F437230

General Info

Members Datasets Scaffolds Average Seq Length
410 351 820 170

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10032933|Ga0114129_100329337
Length 215
Sequence MPDRLAGPAISSAGSGRASLVKLETGPFFADHLEASRELSMSRLSVAVLALFFGLAAPLVQAGETPDKSKAVKQDAEGKYTDKAGTPTYNIKADGTVDWYSYAGFRLYHSDCHVCHGPDAAGSSYAPALADSLKTMTYEQFQDVVVNGRKISNSAKQSVMPSFGTNQNVMCHLDDLYIYLRARADGALERGRPAKKEPKNDAARATESQCLGVKS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
108 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
187 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
188 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
189 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
190 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
193 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
207 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
208 2509276019 Ensifer aridi TW10 Isolate Nodule
209 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
210 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
211 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
212 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
213 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
214 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
215 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
216 2643221557 Ensifer sp. Root558 Isolate Unclassified
217 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
218 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
219 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
220 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
221 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
222 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
223 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
224 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
225 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
226 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
227 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
228 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
229 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
230 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
231 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
232 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
233 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
234 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
235 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
236 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
237 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
238 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
239 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
240 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
241 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
242 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
243 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
244 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
245 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
246 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
247 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
248 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
249 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
250 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
251 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
252 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
253 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
254 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
255 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
256 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
257 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
258 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
259 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
260 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
261 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
262 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
263 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
264 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
265 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
266 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
267 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
268 2904699407
269 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
270 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
271 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
272 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
273 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
274 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
275 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
