Bacteria 2902
368 Ga0495613_0009154 3300046689 Bacteria 7342
369 Ga0495600_0015557 3300046809 Bacteria 4813
370 Ga0495604_0138716 3300047317 Bacteria 1740
371 Ga0495676_0041452 3300047321 Bacteria 3790
372 Ga0495680_0121792 3300047322 Bacteria 1925
373 Ga0495684_0002788 3300047471 Bacteria 13787
374 Ga0495593_0023120 3300047673 Bacteria 3458
375 Ga0495614_0063764 3300048089 Bacteria 1584
376 Ga0496102_0109307 3300048905 Bacteria 2576
377 Ga0496106_0104835 3300048909 Bacteria 2196
378 Ga0496110_0152643 3300048913 Bacteria 2092
379 Ga0496112_0000241 3300048915 Bacteria 35206
380 Ga0496114_0258902 3300048917 Bacteria 1532
381 Ga0501033_0051949 3300049570 Bacteria 3038
382 Ga0501036_0111095 3300049572 Bacteria 2316
383 Ga0501038_0073159 3300049574 Bacteria 2903
384 Ga0501040_0040077 3300049576 Bacteria 3187
385 Ga0501042_0177393 3300049578 Bacteria 1537
386 Ga0501048_0009044 3300049582 Bacteria 7498
387 Ga0501048_0051324 3300049582 Bacteria 2936
388 Ga0501071_0031507 3300049587 Bacteria 3759
389 Ga0501071_0211727 3300049587 Bacteria 1457
390 Ga0501072_0006891 3300049588 Bacteria 8628
391 Ga0501072_0119658 3300049588 Bacteria 2098
392 Ga0501075_0001487 3300049591 Bacteria 15267
393 Ga0501075_0063888 3300049591 Bacteria 2776
394 Ga0501076_0000390 3300049592 Bacteria 27421
395 Ga0501076_0078664 3300049592 Bacteria 2646
396 Ga0501077_0171477 3300049593 Bacteria 1378
397 Ga0501079_0000671 3300049741 Bacteria 22952
398 Ga0501079_0115112 3300049741 Bacteria 2090
399 Ga0501081_0043058 3300049743 Bacteria 3096
400 nmdc:mga0k408_4625_c1 3300050493 Bacteria 7295
401 nmdc:mga05p37_1667_c1 3300050507 Bacteria 25807
402 nmdc:mga09592_1054_c1 3300050508 Bacteria 21854
403 nmdc:mga09592_191010_c1 3300050508 Bacteria 1773
404 nmdc:mga08y16_452255_c1 3300050511 Bacteria 1309
405 nmdc:mga08x19_60186_c1 3300050514 Bacteria 2459
406 Ga0495595_0066708 3300053084 Bacteria 1695
407 Ga0500636_0000106 3300053177 Bacteria 43073
408 Ga0500625_022738 3300053729 Bacteria 2961
409 Ga0501082_0033790 3300060353 Bacteria 4411
410 Ga0501082_0134834 3300060353 Bacteria 2142
411 Ga0157371_10076870
412 Ga0070658_10361691
413 Ga0070676_10119490
414 Ga0070690_100000663
415 Ga0070690_100021422
416 Ga0070690_100074507
417 Ga0070670_100002410
418 Ga0070670_100066202
419 Ga0070670_100138988
420 Ga0070670_100171844
421 Ga0068869_100015701
422 Ga0068869_100026901
423 Ga0070666_10009291
424 Ga0070680_100054478
425 Ga0070682_100026423
426 Ga0068868_100003318
427 Ga0070660_100081683
428 Ga0070689_100042780
429 Ga0070689_100365911
430 Ga0070691_10013345
431 Ga0070687_100095580
432 Ga0070668_100020508
433 Ga0070668_100079802
434 Ga0070668_100170634
435 Ga0070669_100025721
436 Ga0070675_100005401
437 Ga0070675_100078783
438 Ga0070675_100328662
439 Ga0070671_100007426
440 Ga0070671_100076279
441 Ga0070671_100148617
442 Ga0070671_100254582
443 Ga0070674_100000849
444 Ga0070674_100003283
445 Ga0070674_100024026
446 Ga0070673_100003793
447 Ga0070673_100013347
448 Ga0070673_100111649
449 Ga0070673_100113528
450 Ga0070688_100004797
451 Ga0070688_100085079
452 Ga0070659_100306156
453 Ga0070667_100059817
454 Ga0070709_10011237
455 Ga0070709_10109241
456 Ga0070714_100015940
457 Ga0070714_100063326
458 Ga0070710_10013486
459 Ga0070711_100010909
460 Ga0070705_100004135
461 Ga0070705_100040024
