F437204

General Info

Members Datasets Scaffolds Average Seq Length
410 255 410 323

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10076237|Ga0070717_100762374
Length 337
Sequence MHSELRNRDTSVLCLRPQADFARVDALPPSSVAVDYRAPTDADVPDLMRQAAALVIPAVGPPLPAKLFEGTRLKLVQVTGAGLDRLDVAALTRLGIPVANVPGGSNGAVAEYAVTSASLLLRRFAWSSDEIKRGNYVTFRAALIGANLGGLDGLTVGVVGFGTIGVAVAKAFAAANCRLCYHDPAPPDPQAAAALGAQSLSLPELLERSDVVTLHVPLLPATRGLIGAGELARMKRGAVLIQASRGGVVDEAALADALRSQHLGGAAVDVYSTEPPGPDNPLLALDGEGAQRLLLTPHIAGVTRQASAYLFASSWENVERVVIKGSPPLNRANPVLP

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
152 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
250 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
251 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0
Rhizoplane 7.8
Rhizosphere 89.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10011605 3300002459 Unclassified 1816
2 JGI25153J46596_10000737 3300003215 Bacteria 20058
3 Ga0070658_10048551 3300005327 Bacteria 3437
4 Ga0070658_10093740 3300005327 Bacteria 2477
5 Ga0070683_100216108 3300005329 Bacteria 1822
6 Ga0070690_100055677 3300005330 Bacteria 2534
7 Ga0070690_100065406 3300005330 Bacteria 2351
8 Ga0070670_100012722 3300005331 Bacteria 7201
9 Ga0068869_100079602 3300005334 Bacteria 2442
10 Ga0070689_100010035 3300005340 Bacteria 6741
11 Ga0070687_100078362 3300005343 Bacteria 1796
12 Ga0070661_100105667 3300005344 Bacteria 2099
13 Ga0070668_100141590 3300005347 Bacteria 1938
14 Ga0070668_100487884 3300005347 Unclassified 1065
15 Ga0070675_100049148 3300005354 Bacteria 3461
16 Ga0070674_100215318 3300005356 Unclassified 1491
17 Ga0070673_100128906 3300005364 Bacteria 2120
18 Ga0070673_100201111 3300005364 Unclassified 1716
19 Ga0070688_100088534 3300005365 Bacteria 2019
20 Ga0070688_100181015 3300005365 Bacteria 1462
21 Ga0070667_100026413 3300005367 Bacteria 4830
22 Ga0070714_100089370 3300005435 Unclassified 2697
23 Ga0070714_100160350 3300005435 Bacteria 2034
24 Ga0070713_100033453 3300005436 Bacteria 4118
25 Ga0070701_10006456 3300005438 Bacteria 4938
26 Ga0070711_100331484 3300005439 Bacteria 1218
27 Ga0070705_100085520 3300005440 Bacteria 1950
28 Ga0070700_100019982 3300005441 Bacteria 3873
29 Ga0070694_100070876 3300005444 Bacteria 2401
30 Ga0070663_100075945 3300005455 Bacteria 2456
31 Ga0070678_100076483 3300005456 Bacteria 2522
32 Ga0070681_10096918 3300005458 Bacteria 2897
33 Ga0068867_100146030 3300005459 Bacteria 1854
34 Ga0070679_100032177 3300005530 Bacteria 5186
35 Ga0070679_100060960 3300005530 Unclassified 3760
36 Ga0070679_100230753 3300005530 Bacteria 1810
37 Ga0070679_100320226 3300005530 Bacteria 1500
38 Ga0070684_100167367 3300005535 Bacteria 1996
39 Ga0068853_100034275 3300005539 Bacteria 4309
40 Ga0070686_100046860 3300005544 Bacteria 2730
41 Ga0070704_100031036 3300005549 Bacteria 3588
42 Ga0070704_100086152 3300005549 Bacteria 2327
43 Ga0068855_100019711 3300005563 Bacteria 8100
44 Ga0068855_100338156 3300005563 Bacteria 1660
45 Ga0070664_100195579 3300005564 Unclassified 1803
46 Ga0068856_100081718 3300005614 Bacteria 3206
47 Ga0070702_100005939 3300005615 Bacteria 5738
48 Ga0070702_100066659 3300005615 Bacteria 2112
49 Ga0068864_100011942 3300005618 Bacteria 7170
50 Ga0068864_100275442 3300005618 Bacteria 1569
51 Ga0068864_100305238 3300005618 Bacteria 1491
52 Ga0068864_100474287 3300005618 Bacteria 1200
53 Ga0068861_100072444 3300005719 Bacteria 2673
54 Ga0068870_10046279 3300005840 Bacteria 2280
55 Ga0068863_100008931 3300005841 Bacteria 9785
56 Ga0068858_100006106 3300005842 Bacteria 11751
57 Ga0068862_100081097 3300005844 Bacteria 2814
58 Ga0081455_10013177 3300005937 Bacteria 8192
59 Ga0081540_1083213 3300005983 Bacteria 1432
60 Ga0081539_10021153 3300005985 Bacteria 4357
61 Ga0070717_10076237 3300006028 Bacteria 2806
62 Ga0075365_10026679 3300006038 Bacteria 3669
63 Ga0070712_100154361 3300006175 Bacteria 1766
64 Ga0070712_100213930 3300006175 Bacteria 1522