276 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
277 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
278 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
279 2922425934
280 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
281 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
282 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
283 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
284 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
285 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
286 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
287 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
288 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
289 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
290 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
291 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
292 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
293 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
294 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
295 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
296 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
297 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
298 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
299 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
300 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
301 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
302 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
303 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
304 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
305 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
306 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
307 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
308 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
309 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
310 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
311 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
312 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
313 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
314 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
315 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
316 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
317 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
318 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
319 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
320 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
321 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
322 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
323 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
324 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
325 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
326 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
327 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
328 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
329 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
330 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
331 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
332 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
333 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
334 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
335 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
336 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
337 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
338 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
339 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
340 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
341 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
342 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
343 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
344 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
345 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
346 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
347 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
348 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
349 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
350 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
351 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.29
Metatranscriptomes 4.41
Isolates 35.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.12
Nodule 30
Rhizoplane 4.88
Rhizosphere 53.41
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10032933 3300009147 Bacteria 7323
2 JGI24740J21852_10074134 3300001979 Bacteria 905
3 JGI24739J22299_10002799 3300001989 Bacteria 6698
4 JGI25406J46586_10002156 3300003203 Bacteria 9310
5 JGI25404J52841_10016440 3300003659 Bacteria 1605
6 Ga0055529_1011559 3300003763 Bacteria 1136
7 JGI25405J52794_10064940 3300003911 Bacteria 792
8 Ga0070690_100323504 3300005330 Bacteria 1112
9 Ga0068869_100019540 3300005334 Bacteria 4632
10 Ga0070680_100006858 3300005336 Bacteria 8685
11 Ga0068868_101123200 3300005338 Bacteria 724
12 Ga0070691_10027228 3300005341 Bacteria 2667
13 Ga0070692_10080825 3300005345 Bacteria 1750
14 Ga0070668_100074840 3300005347 Bacteria 2643
15 Ga0070659_100533454 3300005366 Bacteria 1003
16 Ga0070703_10014844 3300005406 Bacteria 2223
17 Ga0070701_10079309 3300005438 Bacteria 1773
18 Ga0070705_100001671 3300005440 Bacteria 11609
19 Ga0070700_100035618 3300005441 Bacteria 3013
20 Ga0070694_100020886 3300005444 Bacteria 4179
21 Ga0070708_100003020 3300005445 Bacteria 13062
22 Ga0070708_100625865 3300005445 Bacteria 1014
23 Ga0070663_100023236 3300005455 Bacteria 4154
24 Ga0070663_101090276 3300005455 Unclassified 698
25 Ga0070698_100663888 3300005471 Bacteria 984
26 Ga0070699_100000473 3300005518 Bacteria 38374
27 Ga0070679_100058834 3300005530 Bacteria 3830
28 Ga0070684_100151890 3300005535 Bacteria 2098
29 Ga0070697_100087931 3300005536 Bacteria 2566
30 Ga0068853_100471771 3300005539 Bacteria 1182
31 Ga0068853_101227440 3300005539 Bacteria 724
32 Ga0070695_100002104 3300005545 Bacteria 11390
33 Ga0070695_100007776 3300005545 Bacteria 6351
34 Ga0070696_100000229 3300005546 Bacteria 33893
35 Ga0070704_100001299 3300005549 Bacteria 13207
36 Ga0070704_100549448 3300005549 Bacteria 1009
37 Ga0068855_100240963 3300005563 Bacteria 2021
38 Ga0068857_100001246 3300005577 Bacteria 19897
39 Ga0068857_100084414 3300005577 Bacteria 2838
40 Ga0068856_100417943 3300005614 Bacteria 1361
41 Ga0070702_100594093 3300005615 Unclassified 829
42 Ga0068859_100003426 3300005617 Bacteria 16126
43 Ga0068861_100015249 3300005719 Bacteria 5411
44 Ga0068860_100215666 3300005843 Bacteria 1862
45 Ga0068860_101280600 3300005843 Unclassified 754
46 Ga0068862_100004070 3300005844 Bacteria 12399
47 Ga0081455_10000238 3300005937 Bacteria 71282
48 Ga0081455_10000834 3300005937 Bacteria 39725
49 Ga0081455_10130467 3300005937 Bacteria 1966
50 Ga0081540_1000002 3300005983 Bacteria 251149
51 Ga0081540_1000578 3300005983 Bacteria 35378
52 Ga0081539_10000302 3300005985 Bacteria 111364
53 Ga0075365_10078527 3300006038 Bacteria 2232
54 Ga0075368_10036382 3300006042 Bacteria 1923
55 Ga0070715_10013320 3300006163 Bacteria 3017
56 Ga0070716_100788464 3300006173 Bacteria 735
57 Ga0075367_10334989 3300006178 Bacteria 954
58 Ga0075369_10010525 3300006186 Bacteria 3618
59 Ga0097621_101604944 3300006237 Unclassified 618
60 Ga0075370_10152701 3300006353 Bacteria 1353
61 Ga0068871_100871411 3300006358 Bacteria 833
62 Ga0075428_100179100 3300006844 Bacteria 2295
63 Ga0075428_100248307 3300006844 Bacteria 1918
64 Ga0075430_100012065 3300006846 Bacteria 7355
65 Ga0075430_100058912 3300006846 Bacteria 3228
66 Ga0075431_100075730 3300006847 Bacteria 3472
67 Ga0075431_100142803 3300006847 Bacteria 2468
68 Ga0075431_100419016 3300006847 Bacteria 1338
69 Ga0075433_10011909 3300006852 Bacteria 7008
70 Ga0075433_10122387 3300006852 Bacteria 2311
71 Ga0075434_100033390 3300006871 Bacteria 5079
72 Ga0075434_100060780 3300006871 Bacteria 3758
73 Ga0075434_100093292 3300006871 Bacteria 3014
74 Ga0075429_100515371 3300006880 Bacteria 1048
75 Ga0097620_100003426 3300006931 Bacteria 16126
76 Ga0075435_100027465 3300007076 Bacteria 4453
77 Ga0075435_100233492 3300007076 Bacteria 1563
78 Ga0099794_10289014 3300007265 Bacteria 848
79 Ga0105240_10418582 3300009093 Bacteria 1506
80 Ga0111539_10039891 3300009094 Bacteria 5655
81 Ga0111539_10068765 3300009094 Bacteria 4182
82 Ga0105247_10328670 3300009101 Bacteria 1069
83 Ga0114129_10276881 3300009147 Bacteria 2243
84 Ga0114129_10701865 3300009147 Bacteria 1300
85 Ga0105243_10107326 3300009148 Bacteria 2329
86 Ga0105249_10019769 3300009553 Bacteria 6012
87 Ga0105239_10040646 3300010375 Bacteria 5095
88 Ga0105239_11001694 3300010375 Bacteria 961
89 Ga0105246_10288355 3300011119 Bacteria 1320
90 Ga0157378_10186681 3300013297 Bacteria 1953
91 Ga0163162_10391071 3300013306 Bacteria 1523
92 Ga0206356_10385723 3300020070 Bacteria 2380
93 Ga0206356_11342280 3300020070 Bacteria 6625
94 Ga0206356_11842510 3300020070 Bacteria 1157
95 Ga0206354_10632587 3300020081 Bacteria 2218
96 Ga0214543_1000025 3300021327 Bacteria 225351
97 Ga0213876_10076676 3300021384 Bacteria 1766
98 Ga0209677_100258 3300025253 Bacteria 35939
99 Ga0209233_1001546 3300025261 Bacteria 9019
100 Ga0209233_1004046 3300025261 Bacteria 5074
101 Ga0209455_1018966 3300025272 Bacteria 1400
102 Ga0207653_10021487 3300025885 Bacteria 2047
103 Ga0207647_10000883 3300025904 Bacteria 23261
104 Ga0207685_10059685 3300025905 Bacteria 1505