462 Ga0070700_100041309
463 Ga0070700_100092695
464 Ga0070694_100003424
465 Ga0070678_100003725
466 Ga0070678_100095158
467 Ga0070678_100380254
468 Ga0070662_100001488
469 Ga0070681_10018763
470 Ga0068867_100000256
471 Ga0068867_100015574
472 Ga0068867_100021703
473 Ga0068867_100029458
474 Ga0068867_100121602
475 Ga0070685_10001663
476 Ga0070685_10033650
477 Ga0070706_100023351
478 Ga0070707_100144503
479 Ga0070698_100050063
480 Ga0070699_100040613
481 Ga0070699_100090727
482 Ga0070679_100470024
483 Ga0070684_100030061
484 Ga0070684_100327891
485 Ga0070672_100000540
486 Ga0070672_100004237
487 Ga0070672_100217290
488 Ga0070686_100027883
489 Ga0070695_100204716
490 Ga0070696_100003164
491 Ga0070696_100035182
492 Ga0070693_100005394
493 Ga0070693_100030011
494 Ga0070665_100001402
495 Ga0070665_100111531
496 Ga0070704_100032448
497 Ga0070704_100059914
498 Ga0068855_100209322
499 Ga0070664_100065929
500 Ga0070664_100151923
501 Ga0070664_100314066
502 Ga0068854_100009738
503 Ga0068854_100022054
504 Ga0068856_100002156
505 Ga0068856_100173775
506 Ga0068856_100251140
507 Ga0070702_100024441
508 Ga0068852_100108922
509 Ga0068852_100161419
510 Ga0068852_100226948
511 Ga0068852_100361745
512 Ga0068864_100004280
513 Ga0068864_100006822
514 Ga0068866_10000111
515 Ga0068866_10001382
516 Ga0068866_10081874
517 Ga0068861_100011849
518 Ga0068861_100032033
519 Ga0068861_100032646
520 Ga0068861_100154686
521 Ga0068861_100184994
522 Ga0068863_100000521
523 Ga0068863_100013369
524 Ga0068863_100030593
525 Ga0068863_100039196
526 Ga0068863_100061727
527 Ga0068863_100203936
528 Ga0068863_100581468
529 Ga0068858_100002595
530 Ga0068858_100485254
531 Ga0068860_100008943
532 Ga0068860_100040632
533 Ga0068860_100050603
534 Ga0068860_100097384
535 Ga0068860_100146051
536 Ga0068862_100049489
537 Ga0068862_100082247
538 Ga0068862_100089201
539 Ga0081539_10024164
540 Ga0070716_100013437
541 Ga0070716_100048511
542 Ga0070712_100056552
543 Ga0075366_10000775
544 Ga0097621_100091571
545 Ga0097621_100150221
546 Ga0068871_100003044
547 Ga0068871_100129580
548 Ga0075428_100001491
549 Ga0075428_100037517
550 Ga0075428_100124532
551 Ga0075434_100212235
552 Ga0068865_100002406
553 Ga0068865_100022202
554 Ga0068865_100093517
555 Ga0075435_100128033
556 Ga0105240_10026009
557 Ga0105240_10048016
558 Ga0111539_10100853
559 Ga0111539_10294385
560 Ga0111539_10354724
561 Ga0111539_10397834
562 Ga0105245_10004684
563 Ga0105245_10004874
564 Ga0105245_10039160
565 Ga0105247_10043301
566 Ga0114129_10073649
567 Ga0105241_10070761
568 Ga0105241_10137555
569 Ga0105248_10024569
570 Ga0105248_10025777
571 Ga0105248_10139857
572 Ga0105248_10147620
573 Ga0105248_10392314
574 Ga0105248_10432186
575 Ga0105237_10223446
576 Ga0105249_10029527
577 Ga0157370_10003417
578 Ga0157370_10021458
579 Ga0157370_10118240
580 Ga0157369_10013944
581 Ga0157369_10177709
582 Ga0157369_10202848
583 Ga0157369_10420158
584 Ga0157374_10004205
585 Ga0157378_10011028
586 Ga0157378_10131730
587 Ga0163162_10005749
588 Ga0163162_10089202
589 Ga0163162_10132258
590 Ga0163162_10155565
591 Ga0163162_10185493
592 Ga0163162_10273808
593 Ga0163162_10280110
594 Ga0157372_10121697
595 Ga0157372_10124982
596 Ga0157372_10142087
597 Ga0157372_10420462
598 Ga0157375_10004845
599 Ga0157375_10008010
600 Ga0157375_10342056
601 Ga0163163_10012458