65 Ga0075366_10033724 3300006195 Bacteria 3016
66 Ga0068871_100021703 3300006358 Bacteria 4940
67 Ga0075428_100101572 3300006844 Bacteria 3135
68 Ga0075430_100000276 3300006846 Bacteria 36027
69 Ga0075434_100070324 3300006871 Bacteria 3491
70 Ga0068865_100042256 3300006881 Bacteria 3108
71 Ga0075436_100000949 3300006914 Bacteria 19406
72 Ga0075436_100007281 3300006914 Bacteria 7567
73 Ga0075436_100096676 3300006914 Bacteria 2054
74 Ga0075435_100098650 3300007076 Bacteria 2418
75 Ga0075435_100157284 3300007076 Bacteria 1913
76 Ga0099794_10090625 3300007265 Unclassified 1517
77 Ga0099795_10010801 3300007788 Bacteria 2704
78 Ga0105240_10007867 3300009093 Bacteria 15383
79 Ga0105240_10104581 3300009093 Bacteria 3438
80 Ga0105240_10113543 3300009093 Bacteria 3274
81 Ga0111539_10051024 3300009094 Bacteria 4928
82 Ga0111539_10411600 3300009094 Bacteria 1575
83 Ga0105247_10022463 3300009101 Bacteria 3800
84 Ga0114129_10011961 3300009147 Bacteria 12345
85 Ga0105243_10080130 3300009148 Bacteria 2662
86 Ga0105248_10136151 3300009177 Bacteria 2770
87 Ga0105248_10201703 3300009177 Bacteria 2241
88 Ga0105238_10010090 3300009551 Bacteria 9471
89 Ga0105238_10084949 3300009551 Bacteria 3154
90 Ga0105249_10023729 3300009553 Bacteria 5508
91 Ga0105249_10394575 3300009553 Bacteria 1413
92 Ga0105239_10338115 3300010375 Unclassified 1699
93 Ga0105246_10095285 3300011119 Bacteria 2155
94 Ga0157373_10202511 3300013100 Bacteria 1399
95 Ga0157370_10011542 3300013104 Bacteria 9224
96 Ga0157369_10000857 3300013105 Bacteria 38789
97 Ga0157369_10150261 3300013105 Bacteria 2462
98 Ga0157372_10002300 3300013307 Bacteria 20723
99 Ga0157375_10131921 3300013308 Bacteria 2618
100 Ga0163163_10031013 3300014325 Bacteria 5155
101 Ga0157380_10278790 3300014326 Unclassified 1528
102 Ga0157377_10083697 3300014745 Bacteria 1869
103 Ga0157376_10116935 3300014969 Bacteria 2357
104 Ga0163161_10340193 3300017792 Bacteria 1190
105 Ga0209758_1000798 3300025297 Bacteria 44669
106 Ga0209758_1049370 3300025297 Bacteria 1486
107 Ga0207710_10008469 3300025900 Bacteria 4336
108 Ga0207688_10011456 3300025901 Bacteria 4829
109 Ga0207699_10038479 3300025906 Bacteria 2741
110 Ga0207643_10000769 3300025908 Bacteria 19602
111 Ga0207705_10006540 3300025909 Bacteria 8633
112 Ga0207705_10023497 3300025909 Bacteria 4397
113 Ga0207705_10029319 3300025909 Bacteria 3923
114 Ga0207693_10006096 3300025915 Bacteria 9987
115 Ga0207693_10095771 3300025915 Bacteria 2327
116 Ga0207663_10345169 3300025916 Bacteria 1125
117 Ga0207662_10016786 3300025918 Bacteria 4134
118 Ga0207657_10054159 3300025919 Bacteria 3471
119 Ga0207652_10020288 3300025921 Bacteria 5472
120 Ga0207652_10105827 3300025921 Unclassified 2489
121 Ga0207652_10192147 3300025921 Bacteria 1836
122 Ga0207650_10017407 3300025925 Bacteria 5032
123 Ga0207659_10066818 3300025926 Bacteria 2611
124 Ga0207700_10349903 3300025928 Bacteria 1286
125 Ga0207664_10174225 3300025929 Bacteria 1843
126 Ga0207644_10008179 3300025931 Bacteria 6853
127 Ga0207644_10055316 3300025931 Bacteria 2860
128 Ga0207709_10081501 3300025935 Bacteria 2087
129 Ga0207670_10005450 3300025936 Bacteria 6980
130 Ga0207670_10388481 3300025936 Bacteria 1113
131 Ga0207669_10044810 3300025937 Bacteria 2602
132 Ga0207669_10097116 3300025937 Bacteria 1936
133 Ga0207704_10038142 3300025938 Bacteria 2783
134 Ga0207704_10213597 3300025938 Bacteria 1422
135 Ga0207691_10058893 3300025940 Bacteria 3493
136 Ga0207691_10178082 3300025940 Bacteria 1859
137 Ga0207711_10088525 3300025941 Bacteria 2719
138 Ga0207689_10005268 3300025942 Bacteria 11592
139 Ga0207661_10196110 3300025944 Bacteria 1773
140 Ga0207661_10360883 3300025944 Unclassified 1312
141 Ga0207667_10081194 3300025949 Bacteria 3359
142 Ga0207651_10084643 3300025960 Bacteria 2298
143 Ga0207651_10086550 3300025960 Bacteria 2278
144 Ga0207668_10297589 3300025972 Unclassified 1330
145 Ga0207658_10018161 3300025986 Bacteria 4852