105 Ga0207671_10128572 3300025914 Bacteria 1943
106 Ga0207671_10859358 3300025914 Bacteria 718
107 Ga0207660_10051296 3300025917 Bacteria 2933
108 Ga0207704_10757534 3300025938 Bacteria 808
109 Ga0207689_10020616 3300025942 Bacteria 5544
110 Ga0207667_11219457 3300025949 Bacteria 731
111 Ga0207712_10002402 3300025961 Bacteria 12128
112 Ga0207668_11293748 3300025972 Bacteria 656
113 Ga0207640_10771352 3300025981 Bacteria 831
114 Ga0207703_10504111 3300026035 Bacteria 1136
115 Ga0207639_10111439 3300026041 Bacteria 2231
116 Ga0207639_10479995 3300026041 Bacteria 1133
117 Ga0207639_11263979 3300026041 Bacteria 693
118 Ga0207678_10007341 3300026067 Bacteria 9762
119 Ga0207708_10000819 3300026075 Bacteria 23412
120 Ga0207702_10095145 3300026078 Bacteria 2616
121 Ga0207641_11062608 3300026088 Bacteria 807
122 Ga0207676_10056471 3300026095 Bacteria 3087
123 Ga0207674_10000240 3300026116 Bacteria 68544
124 Ga0207674_10099834 3300026116 Bacteria 2885
125 Ga0207675_100018792 3300026118 Bacteria 6449
126 Ga0207683_10372299 3300026121 Bacteria 1312
127 Ga0207428_10238013 3300027907 Bacteria 1361
128 Ga0268265_10001328 3300028380 Bacteria 21171
129 Ga0268264_10091029 3300028381 Bacteria 2630
130 Ga0268264_11021825 3300028381 Unclassified 834
131 Ga0307508_10052417 3300031616 Bacteria 3624
132 Ga0307405_10307317 3300031731 Bacteria 1206
133 Ga0307412_10598873 3300031911 Bacteria 933
134 Ga0307416_101552593 3300032002 Bacteria 768
135 Ga0307414_10504810 3300032004 Bacteria 1071
136 Ga0307411_10145892 3300032005 Bacteria 1752
137 Ga0315911_1000027 3300033442 Bacteria 85143
138 Ga0373928_0009406 3300035084 Bacteria 1908
139 Ga0373940_0004936 3300035088 Bacteria 2854
140 Ga0373944_0039384 3300035089 Bacteria 1455
141 Ga0373949_0006884 3300035090 Bacteria 2496
142 Ga0373951_0041320 3300035091 Bacteria 1113
143 Ga0373932_0029090 3300035112 Bacteria 1523
144 Ga0373932_0061156 3300035112 Bacteria 1144
145 Ga0373939_0034108 3300035114 Bacteria 1491
146 Ga0373942_0086464 3300035207 Bacteria 938
147 Ga0373961_0193694 3300035241 Bacteria 714
148 Ga0373962_0010990 3300035242 Bacteria 2265
149 Ga0373931_0007882 3300035691 Bacteria 5037
150 Ga0373931_0013960 3300035691 Bacteria 3919
151 Ga0373937_0645870 3300036401 Bacteria 1003
152 Ga0395899_0180641 3300037312 Bacteria 1482
153 Ga0395900_0308285 3300037418 Bacteria 1567
154 Ga0395900_0329494 3300037418 Bacteria 1505
155 Ga0395898_0337147 3300037466 Bacteria 1438
156 Ga0395898_0616072 3300037466 Bacteria 1028
157 Ga0395905_0036611 3300037471 Bacteria 4609
158 Ga0395901_0145188 3300038443 Bacteria 2494
159 Ga0436361_0028729 3300039447 Bacteria 12850
160 Ga0439465_0058147 3300041413 Bacteria 1277
161 Ga0439465_0064754 3300041413 Bacteria 1216
162 Ga0439465_0126854 3300041413 Bacteria 898
163 Ga0451789_0785936 3300041443 Bacteria 616
164 Ga0439433_0075155 3300041999 Bacteria 817
165 Ga0439445_0117701 3300042004 Bacteria 761
166 Ga0439449_0122062 3300042007 Bacteria 967
167 Ga0439462_0009211 3300042015 Bacteria 2497
168 Ga0466967_0079083 3300045976 Bacteria 2964
169 Ga0466967_0236538 3300045976 Bacteria 1741
170 Ga0495638_0007337 3300046460 Bacteria 7917
171 Ga0495651_0099756 3300046462 Bacteria 2165
172 Ga0495608_0063633 3300046511 Bacteria 2420
173 Ga0495645_0050516 3300046543 Bacteria 3028
174 Ga0495668_0529207 3300046616 Bacteria 650
175 Ga0495625_0505657 3300046660 Bacteria 738
176 Ga0495635_0431485 3300046663 Bacteria 873
177 Ga0495604_0057442 3300047317 Bacteria 2992
178 Ga0495677_0248984 3300047445 Bacteria 695
179 Ga0496100_0382571 3300048903 Bacteria 1069
180 Ga0496100_0442234 3300048903 Unclassified 996
181 Ga0496100_0918225 3300048903 Bacteria 688
182 Ga0496102_0012811 3300048905 Bacteria 7259
183 Ga0496102_0130777 3300048905 Bacteria 2349
184 Ga0496102_0762049 3300048905 Bacteria 891
185 Ga0496103_0252276 3300048906 Bacteria 1135
186 Ga0496104_0278623 3300048907 Bacteria 1585
187 Ga0496105_0291777 3300048908 Bacteria 1313
188 Ga0496106_0010658 3300048909 Bacteria 6791
189 Ga0496107_0006883 3300048910 Bacteria 7834
190 Ga0496107_0339228 3300048910 Bacteria 1118
191 Ga0496109_0430016 3300048912 Bacteria 1247
192 Ga0496110_0350552 3300048913 Bacteria 1345
193 Ga0496110_0539881 3300048913 Bacteria 1060
194 Ga0496115_0065226 3300048918 Bacteria 2941
195 Ga0496117_0131734 3300048920 Bacteria 1514
196 Ga0496118_0019924 3300048921 Bacteria 5971
197 Ga0496121_0047152 3300048924 Bacteria 3679
198 Ga0496121_0093804 3300048924 Bacteria 2336
199 Ga0496121_0312682 3300048924 Bacteria 1061
200 Ga0496121_0318492 3300048924 Bacteria 1048
201 Ga0496125_0421683 3300048928 Bacteria 773
202 Ga0496126_0382017 3300048929 Bacteria 1146
203 Ga0501031_0222436 3300049568 Bacteria 1229
204 Ga0501032_0034660 3300049569 Bacteria 3454
205 Ga0501032_0342991 3300049569 Bacteria 963