602 Ga0163163_10077301
603 Ga0163163_10136927
604 Ga0157380_10165784
605 Ga0157380_10226945
606 Ga0157379_10002212
607 Ga0157379_10048186
608 Ga0157379_10084652
609 Ga0157379_10203847
610 Ga0157376_10013723
611 Ga0157376_10080261
612 Ga0157376_10082831
613 Ga0163161_10048389
614 Ga0163161_10050320
615 Ga0209455_1002641
616 Ga0207682_10019568
617 Ga0207692_10013715
618 Ga0207642_10049020
619 Ga0207688_10132607
620 Ga0207680_10090547
621 Ga0207699_10008810
622 Ga0207645_10003112
623 Ga0207645_10116237
624 Ga0207645_10135159
625 Ga0207643_10156465
626 Ga0207654_10017266
627 Ga0207693_10001071
628 Ga0207693_10010413
629 Ga0207663_10003519
630 Ga0207663_10057216
631 Ga0207660_10222935
632 Ga0207657_10004018
633 Ga0207657_10005722
634 Ga0207649_10102705
635 Ga0207646_10331540
636 Ga0207681_10023773
637 Ga0207681_10031822
638 Ga0207681_10143974
639 Ga0207650_10017867
640 Ga0207650_10065111
641 Ga0207650_10213129
642 Ga0207659_10035023
643 Ga0207659_10081738
644 Ga0207659_10237740
645 Ga0207664_10012932
646 Ga0207664_10033142
647 Ga0207644_10011508
648 Ga0207690_10113626
649 Ga0207706_10001838
650 Ga0207706_10023309
651 Ga0207686_10000067
652 Ga0207686_10002716
653 Ga0207709_10014970
654 Ga0207709_10064161
655 Ga0207669_10003209
656 Ga0207704_10000383
657 Ga0207704_10005451
658 Ga0207665_10013769
659 Ga0207691_10007860
660 Ga0207691_10014472
661 Ga0207691_10021535
662 Ga0207711_10000654
663 Ga0207711_10000687
664 Ga0207689_10028469
665 Ga0207689_10125752
666 Ga0207679_10129342
667 Ga0207667_10024872
668 Ga0207667_10206271
669 Ga0207651_10101126
670 Ga0207651_10193681
671 Ga0207651_10241863
672 Ga0207712_10000422
673 Ga0207712_10031458
674 Ga0207668_10055900
675 Ga0207668_10124174
676 Ga0207640_10001771
677 Ga0207640_10016003
678 Ga0207658_10004210
679 Ga0207658_10173282
680 Ga0207677_10000162
681 Ga0207677_10057698
682 Ga0207708_10004098
683 Ga0207708_10262205
684 Ga0207702_10032060
685 Ga0207702_10036071
686 Ga0207702_10037175
687 Ga0207641_10004151
688 Ga0207641_10155617
689 Ga0207648_10000612
690 Ga0207648_10004350
691 Ga0207648_10071409
692 Ga0207648_10080119
693 Ga0207676_10004233
694 Ga0207676_10150549
695 Ga0207674_10108498
696 Ga0207675_100009617
697 Ga0207675_100011315
698 Ga0207675_100020388
699 Ga0207675_100223591
700 Ga0207675_100231249
701 Ga0207683_10001007
702 Ga0207683_10041054
703 Ga0207683_10134167
704 Ga0207698_10109006
705 Ga0207698_10456956
706 Ga0209974_10043911
707 Ga0268266_10030423
708 Ga0268265_10087899
709 Ga0268264_10123144
710 Ga0307408_100056282
711 Ga0316575_10074013
712 Ga0316579_10002969
713 Ga0316576_10178637
714 Ga0307405_10008243
715 Ga0307413_10076442
716 Ga0307410_10001317
717 Ga0307410_10003681
718 Ga0307410_10015892
719 Ga0307407_10101875
720 Ga0307412_10024753
721 Ga0307409_100000903
722 Ga0307409_100033243
723 Ga0307416_100001846
724 Ga0307411_10038089
725 Ga0307411_10057937
726 Ga0307415_100124756
727 Ga0316583_10078875
728 Ga0316585_10013211
729 Ga0316580_10046208
730 Ga0316593_10000525
731 Ga0316593_10020250
732 Ga0316587_1006532
733 Ga0373923_0012195
734 Ga0373953_0010810
735 Ga0373956_0091192
736 Ga0373957_0003932
737 Ga0373943_0137457
738 Ga0373955_0007947
739 Ga0316574_0002338
740 Ga0373927_0028659
741 Ga0373947_0028975
742 Ga0316582_0023032
743 Ga0316582_0085096
744 Ga0316584_0005919