146 Ga0207703_10018493 3300026035 Bacteria 5441
147 Ga0207639_10096984 3300026041 Bacteria 2373
148 Ga0207639_10103524 3300026041 Bacteria 2306
149 Ga0207678_10023862 3300026067 Bacteria 5349
150 Ga0207708_10016268 3300026075 Bacteria 5589
151 Ga0207702_10128174 3300026078 Bacteria 2281
152 Ga0207641_10238819 3300026088 Bacteria 1692
153 Ga0207648_10077732 3300026089 Bacteria 2894
154 Ga0207676_10341028 3300026095 Unclassified 1382
155 Ga0207676_10347091 3300026095 Bacteria 1371
156 Ga0207675_100002971 3300026118 Bacteria 16687
157 Ga0207683_10084614 3300026121 Bacteria 2819
158 Ga0207698_10146572 3300026142 Bacteria 2042
159 Ga0265356_1000482 3300028017 Bacteria 7199
160 Ga0265338_10004838 3300028800 Bacteria 17970
161 Ga0265762_1005543 3300030760 Bacteria 2263
162 Ga0265340_10009007 3300031247 Bacteria 5372
163 Ga0265339_10048274 3300031249 Bacteria 2334
164 Ga0265331_10003706 3300031250 Bacteria 9721
165 Ga0265314_10004028 3300031711 Bacteria 13890
166 Ga0265342_10015949 3300031712 Bacteria 4926
167 Ga0373934_0000019 3300035086 Bacteria 56145
168 Ga0373934_0002315 3300035086 Bacteria 7007
169 Ga0373934_0054804 3300035086 Unclassified 1583
170 Ga0373944_0047560 3300035089 Bacteria 1344
171 Ga0373936_0002055 3300035113 Bacteria 7457
172 Ga0373945_0051313 3300035116 Bacteria 1517
173 Ga0373953_0000993 3300035117 Bacteria 7981
174 Ga0373953_0009372 3300035117 Bacteria 3366
175 Ga0373953_0083394 3300035117 Unclassified 1331
176 Ga0373954_0000201 3300035118 Bacteria 21841
177 Ga0373954_0001352 3300035118 Bacteria 9881
178 Ga0373956_0000002 3300035119 Bacteria 88965
179 Ga0373956_0045877 3300035119 Bacteria 1951
180 Ga0373957_0004959 3300035120 Bacteria 4097
181 Ga0373957_0013984 3300035120 Bacteria 2736
182 Ga0373957_0023505 3300035120 Bacteria 2205
183 Ga0373957_0035522 3300035120 Bacteria 1852
184 Ga0373960_0025618 3300035121 Bacteria 1605
185 Ga0373943_0001697 3300035170 Bacteria 9992
186 Ga0373943_0007738 3300035170 Bacteria 4824
187 Ga0373946_0014882 3300035171 Bacteria 2940
188 Ga0373946_0020063 3300035171 Bacteria 2580
189 Ga0373955_0000145 3300035172 Bacteria 28047
190 Ga0373955_0001863 3300035172 Bacteria 9072
191 Ga0373955_0005786 3300035172 Bacteria 5581
192 Ga0373955_0016489 3300035172 Bacteria 3638
193 Ga0373924_0017354 3300035410 Bacteria 2760
194 Ga0373924_0072136 3300035410 Bacteria 1458
195 Ga0373931_0020344 3300035691 Bacteria 3320
196 Ga0373931_0033184 3300035691 Bacteria 2674
197 Ga0373935_0000017 3300035692 Bacteria 70368
198 Ga0373935_0043911 3300035692 Bacteria 2815
199 Ga0373935_0054499 3300035692 Bacteria 2546
200 Ga0373927_0006305 3300035695 Bacteria 8089
201 Ga0373927_0028566 3300035695 Bacteria 3639
202 Ga0373927_0033671 3300035695 Bacteria 3336
203 Ga0373927_0257480 3300035695 Bacteria 1147
204 Ga0373933_0000386 3300035724 Bacteria 28300
205 Ga0373933_0001257 3300035724 Bacteria 14967
206 Ga0373933_0072820 3300035724 Bacteria 2093
207 Ga0373947_0002594 3300035725 Bacteria 10851
208 Ga0373947_0037249 3300035725 Bacteria 2886
209 Ga0373947_0039380 3300035725 Bacteria 2812
210 Ga0373947_0047012 3300035725 Bacteria 2585
211 Ga0373937_0000085 3300036401 Bacteria 85937
212 Ga0373937_0000103 3300036401 Bacteria 80386
213 Ga0373937_0000123 3300036401 Bacteria 74156
214 Ga0373937_0017766 3300036401 Bacteria 6345
215 Ga0373937_0018537 3300036401 Bacteria 6217
216 Ga0373937_0181430 3300036401 Bacteria 1977
217 Ga0373937_0248953 3300036401 Bacteria 1675
218 Ga0373937_0312548 3300036401 Bacteria 1486
219 Ga0373925_0000058 3300037068 Bacteria 122682
220 Ga0373925_0016592 3300037068 Bacteria 5335
221 Ga0373925_0049283 3300037068 Bacteria 3139
222 Ga0373925_0095583 3300037068 Bacteria 2276
223 Ga0373925_0134102 3300037068 Bacteria 1933
224 Ga0395899_0018529 3300037312 Bacteria 5291
225 Ga0395899_0075220 3300037312 Bacteria 2466
226 Ga0395900_0003113 3300037418 Bacteria 18011
227 Ga0395900_0009465 3300037418 Bacteria 9986