206 Ga0501034_0005856 3300049571 Bacteria 13374
207 Ga0501034_0115815 3300049571 Bacteria 2668
208 Ga0501034_0404817 3300049571 Bacteria 1287
209 Ga0501036_0045956 3300049572 Bacteria 3698
210 Ga0501036_0479363 3300049572 Bacteria 1036
211 Ga0501037_0164465 3300049573 Bacteria 1580
212 Ga0501038_0047251 3300049574 Bacteria 3729
213 Ga0501040_0976227 3300049576 Bacteria 614
214 Ga0501046_0172672 3300049580 Bacteria 1621
215 Ga0501046_0183969 3300049580 Bacteria 1561
216 Ga0501048_0031746 3300049582 Bacteria 3820
217 Ga0501068_0215837 3300049584 Bacteria 1219
218 Ga0501070_0527717 3300049586 Bacteria 947
219 Ga0501073_0110585 3300049589 Bacteria 1906
220 Ga0501074_0225625 3300049590 Bacteria 1334
221 Ga0501080_0033665 3300049742 Bacteria 4783
222 Ga0501083_0201034 3300049744 Bacteria 1299
223 Ga0501044_0208781 3300049823 Bacteria 1908
224 nmdc:mga05p37_89930_c1 3300050507 Bacteria 3783
225 nmdc:mga09592_329555_c1 3300050508 Bacteria 1322
226 nmdc:mga09592_44934_c1 3300050508 Bacteria 3720
227 nmdc:mga0qj67_15200_c1 3300050509 Bacteria 5826
228 nmdc:mga0qj67_43448_c1 3300050509 Bacteria 3539
229 nmdc:mga06r32_517682_c1 3300050510 Bacteria 1169
230 nmdc:mga06r32_660435_c1 3300050510 Bacteria 1013
231 nmdc:mga06r32_89959_c1 3300050510 Bacteria 2998
232 nmdc:mga08y16_81433_c1 3300050511 Bacteria 3375
233 nmdc:mga0n895_235570_c1 3300050512 Bacteria 1858
234 nmdc:mga0n895_267038_c1 3300050512 Bacteria 1736
235 nmdc:mga0n895_65231_c1 3300050512 Bacteria 3604
236 nmdc:mga0rr50_222630_c1 3300050513 Bacteria 1558
237 nmdc:mga08x19_506848_c1 3300050514 Bacteria 852
238 nmdc:mga0a205_138374_c1 3300050515 Bacteria 2335
239 nmdc:mga0a205_6482_c1 3300050515 Bacteria 10582
240 Ga0500566_0039402 3300053094 Bacteria 2732
241 Ga0500595_000903 3300053119 Bacteria 16937
242 Ga0500573_0008600 3300053140 Bacteria 5627
243 Ga0500616_0110417 3300053153 Bacteria 1329
244 Ga0500627_0115159 3300053158 Bacteria 1211
245 Ga0500638_013517 3300053162 Bacteria 3696
246 Ga0500636_0031659 3300053177 Bacteria 3130
247 Ga0500637_0052430 3300053178 Bacteria 2326
248 Ga0500611_049810 3300053727 Bacteria 955
249 Ga0500645_037105 3300053730 Bacteria 1448
250 Ga0500661_000483 3300055283 Bacteria 7370
251 Ga0587077_045654 3300059493 Bacteria 897
252 Ga0587082_036151 3300059504 Bacteria 885
253 Ga0587088_000909 3300059508 Bacteria 2809
254 Ga0587088_034488 3300059508 Bacteria 923
255 Ga0587091_033305 3300059511 Bacteria 979
256 Ga0587106_000732 3300059605 Bacteria 2536
257 Ga0587115_030673 3300059626 Bacteria 798
258 Ga0587128_007058 3300059630 Bacteria 1405
259 Ga0587067_030987 3300059640 Bacteria 986
260 Ga0587075_000362 3300059644 Bacteria 3418
261 Ga0587078_014668 3300059646 Bacteria 939
262 Ga0587107_040110 3300059652 Bacteria 753
263 Ga0587114_006975 3300059655 Bacteria 1281
264 Ga0587111_0037424 3300060346 Bacteria 1020
265 2509110429 2508501122 Bacteria 6292184
266 2509139841 2508501127 Bacteria 7037543
267 2509379491 2509276019 Bacteria 6802256
268 2510317732 2510065059 Bacteria 6847884
269 2513858480 2513237137 Bacteria 9558895
270 2514588490 2513237351 Bacteria 6968952
271 2517894460 2517572143 Bacteria 9484767
272 2524535794 2524023228 Bacteria 10118060
273 2558861380 2558860100 Bacteria 8458965
274 2599719685 2599185236 Bacteria 6875203
275 2643806619 2643221557 Bacteria 7184309
276 2657684433 2657244999 Bacteria 5946535
277 2688599653 2687453392 Bacteria 6880454
278 2765468297 2765235802 Bacteria 5618596
279 2770196285 2767802442 Bacteria 5747986
280 2776268574 2775506902 Bacteria 6208009
281 2776285345 2775506904 Bacteria 5954060
282 2792643510 2791355094 Bacteria 7011481
283 2804754838 2802429268 Bacteria 6094027
284 2838074733 2838074704 Bacteria 6785777
285 2839997616 2839993093 Bacteria 5512535
286 2840770575 2840764183 Bacteria 6358399
287 2841738525 2841734538 Bacteria 6784580
288 2844014949 2844009547 Bacteria 6728125
289 2850084657 2850079185 Bacteria 6848280
290 2856334175 2856328259 Bacteria 6528202
291 2856341106 2856334872 Bacteria 7037011
292 2856347828 2856342000 Bacteria 7176905
293 2857370437 2857367948 Bacteria 6965560
294 2869235861 2869234852 Bacteria 6654993
295 2869249113 2869242130 Bacteria 6609239
296 2869253899 2869249662 Bacteria 6868783
297 2869260868 2869256925 Bacteria 6981691
298 2869267027 2869264136 Bacteria 6880765
299 2869274002 2869271264 Bacteria 6908218
300 2871437828 2871435913 Bacteria 6880295
301 2871466407 2871459585 Bacteria 6866887
302 2871478810 2871474448 Bacteria 6806570
303 2871484010 2871481445 Bacteria 6700002
304 2874119598 2874116593 Bacteria 6674494
305 2874138668 2874131515 Bacteria 6820270
306 2874164875 2874162495 Bacteria 6174670
307 2876383394 2876377896 Bacteria 6565995
308 2876386494 2876386047 Bacteria 6698674
309 2876400813 2876399893 Bacteria 6927900