745 Ga0316584_0120525
746 Ga0373925_0056678
747 Ga0316581_0000600
748 Ga0400488_18372
749 Ga0400488_48824
750 Ga0400487_41427
751 Ga0450890_007972
752 Ga0439444_0006131
753 Ga0439460_0017845
754 Ga0451577_0004271
755 Ga0453683_0011624
756 Ga0453684_0219265
757 Ga0451576_0076265
758 Ga0451576_0439947
759 Ga0495603_0060228
760 Ga0495603_0144096
761 Ga0495651_0122664
762 Ga0495580_0053971
763 Ga0495580_0063047
764 Ga0495582_0003184
765 Ga0495639_0005560
766 Ga0495664_0070077
767 Ga0495666_0044056
768 Ga0495665_0027733
769 Ga0495640_0077328
770 Ga0495587_0040696
771 Ga0495621_0018731
772 Ga0495645_0038238
773 Ga0495622_0074884
774 Ga0495667_0143889
775 Ga0495634_0137142
776 Ga0495635_0034539
777 Ga0495599_0041162
778 Ga0495613_0009154
779 Ga0495600_0015557
780 Ga0495604_0138716
781 Ga0495676_0041452
782 Ga0495680_0121792
783 Ga0495684_0002788
784 Ga0495593_0023120
785 Ga0495614_0063764
786 Ga0496102_0109307
787 Ga0496106_0104835
788 Ga0496110_0152643
789 Ga0496112_0000241
790 Ga0496114_0258902
791 Ga0501033_0051949
792 Ga0501036_0111095
793 Ga0501038_0073159
794 Ga0501040_0040077
795 Ga0501042_0177393
796 Ga0501048_0009044
797 Ga0501048_0051324
798 Ga0501071_0031507
799 Ga0501071_0211727
800 Ga0501072_0006891
801 Ga0501072_0119658
802 Ga0501075_0001487
803 Ga0501075_0063888
804 Ga0501076_0000390
805 Ga0501076_0078664
806 Ga0501077_0171477
807 Ga0501079_0000671
808 Ga0501079_0115112
809 Ga0501081_0043058
810 nmdc:mga0k408_4625_c1
811 nmdc:mga05p37_1667_c1
812 nmdc:mga09592_1054_c1
813 nmdc:mga09592_191010_c1
814 nmdc:mga08y16_452255_c1
815 nmdc:mga08x19_60186_c1
816 Ga0495595_0066708
817 Ga0500636_0000106
818 Ga0500625_022738
819 Ga0501082_0033790
820 Ga0501082_0134834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02504

FA_synthesis

Fatty acid synthesis protein

39

351

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.9127 3 323
1vi1-assembly1.cif.gz_A crystal structure of a fatty acid/phospholipid synthesis protein 0.9091 3 323
1u7n-assembly1.cif.gz_A crystal structure of the fatty acid/phospholipid synthesis protein plsx from enterococcus faecalis v583 0.9011 3 323
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.894 3 323
1u7n-assembly1.cif.gz_B crystal structure of the fatty acid/phospholipid synthesis protein plsx from enterococcus faecalis v583 0.8857 3 323
ID Description Score Start End Superfamily
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9424 3 332 3.40.718.10
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9288 3 332 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8836 5 323 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8592 5 323 3.40.718.10
1vmiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isocitrate/Isopropylmalate dehydrogenase-like 0.7403 122 244 3.40.50.10750
ID Description Score Start End GO Terms
AF-A0A6G3HQE2-F1-model_v4 deleted 0.9868 1 128
AF-A0A3S4HGE1-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9851 2 125 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A2R7SKM8-F1-model_v4 deleted 0.9843 10 128
AF-A0A5U8T0Z5-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9836 1 119 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A6C9QJV4-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9792 1 105 GO:0005737
GO:0006633
GO:0008654
GO:0043811

Map