228 Ga0395898_0022352 3300037466 Bacteria 6405
229 Ga0395898_0152561 3300037466 Bacteria 2210
230 Ga0395898_0333882 3300037466 Bacteria 1445
231 Ga0395905_0047328 3300037471 Bacteria 4031
232 Ga0395901_0009726 3300038443 Bacteria 9749
233 Ga0395901_0023119 3300038443 Bacteria 6372
234 Ga0395901_0038926 3300038443 Bacteria 4918
235 Ga0439432_070988 3300042006 Bacteria 1062
236 Ga0439435_0001572 3300042436 Bacteria 4273
237 Ga0466958_0014414 3300045836 Bacteria 4514
238 Ga0495592_0000062 3300046454 Bacteria 99207
239 Ga0495592_0248298 3300046454 Unclassified 1177
240 Ga0495603_0052632 3300046455 Bacteria 2416
241 Ga0495629_0042860 3300046459 Bacteria 3179
242 Ga0495629_0046217 3300046459 Bacteria 3054
243 Ga0495651_0000046 3300046462 Bacteria 89908
244 Ga0495651_0000952 3300046462 Bacteria 22386
245 Ga0495651_0012045 3300046462 Bacteria 6655
246 Ga0495653_0000072 3300046463 Bacteria 85266
247 Ga0495653_0012794 3300046463 Bacteria 6850
248 Ga0495582_0044578 3300046473 Bacteria 2443
249 Ga0495582_0064008 3300046473 Bacteria 2030
250 Ga0495582_0081989 3300046473 Bacteria 1792
251 Ga0495639_0118776 3300046475 Unclassified 1260
252 Ga0495662_0055026 3300046476 Bacteria 1922
253 Ga0495664_0000009 3300046477 Bacteria 289534
254 Ga0495664_0028337 3300046477 Bacteria 3270
255 Ga0495584_0008237 3300046491 Bacteria 5404
256 Ga0495584_0116092 3300046491 Bacteria 1355
257 Ga0495585_0041488 3300046492 Bacteria 2581
258 Ga0495585_0115094 3300046492 Bacteria 1427
259 Ga0495608_0000061 3300046511 Bacteria 86891
260 Ga0495608_0139145 3300046511 Bacteria 1550
261 Ga0495618_0000061 3300046514 Bacteria 78337
262 Ga0495618_0051360 3300046514 Bacteria 2604
263 Ga0495628_0000012 3300046516 Bacteria 224162
264 Ga0495628_0019735 3300046516 Bacteria 5569
265 Ga0495630_0000644 3300046517 Bacteria 25266
266 Ga0495630_0035480 3300046517 Bacteria 3726
267 Ga0495630_0054893 3300046517 Bacteria 2985
268 Ga0495637_0043387 3300046520 Bacteria 1920
269 Ga0495644_0049293 3300046523 Bacteria 1581
270 Ga0495666_0074139 3300046526 Bacteria 1614
271 Ga0495652_0000021 3300046529 Bacteria 181454
272 Ga0495652_0215215 3300046529 Bacteria 1447
273 Ga0495665_0045624 3300046531 Bacteria 2328
274 Ga0495640_0000028 3300046533 Bacteria 79904
275 Ga0495640_0128118 3300046533 Bacteria 1644
276 Ga0495640_0205679 3300046533 Bacteria 1246
277 Ga0495587_0000033 3300046536 Bacteria 123885
278 Ga0495587_0003929 3300046536 Bacteria 9866
279 Ga0495645_0000017 3300046543 Bacteria 156865
280 Ga0495667_0000011 3300046559 Bacteria 222545
281 Ga0495667_0055897 3300046559 Bacteria 2595
282 Ga0495667_0323262 3300046559 Bacteria 976
283 Ga0495634_0000220 3300046642 Bacteria 53609
284 Ga0495635_0000019 3300046663 Bacteria 193402
285 Ga0495635_0166023 3300046663 Unclassified 1502
286 Ga0495657_0000378 3300046675 Bacteria 41496
287 Ga0495599_0000024 3300046678 Bacteria 121388
288 Ga0495599_0010345 3300046678 Bacteria 5704
289 Ga0495623_0000022 3300046679 Bacteria 98899
290 Ga0495623_0051694 3300046679 Bacteria 2598
291 Ga0495646_0000033 3300046680 Bacteria 83930
292 Ga0495647_0004166 3300046681 Bacteria 4684
293 Ga0495658_0020087 3300046683 Bacteria 3499
294 Ga0495658_0030435 3300046683 Bacteria 2931
295 Ga0495613_0012981 3300046689 Bacteria 6189
296 Ga0495613_0030879 3300046689 Bacteria 3980
297 Ga0495624_0039712 3300046690 Bacteria 3016
298 Ga0495624_0157593 3300046690 Bacteria 1387
299 Ga0495671_0214808 3300046692 Bacteria 932
300 Ga0495600_0000028 3300046809 Bacteria 90661
301 Ga0495600_0002659 3300046809 Bacteria 10327
302 Ga0495604_0000011 3300047317 Bacteria 292024
303 Ga0495604_0003069 3300047317 Bacteria 13351
304 Ga0495674_0000015 3300047319 Bacteria 224071
305 Ga0495674_0029334 3300047319 Bacteria 5011
306 Ga0495680_0000895 3300047322 Bacteria 33127
307 Ga0495680_0098947 3300047322 Bacteria 2175
308 Ga0495680_0109430 3300047322 Bacteria 2049
309 Ga0495675_0000295 3300047444 Bacteria 35782