310 2876413172 2876406927 Bacteria 6191900
311 2876426182 2876420981 Bacteria 6687741
312 2878760569 2878760144 Bacteria 6823465
313 2878767532 2878767105 Bacteria 6898628
314 2878775316 2878774303 Bacteria 6108671
315 2878782818 2878781027 Bacteria 6834456
316 2878793267 2878788777 Bacteria 6567085
317 2881151028 2881147464 Bacteria 7779814
318 2885308960 2885305155 Bacteria 7348390
319 2885318610 2885312484 Bacteria 6415165
320 2885328611 2885326080 Bacteria 7134805
321 2885336932 2885334103 Bacteria 7216818
322 2888346482 2888343758 Bacteria 6611049
323 2894657353 2894652903 Bacteria 4587256
324 2896386068 2896384573 Bacteria 7700774
325 2903541134 2903540706 Bacteria 7062119
326 2904581906 2904578770 Bacteria 5302906
327 2904705518
328 2906377168 2906370794 Bacteria 6881062
329 2906387957 2906386501 Bacteria 5977019
330 2906396060 2906393657 Bacteria 6790866
331 2906401723 2906401398 Bacteria 6693206
332 2906410782 2906408224 Bacteria 6162342
333 2913295966 2913295892 Bacteria 6333755
334 2919123574 2919119836 Bacteria 5208557
335 2920760558 2920760137 Bacteria 7427611
336 2922155983 2922151315 Bacteria 6902399
337 2922177378 2922172374 Bacteria 6167644
338 2922428112
339 2924745892 2924741084 Bacteria 6661321
340 2924752339 2924748358 Bacteria 6154725
341 2924759531 2924754689 Bacteria 6774424
342 2928525362 2928521798 Bacteria 4960112
343 2935631980 2935630451 Bacteria 8169952
344 2937841808 2937836603 Bacteria 6811263
345 2937848246 2937843397 Bacteria 5256375
346 2937863798 2937861824 Bacteria 6660327
347 2937876506 2937868953 Bacteria 6639878
348 2937987427 2937980651 Bacteria 6517427
349 2937994987 2937994558 Bacteria 7036190
350 2938022216 2938014810 Bacteria 6700592
351 2941507928 2941507105 Bacteria 8166816
352 2941515567 2941515067 Bacteria 8166720
353 2941523858 2941523033 Bacteria 8169134
354 2954011654 2954011201 Bacteria 4762601
355 2958077853 2958071322 Bacteria 6815895
356 2958114181 2958108152 Bacteria 6681128
357 2958127250 2958122699 Bacteria 7280457
358 2958141956 2958137437 Bacteria 6050276
359 2958164622 2958158011 Bacteria 6058449
360 2958165467 2958165035 Bacteria 6906348
361 2961138783 2961136820 Bacteria 6775228
362 2961163925 2961163497 Bacteria 6901077
363 2961189456 2961183825 Bacteria 6688536
364 2965018730 2965018300 Bacteria 6883036
365 2965027894 2965025482 Bacteria 6532201
366 2965037429 2965032056 Bacteria 6887443
367 2965042470 2965040258 Bacteria 6855979
368 2965048079 2965047637 Bacteria 6623551
369 2965095962 2965089291 Bacteria 6866420
370 2965107053 2965102966 Bacteria 6800987
371 2968172331 2968171901 Bacteria 6894245
372 2970490356 2970489779 Bacteria 6517260
373 2970512902 2970510686 Bacteria 7006402
374 2970528037 2970524798 Bacteria 6840927
375 2970539232 2970532167 Bacteria 6553173
376 2970552833 2970547951 Bacteria 6931819
377 2970555421 2970554993 Bacteria 6814252
378 2970619688 2970619444 Bacteria 6986144
379 2970629844 2970627176 Bacteria 6680862
380 2977851673 2977851361 Bacteria 6694324
381 2977867956 2977864932 Bacteria 7534097
382 2977879186 2977872689 Bacteria 7270173
383 2977910437 2977907340 Bacteria 6577984
384 2977936182 2977935797 Bacteria 6252826
385 2977954759 2977950692 Bacteria 6893264
386 2977958908 2977957713 Bacteria 6877875
387 2979778756 2979772303 Bacteria 6618277
388 2987646502 2987645492 Bacteria 6117018
389 2987659937 2987659509 Bacteria 6966464
390 2987675331 2987673487 Bacteria 6884027
391 2996341180 2996336353 Bacteria 5511628
392 2996393195 2996386984 Bacteria 6978667
393 3004188984 3004188549 Bacteria 6952365
394 3004197643 3004195979 Bacteria 6776956
395 3004236558 3004232784 Bacteria 6662140
396 3004242769 3004239961 Bacteria 6892290
397 3004254397 3004248173 Bacteria 6563236
398 3004274487 3004268573 Bacteria 7043476
399 3005478100 3005474847 Bacteria 9259049
400 649874157 649633066 Bacteria 6690028
401 8004302268 8004300914 Bacteria 6132239
402 8004314504 8004312739 Bacteria 7444653
403 8004368517 8004361976 Bacteria 6858373
404 8004397638 8004395343 Bacteria 6620908
405 8004637997 8004633249 Bacteria 6723080
406 8004695267 8004695233 Bacteria 6731676
407 8004733331 8004727605 Bacteria 6643904
408 8019559005 8019555841 Bacteria 9642137
409 8019566297 8019565922 Bacteria 9639779
410 8055620153 8055617313 Bacteria 7548464
411 Ga0114129_10032933
412 JGI24740J21852_10074134
413 JGI24739J22299_10002799
414 JGI25406J46586_10002156
415 JGI25404J52841_10016440
416 Ga0055529_1011559
417 JGI25405J52794_10064940
418 Ga0070690_100323504
419 Ga0068869_100019540
420 Ga0070680_100006858
421 Ga0068868_101123200
422 Ga0070691_10027228
423 Ga0070692_10080825
424 Ga0070668_100074840
425 Ga0070659_100533454
426 Ga0070703_10014844
427 Ga0070701_10079309
428 Ga0070705_100001671
429 Ga0070700_100035618
430 Ga0070694_100020886
431 Ga0070708_100003020
432 Ga0070708_100625865
433 Ga0070663_100023236
434 Ga0070663_101090276
435 Ga0070698_100663888
436 Ga0070699_100000473
437 Ga0070679_100058834
438 Ga0070684_100151890
439 Ga0070697_100087931
440 Ga0068853_100471771
441 Ga0068853_101227440
442 Ga0070695_100002104
443 Ga0070695_100007776
444 Ga0070696_100000229
445 Ga0070704_100001299
446 Ga0070704_100549448
447 Ga0068855_100240963
448 Ga0068857_100001246
449 Ga0068857_100084414
450 Ga0068856_100417943
451 Ga0070702_100594093
452 Ga0068859_100003426
453 Ga0068861_100015249
454 Ga0068860_100215666
455 Ga0068860_101280600
456 Ga0068862_100004070
457 Ga0081455_10000238
458 Ga0081455_10000834
459 Ga0081455_10130467
460 Ga0081540_1000002
461 Ga0081540_1000578
462 Ga0081539_10000302
463 Ga0075365_10078527
464 Ga0075368_10036382
465 Ga0070715_10013320
466 Ga0070716_100788464
467 Ga0075367_10334989
468 Ga0075369_10010525
469 Ga0097621_101604944
470 Ga0075370_10152701
471 Ga0068871_100871411
472 Ga0075428_100179100
473 Ga0075428_100248307
474 Ga0075430_100012065
475 Ga0075430_100058912
476 Ga0075431_100075730
477 Ga0075431_100142803
478 Ga0075431_100419016
479 Ga0075433_10011909
480 Ga0075433_10122387
481 Ga0075434_100033390
482 Ga0075434_100060780
483 Ga0075434_100093292
484 Ga0075429_100515371
485 Ga0097620_100003426
486 Ga0075435_100027465
487 Ga0075435_100233492
488 Ga0099794_10289014
489 Ga0105240_10418582
490 Ga0111539_10039891
491 Ga0111539_10068765
492 Ga0105247_10328670
493 Ga0114129_10276881
494 Ga0114129_10701865
495 Ga0105243_10107326
496 Ga0105249_10019769
497 Ga0105239_10040646
498 Ga0105239_11001694
499 Ga0105246_10288355
500 Ga0157378_10186681
501 Ga0163162_10391071
502 Ga0206356_10385723
503 Ga0206356_11342280
504 Ga0206356_11842510
505 Ga0206354_10632587
506 Ga0214543_1000025
507 Ga0213876_10076676
508 Ga0209677_100258
509 Ga0209233_1001546
510 Ga0209233_1004046
511 Ga0209455_1018966
512 Ga0207653_10021487
513 Ga0207647_10000883
514 Ga0207685_10059685
515 Ga0207671_10128572
516 Ga0207671_10859358
517 Ga0207660_10051296
518 Ga0207704_10757534
519 Ga0207689_10020616
520 Ga0207667_11219457
521 Ga0207712_10002402
522 Ga0207668_11293748
523 Ga0207640_10771352
524 Ga0207703_10504111
525 Ga0207639_10111439
526 Ga0207639_10479995
527 Ga0207639_11263979
528 Ga0207678_10007341
529 Ga0207708_10000819
530 Ga0207702_10095145
531 Ga0207641_11062608
532 Ga0207676_10056471
533 Ga0207674_10000240
534 Ga0207674_10099834
535 Ga0207675_100018792
536 Ga0207683_10372299
537 Ga0207428_10238013
538 Ga0268265_10001328
539 Ga0268264_10091029
540 Ga0268264_11021825
541 Ga0307508_10052417
542 Ga0307405_10307317
543 Ga0307412_10598873
544 Ga0307416_101552593
545 Ga0307414_10504810
546 Ga0307411_10145892
547 Ga0315911_1000027
548 Ga0373928_0009406
549 Ga0373940_0004936
550 Ga0373944_0039384
551 Ga0373949_0006884
552 Ga0373951_0041320
553 Ga0373932_0029090
554 Ga0373932_0061156
555 Ga0373939_0034108
556 Ga0373942_0086464
557 Ga0373961_0193694
558 Ga0373962_0010990
559 Ga0373931_0007882
560 Ga0373931_0013960
561 Ga0373937_0645870
562 Ga0395899_0180641
563 Ga0395900_0308285
564 Ga0395900_0329494
565 Ga0395898_0337147
566 Ga0395898_0616072
567 Ga0395905_0036611
568 Ga0395901_0145188
569 Ga0436361_0028729
570 Ga0439465_0058147
571 Ga0439465_0064754
572 Ga0439465_0126854
573 Ga0451789_0785936
574 Ga0439433_0075155
575 Ga0439445_0117701
576 Ga0439449_0122062
577 Ga0439462_0009211
578 Ga0466967_0079083
579 Ga0466967_0236538
580 Ga0495638_0007337
581 Ga0495651_0099756
582 Ga0495608_0063633
583 Ga0495645_0050516
584 Ga0495668_0529207
585 Ga0495625_0505657
586 Ga0495635_0431485
587 Ga0495604_0057442
588 Ga0495677_0248984
589 Ga0496100_0382571
590 Ga0496100_0442234
591 Ga0496100_0918225
592 Ga0496102_0012811
593 Ga0496102_0130777
594 Ga0496102_0762049
595 Ga0496103_0252276
596 Ga0496104_0278623
597 Ga0496105_0291777
598 Ga0496106_0010658
599 Ga0496107_0006883
600 Ga0496107_0339228
601 Ga0496109_0430016
602 Ga0496110_0350552
603 Ga0496110_0539881
604 Ga0496115_0065226
605 Ga0496117_0131734
606 Ga0496118_0019924
607 Ga0496121_0047152
608 Ga0496121_0093804
609 Ga0496121_0312682
610 Ga0496121_0318492
611 Ga0496125_0421683
612 Ga0496126_0382017
613 Ga0501031_0222436
614 Ga0501032_0034660
615 Ga0501032_0342991
616 Ga0501034_0005856
617 Ga0501034_0115815
618 Ga0501034_0404817
619 Ga0501036_0045956
620 Ga0501036_0479363
621 Ga0501037_0164465
622 Ga0501038_0047251
623 Ga0501040_0976227
624 Ga0501046_0172672
625 Ga0501046_0183969
626 Ga0501048_0031746
627 Ga0501068_0215837
628 Ga0501070_0527717
629 Ga0501073_0110585
630 Ga0501074_0225625
631 Ga0501080_0033665
632 Ga0501083_0201034
633 Ga0501044_0208781
634 nmdc:mga05p37_89930_c1
635 nmdc:mga09592_329555_c1
636 nmdc:mga09592_44934_c1
637 nmdc:mga0qj67_15200_c1
638 nmdc:mga0qj67_43448_c1