310 Ga0495675_0009018 3300047444 Bacteria 6202
311 Ga0495675_0026377 3300047444 Bacteria 3705
312 Ga0495684_0000036 3300047471 Bacteria 107181
313 Ga0495593_0001674 3300047673 Bacteria 13131
314 Ga0495602_0000018 3300048088 Bacteria 183837
315 Ga0495602_0000362 3300048088 Bacteria 42468
316 Ga0496100_0002533 3300048903 Bacteria 9311
317 Ga0496101_0022442 3300048904 Bacteria 4344
318 Ga0496102_0122205 3300048905 Bacteria 2432
319 Ga0496103_0014648 3300048906 Bacteria 4659
320 Ga0496104_0000245 3300048907 Bacteria 47976
321 Ga0496104_0008767 3300048907 Bacteria 8991
322 Ga0496104_0010133 3300048907 Bacteria 8415
323 Ga0496104_0112100 3300048907 Bacteria 2615
324 Ga0496105_0004197 3300048908 Bacteria 10818
325 Ga0496105_0005925 3300048908 Bacteria 9326
326 Ga0496108_0001908 3300048911 Bacteria 16679
327 Ga0496108_0281320 3300048911 Bacteria 1448
328 Ga0496109_0006772 3300048912 Bacteria 9651
329 Ga0496110_0017717 3300048913 Bacteria 5958
330 Ga0496111_0001877 3300048914 Bacteria 12424
331 Ga0496111_0080244 3300048914 Bacteria 2380
332 Ga0496111_0145178 3300048914 Bacteria 1759
333 Ga0496112_0007911 3300048915 Bacteria 9469
334 Ga0496112_0108703 3300048915 Bacteria 2743
335 Ga0496112_0184598 3300048915 Bacteria 2049
336 Ga0496112_0233100 3300048915 Bacteria 1795
337 Ga0496113_0000265 3300048916 Bacteria 24730
338 Ga0496113_0014723 3300048916 Bacteria 5348
339 Ga0496113_0051677 3300048916 Bacteria 3068
340 Ga0496114_0005503 3300048917 Bacteria 9916
341 Ga0496114_0032832 3300048917 Bacteria 4275
342 Ga0496114_0115898 3300048917 Bacteria 2299
343 Ga0496114_0144839 3300048917 Bacteria 2059
344 Ga0496115_0058777 3300048918 Bacteria 3095
345 Ga0496115_0059523 3300048918 Bacteria 3076
346 Ga0496115_0060997 3300048918 Bacteria 3040
347 Ga0496115_0159291 3300048918 Bacteria 1865
348 Ga0501033_0022899 3300049570 Bacteria 4710
349 Ga0501033_0317193 3300049570 Bacteria 1095
350 Ga0501034_0149620 3300049571 Bacteria 2311
351 Ga0501036_0415046 3300049572 Bacteria 1122
352 Ga0501038_0089820 3300049574 Unclassified 2576
353 Ga0501038_0186706 3300049574 Bacteria 1670
354 Ga0501039_0008714 3300049575 Bacteria 7723
355 Ga0501040_0090790 3300049576 Bacteria 2123
356 Ga0501041_0108278 3300049577 Bacteria 1723
357 Ga0501042_0293212 3300049578 Bacteria 1175
358 Ga0501043_0020848 3300049579 Bacteria 5141
359 Ga0501043_0038145 3300049579 Bacteria 3778
360 Ga0501046_0024431 3300049580 Bacteria 4958
361 Ga0501046_0044225 3300049580 Bacteria 3542
362 Ga0501047_0024393 3300049581 Bacteria 5805
363 Ga0501068_0185946 3300049584 Bacteria 1315
364 Ga0501069_0198800 3300049585 Bacteria 1161
365 Ga0501070_0005380 3300049586 Bacteria 10921
366 Ga0501071_0004137 3300049587 Bacteria 9170
367 Ga0501074_0351287 3300049590 Bacteria 1046
368 Ga0501075_0010380 3300049591 Bacteria 6544
369 Ga0501076_0025931 3300049592 Bacteria 4538
370 Ga0501077_0017571 3300049593 Bacteria 4517
371 Ga0501079_0006645 3300049741 Bacteria 8697
372 Ga0501080_0054801 3300049742 Bacteria 3713
373 Ga0501080_0096293 3300049742 Bacteria 2748
374 Ga0501081_0000033 3300049743 Bacteria 51492
375 Ga0501083_0099920 3300049744 Bacteria 1914
376 Ga0501035_0039201 3300049822 Bacteria 4288
377 Ga0501044_0053305 3300049823 Bacteria 4161
378 Ga0501044_0339509 3300049823 Bacteria 1423
379 nmdc:mga03n38_76777_c1 3300050490 Bacteria 1559
380 nmdc:mga0yw44_118296_c1 3300050492 Bacteria 1705
381 nmdc:mga0k408_51560_c1 3300050493 Bacteria 2384
382 nmdc:mga05p37_5101_c1 3300050507 Bacteria 15404
383 nmdc:mga0qj67_143421_c1 3300050509 Bacteria 1936
384 nmdc:mga0qj67_18_c1 3300050509 Bacteria 120268
385 nmdc:mga08y16_137081_c1 3300050511 Bacteria 2544
386 nmdc:mga0n895_124402_c1 3300050512 Bacteria 2602
387 nmdc:mga0n895_127444_c1 3300050512 Bacteria 2569
388 nmdc:mga0n895_49442_c1 3300050512 Bacteria 4119
389 nmdc:mga0rr50_165852_c1 3300050513 Bacteria 1796
390 nmdc:mga0rr50_192781_c1 3300050513 Bacteria 1671
391 nmdc:mga08x19_48336_c1 3300050514 Bacteria 2726
392 nmdc:mga08x19_5092_c1 3300050514 Bacteria 7772
393 nmdc:mga08x19_5696_c1 3300050514 Bacteria 7363
394 Ga0495601_0000024 3300053077 Bacteria 133160
395 Ga0495612_0000079 3300053078 Bacteria 44236
396 Ga0495595_0000036 3300053084 Bacteria 79035
397 Ga0495595_0031439 3300053084 Unclassified 2386
398 Ga0495595_0038351 3300053084 Bacteria 2183
399 Ga0495619_0000034 3300053085 Bacteria 129851
400 Ga0495619_0017057 3300053085 Bacteria 4604
401 Ga0495619_0085345 3300053085 Bacteria 2132
402 Ga0495619_0093306 3300053085 Bacteria 2040
403 Ga0495619_0155533 3300053085 Bacteria 1578
404 Ga0500643_003818 3300053087 Bacteria 7028
405 Ga0500566_0042182 3300053094 Bacteria 2633
406 Ga0500595_000022 3300053119 Bacteria 149029
407 Ga0500616_0010004 3300053153 Bacteria 5701
408 Ga0501082_0003399 3300060353 Bacteria 13894
409 Ga0466962_0055454 3300061719 Bacteria 1894
410 Ga0530510_0071140 3300061734 Bacteria 2525

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053087 Ga0500643_003818 Ga0500643_003818_20_922 267
2 3300048911 Ga0496108_0281320 Ga0496108_0281320_201_1157 271
3 3300049570 Ga0501033_0317193 Ga0501033_0317193_227_1078 283
4 3300049578 Ga0501042_0293212 Ga0501042_0293212_313_1164 283
5 3300036401 Ga0373937_0248953 Ga0373937_0248953_364_1341 285
6 3300046533 Ga0495640_0205679 Ga0495640_0205679_375_1235 286
7 3300050490 nmdc:mga03n38_76777_c1 nmdc:mga03n38_76777_c1_664_1524 286
8 3300046692 Ga0495671_0214808 Ga0495671_0214808_20_892 290
9 3300053094 Ga0500566_0042182 Ga0500566_0042182_227_1204 292
10 3300053119 Ga0500595_000022 Ga0500595_000022_99193_100170 292
11 3300035120 Ga0373957_0004959 Ga0373957_0004959_53_952 299
12 3300046559 Ga0495667_0323262 Ga0495667_0323262_27_929 299
13 3300009551 Ga0105238_10084949 Ga0105238_100849494 300
14 3300006914 Ga0075436_100000949 Ga0075436_1000009497 306
15 3300009093 Ga0105240_10007867 Ga0105240_100078679 306
16 3300026142 Ga0207698_10146572 Ga0207698_101465723 306
17 3300035695 Ga0373927_0006305 Ga0373927_0006305_5372_6352 306
18 3300046475 Ga0495639_0118776 Ga0495639_0118776_238_1218 306
19 3300046531 Ga0495665_0045624 Ga0495665_0045624_1128_2108 306
20 3300046683 Ga0495658_0030435 Ga0495658_0030435_426_1406 306
21 3300050514 nmdc:mga08x19_5696_c1 nmdc:mga08x19_5696_c1_761_1735 306
22 3300006914 Ga0075436_100096676 Ga0075436_1000966762 307
23 3300046689 Ga0495613_0030879 Ga0495613_0030879_3044_3967 307
24 3300005439 Ga0070711_100331484 Ga0070711_1003314842 311
25 3300005458 Ga0070681_10096918 Ga0070681_100969183 311
26 3300013100 Ga0157373_10202511 Ga0157373_102025111 311
27 3300025916 Ga0207663_10345169 Ga0207663_103451691 311
28 3300005983 Ga0081540_1083213 Ga0081540_10832132 312
29 3300035086 Ga0373934_0000019 Ga0373934_0000019_21313_22290 313
30 3300035119 Ga0373956_0000002 Ga0373956_0000002_45689_46666 313
31 3300035120 Ga0373957_0013984 Ga0373957_0013984_958_1935 313
32 3300035724 Ga0373933_0000386 Ga0373933_0000386_14907_15884 313
33 3300036401 Ga0373937_0000085 Ga0373937_0000085_24463_25440 313
34 3300046462 Ga0495651_0000046 Ga0495651_0000046_42745_43722 313
35 3300047322 Ga0495680_0109430 Ga0495680_0109430_627_1604 313
36 3300050512 nmdc:mga0n895_49442_c1 nmdc:mga0n895_49442_c1_1568_2551 313
37 3300005615 Ga0070702_100066659 Ga0070702_1000666592 314
38 3300035117 Ga0373953_0000993 Ga0373953_0000993_3897_4877 314
39 3300035172 Ga0373955_0016489 Ga0373955_0016489_1257_2237 314
40 3300035410 Ga0373924_0072136 Ga0373924_0072136_26_1006 314
41 3300036401 Ga0373937_0017766 Ga0373937_0017766_2729_3709 314
42 3300049570 Ga0501033_0022899 Ga0501033_0022899_3344_4324 315
43 3300049572 Ga0501036_0415046 Ga0501036_0415046_52_1032 315
44 3300049574 Ga0501038_0089820 Ga0501038_0089820_959_1939 315
45 3300049579 Ga0501043_0020848 Ga0501043_0020848_969_1949 315
46 3300049580 Ga0501046_0024431 Ga0501046_0024431_2582_3562 315
47 3300049581 Ga0501047_0024393 Ga0501047_0024393_3726_4706 315