639 nmdc:mga06r32_517682_c1
640 nmdc:mga06r32_660435_c1
641 nmdc:mga06r32_89959_c1
642 nmdc:mga08y16_81433_c1
643 nmdc:mga0n895_235570_c1
644 nmdc:mga0n895_267038_c1
645 nmdc:mga0n895_65231_c1
646 nmdc:mga0rr50_222630_c1
647 nmdc:mga08x19_506848_c1
648 nmdc:mga0a205_138374_c1
649 nmdc:mga0a205_6482_c1
650 Ga0500566_0039402
651 Ga0500595_000903
652 Ga0500573_0008600
653 Ga0500616_0110417
654 Ga0500627_0115159
655 Ga0500638_013517
656 Ga0500636_0031659
657 Ga0500637_0052430
658 Ga0500611_049810
659 Ga0500645_037105
660 Ga0500661_000483
661 Ga0587077_045654
662 Ga0587082_036151
663 Ga0587088_000909
664 Ga0587088_034488
665 Ga0587091_033305
666 Ga0587106_000732
667 Ga0587115_030673
668 Ga0587128_007058
669 Ga0587067_030987
670 Ga0587075_000362
671 Ga0587078_014668
672 Ga0587107_040110
673 Ga0587114_006975
674 Ga0587111_0037424
675 2509110429
676 2509139841
677 2509379491
678 2510317732
679 2513858480
680 2514588490
681 2517894460
682 2524535794
683 2558861380
684 2599719685
685 2643806619
686 2657684433
687 2688599653
688 2765468297
689 2770196285
690 2776268574
691 2776285345
692 2792643510
693 2804754838
694 2838074733
695 2839997616
696 2840770575
697 2841738525
698 2844014949
699 2850084657
700 2856334175
701 2856341106
702 2856347828
703 2857370437
704 2869235861
705 2869249113
706 2869253899
707 2869260868
708 2869267027
709 2869274002
710 2871437828
711 2871466407
712 2871478810
713 2871484010
714 2874119598
715 2874138668
716 2874164875
717 2876383394
718 2876386494
719 2876400813
720 2876413172
721 2876426182
722 2878760569
723 2878767532
724 2878775316
725 2878782818
726 2878793267
727 2881151028
728 2885308960
729 2885318610
730 2885328611
731 2885336932
732 2888346482
733 2894657353
734 2896386068
735 2903541134
736 2904581906
737 2904705518
738 2906377168
739 2906387957
740 2906396060
741 2906401723
742 2906410782
743 2913295966
744 2919123574
745 2920760558
746 2922155983
747 2922177378
748 2922428112
749 2924745892
750 2924752339
751 2924759531
752 2928525362
753 2935631980
754 2937841808
755 2937848246
756 2937863798
757 2937876506
758 2937987427
759 2937994987
760 2938022216
761 2941507928
762 2941515567
763 2941523858
764 2954011654
765 2958077853
766 2958114181
767 2958127250
768 2958141956
769 2958164622
770 2958165467
771 2961138783
772 2961163925
773 2961189456
774 2965018730
775 2965027894
776 2965037429
777 2965042470
778 2965048079
779 2965095962
780 2965107053
781 2968172331
782 2970490356
783 2970512902
784 2970528037
785 2970539232
786 2970552833
787 2970555421
788 2970619688
789 2970629844
790 2977851673
791 2977867956
792 2977879186
793 2977910437
794 2977936182
795 2977954759
796 2977958908
797 2979778756
798 2987646502
799 2987659937
800 2987675331
801 2996341180
802 2996393195
803 3004188984
804 3004197643
805 3004236558
806 3004242769
807 3004254397
808 3004274487
809 3005478100
810 649874157
811 8004302268
812 8004314504
813 8004368517
814 8004397638
815 8004637997
816 8004695267
817 8004733331
818 8019559005
819 8019566297
820 8055620153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

101

181

0.81

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

102

180

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6onq-assembly1.cif.gz_A crystal structure of c-type cytochrome xoxg from methylobacterium extorquens am1 0.9316 30 171
6onq-assembly1.cif.gz_A crystal structure of c-type cytochrome xoxg from methylobacterium extorquens am1 0.8139 30 171
1k3g-assembly1.cif.gz_A nmr solution structure of oxidized cytochrome c-553 from bacillus pasteurii 0.7442 64 144
1k3g-assembly1.cif.gz_A nmr solution structure of oxidized cytochrome c-553 from bacillus pasteurii 0.7183 64 144
1c75-assembly1.cif.gz_A "0.97 a ""ab initio"" crystal structure of cytochrome c-553 from bacillus pasteurii" 0.7059 67 144
ID Description Score Start End Superfamily
3mk7C02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7466 61 144 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7442 64 144 1.10.760.10
1h9yB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7272 61 155 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7183 64 144 1.10.760.10
1h9yB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6919 61 155 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A6G9WCI7-F1-model_v4 C-type cytochrome, methanol metabolism-related 0.9436 32 174 GO:0009055
GO:0020037
GO:0046872
AF-A0A435TVX7-F1-model_v4 C-type cytochrome, methanol metabolism-related 0.9416 31 174 GO:0009055
GO:0020037
GO:0046872
AF-A0A537TNM2-F1-model_v4 C-type cytochrome, methanol metabolism-related 0.9388 32 173 GO:0009055
GO:0020037
AF-A0A853VGQ9-F1-model_v4 deleted 0.9386 17 174
AF-A0A6L6J0Y9-F1-model_v4 C-type cytochrome, methanol metabolism-related 0.9383 32 174 GO:0009055
GO:0020037
GO:0046872

Map