48 3300049584 Ga0501068_0185946 Ga0501068_0185946_36_1016 315
49 3300049586 Ga0501070_0005380 Ga0501070_0005380_1921_2901 315
50 3300049742 Ga0501080_0096293 Ga0501080_0096293_1345_2325 315
51 3300049822 Ga0501035_0039201 Ga0501035_0039201_693_1673 315
52 3300049823 Ga0501044_0053305 Ga0501044_0053305_251_1231 315
53 3300006914 Ga0075436_100007281 Ga0075436_1000072814 316
54 3300007076 Ga0075435_100098650 Ga0075435_1000986502 316
55 3300028800 Ga0265338_10004838 Ga0265338_1000483819 316
56 3300031712 Ga0265342_10015949 Ga0265342_100159493 316
57 3300050512 nmdc:mga0n895_127444_c1 nmdc:mga0n895_127444_c1_962_1912 316
58 3300050513 nmdc:mga0rr50_165852_c1 nmdc:mga0rr50_165852_c1_710_1660 316
59 3300050514 nmdc:mga08x19_5092_c1 nmdc:mga08x19_5092_c1_5596_6546 316
60 3300031247 Ga0265340_10009007 Ga0265340_100090077 317
61 3300031249 Ga0265339_10048274 Ga0265339_100482741 317
62 3300035086 Ga0373934_0054804 Ga0373934_0054804_143_1120 317
63 3300035117 Ga0373953_0083394 Ga0373953_0083394_87_1064 317
64 3300035120 Ga0373957_0035522 Ga0373957_0035522_288_1265 317
65 3300035172 Ga0373955_0005786 Ga0373955_0005786_3850_4827 317
66 3300035695 Ga0373927_0028566 Ga0373927_0028566_921_1898 317
67 3300037068 Ga0373925_0134102 Ga0373925_0134102_19_996 317
68 3300046454 Ga0495592_0248298 Ga0495592_0248298_59_1036 317
69 3300046463 Ga0495653_0012794 Ga0495653_0012794_1583_2560 317
70 3300046473 Ga0495582_0081989 Ga0495582_0081989_472_1449 317
71 3300046477 Ga0495664_0028337 Ga0495664_0028337_2008_2985 317
72 3300046514 Ga0495618_0051360 Ga0495618_0051360_976_1953 317
73 3300046516 Ga0495628_0019735 Ga0495628_0019735_37_1014 317
74 3300046517 Ga0495630_0035480 Ga0495630_0035480_986_1963 317
75 3300046526 Ga0495666_0074139 Ga0495666_0074139_59_1036 317
76 3300046529 Ga0495652_0215215 Ga0495652_0215215_403_1380 317
77 3300046533 Ga0495640_0128118 Ga0495640_0128118_222_1199 317
78 3300046559 Ga0495667_0055897 Ga0495667_0055897_446_1423 317
79 3300046663 Ga0495635_0166023 Ga0495635_0166023_165_1142 317
80 3300046678 Ga0495599_0010345 Ga0495599_0010345_54_1031 317
81 3300046681 Ga0495647_0004166 Ga0495647_0004166_3085_4062 317
82 3300046809 Ga0495600_0002659 Ga0495600_0002659_6260_7237 317
83 3300047319 Ga0495674_0029334 Ga0495674_0029334_922_1899 317
84 3300047322 Ga0495680_0098947 Ga0495680_0098947_26_1003 317
85 3300047444 Ga0495675_0009018 Ga0495675_0009018_1602_2579 317
86 3300007076 Ga0075435_100157284 Ga0075435_1001572842 318
87 3300037068 Ga0373925_0016592 Ga0373925_0016592_1081_2043 318
88 3300050513 nmdc:mga0rr50_192781_c1 nmdc:mga0rr50_192781_c1_662_1621 318
89 3300046517 Ga0495630_0054893 Ga0495630_0054893_2003_2962 319
90 3300006175 Ga0070712_100154361 Ga0070712_1001543612 320
91 3300025915 Ga0207693_10095771 Ga0207693_100957712 320
92 3300048907 Ga0496104_0000245 Ga0496104_0000245_16404_17381 320
93 3300048908 Ga0496105_0004197 Ga0496105_0004197_4922_5899 320
94 3300048917 Ga0496114_0144839 Ga0496114_0144839_322_1299 320
95 3300048918 Ga0496115_0159291 Ga0496115_0159291_702_1679 320
96 3300053084 Ga0495595_0038351 Ga0495595_0038351_37_1014 320
97 3300048917 Ga0496114_0005503 Ga0496114_0005503_1127_2113 321
98 3300005330 Ga0070690_100065406 Ga0070690_1000654063 323
99 3300005340 Ga0070689_100010035 Ga0070689_1000100355 323
100 3300005347 Ga0070668_100487884 Ga0070668_1004878841 323
101 3300005354 Ga0070675_100049148 Ga0070675_1000491482 323
102 3300005364 Ga0070673_100128906 Ga0070673_1001289061 323
103 3300005365 Ga0070688_100181015 Ga0070688_1001810151 323
104 3300005456 Ga0070678_100076483 Ga0070678_1000764831 323
105 3300005530 Ga0070679_100320226 Ga0070679_1003202261 323
106 3300005618 Ga0068864_100305238 Ga0068864_1003052382 323
107 3300009177 Ga0105248_10201703 Ga0105248_102017032 323
108 3300009553 Ga0105249_10394575 Ga0105249_103945752 323
109 3300017792 Ga0163161_10340193 Ga0163161_103401932 323
110 3300025931 Ga0207644_10055316 Ga0207644_100553163 323
111 3300025936 Ga0207670_10005450 Ga0207670_100054503 323
112 3300025937 Ga0207669_10097116 Ga0207669_100971162 323
113 3300025938 Ga0207704_10213597 Ga0207704_102135972 323
114 3300025940 Ga0207691_10178082 Ga0207691_101780822 323
115 3300025941 Ga0207711_10088525 Ga0207711_100885253 323
116 3300025960 Ga0207651_10086550 Ga0207651_100865503 323
117 3300026088 Ga0207641_10238819 Ga0207641_102388192 323
118 3300026095 Ga0207676_10347091 Ga0207676_103470912 323
119 3300026121 Ga0207683_10084614 Ga0207683_100846142 323
120 3300035121 Ga0373960_0025618 Ga0373960_0025618_261_1232 323
121 3300035691 Ga0373931_0020344 Ga0373931_0020344_1641_2612 323
122 3300035691 Ga0373931_0033184 Ga0373931_0033184_446_1417 323
123 3300037312 Ga0395899_0018529 Ga0395899_0018529_4141_5130 323
124 3300037312 Ga0395899_0075220 Ga0395899_0075220_509_1498 323
125 3300037418 Ga0395900_0003113 Ga0395900_0003113_16336_17325 323
126 3300037418 Ga0395900_0009465 Ga0395900_0009465_8091_9080 323
127 3300037466 Ga0395898_0022352 Ga0395898_0022352_5350_6339 323
128 3300037466 Ga0395898_0152561 Ga0395898_0152561_641_1645 323
129 3300037466 Ga0395898_0333882 Ga0395898_0333882_287_1276 323
130 3300038443 Ga0395901_0009726 Ga0395901_0009726_1129_2118 323
131 3300038443 Ga0395901_0038926 Ga0395901_0038926_1790_2794 323
132 3300048907 Ga0496104_0010133 Ga0496104_0010133_2054_3025 323
133 3300048914 Ga0496111_0145178 Ga0496111_0145178_715_1686 323
134 3300048915 Ga0496112_0184598 Ga0496112_0184598_622_1593 323
135 3300048916 Ga0496113_0051677 Ga0496113_0051677_1372_2343 323
136 3300048917 Ga0496114_0032832 Ga0496114_0032832_555_1526 323
137 3300048918 Ga0496115_0058777 Ga0496115_0058777_1513_2484 323
138 3300048918 Ga0496115_0060997 Ga0496115_0060997_1243_2214 323
139 3300053084 Ga0495595_0031439 Ga0495595_0031439_171_1142 323
140 3300053085 Ga0495619_0085345 Ga0495619_0085345_950_1921 323
141 3300053085 Ga0495619_0155533 Ga0495619_0155533_584_1555 323
142 3300005435 Ga0070714_100160350 Ga0070714_1001603503 324
143 3300005436 Ga0070713_100033453 Ga0070713_1000334532 324
144 3300005937 Ga0081455_10013177 Ga0081455_100131778 324
145 3300025906 Ga0207699_10038479 Ga0207699_100384794 324
146 3300025928 Ga0207700_10349903 Ga0207700_103499031 324
147 3300025929 Ga0207664_10174225 Ga0207664_101742251 324
148 3300042436 Ga0439435_0001572 Ga0439435_0001572_1105_2082 324
149 3300045836 Ga0466958_0014414 Ga0466958_0014414_2342_3316 324
150 3300050514 nmdc:mga08x19_48336_c1 nmdc:mga08x19_48336_c1_223_1197 324
151 3300061719 Ga0466962_0055454 Ga0466962_0055454_301_1275 324
152 3300005327 Ga0070658_10048551 Ga0070658_100485513 325
153 3300005530 Ga0070679_100032177 Ga0070679_1000321774 325
154 3300005530 Ga0070679_100230753 Ga0070679_1002307532 325
155 3300005539 Ga0068853_100034275 Ga0068853_1000342753 325
156 3300005563 Ga0068855_100019711 Ga0068855_1000197119 325
157 3300009093 Ga0105240_10113543 Ga0105240_101135434 325
158 3300009551 Ga0105238_10010090 Ga0105238_100100906 325
159 3300013104 Ga0157370_10011542 Ga0157370_100115422 325
160 3300013105 Ga0157369_10000857 Ga0157369_100008573 325
161 3300013307 Ga0157372_10002300 Ga0157372_100023004 325
162 3300025909 Ga0207705_10006540 Ga0207705_100065407 325
163 3300025909 Ga0207705_10029319 Ga0207705_100293193 325
164 3300025921 Ga0207652_10020288 Ga0207652_100202885 325
165 3300025921 Ga0207652_10192147 Ga0207652_101921472 325
166 3300025944 Ga0207661_10196110 Ga0207661_101961101 325
167 3300026041 Ga0207639_10096984 Ga0207639_100969841 325
168 3300031250 Ga0265331_10003706 Ga0265331_100037066 325
169 3300031711 Ga0265314_10004028 Ga0265314_100040286 325
170 3300035089 Ga0373944_0047560 Ga0373944_0047560_239_1225 325
171 3300035113 Ga0373936_0002055 Ga0373936_0002055_5896_6882 325
172 3300035117 Ga0373953_0009372 Ga0373953_0009372_1446_2432 325
173 3300035118 Ga0373954_0001352 Ga0373954_0001352_4592_5578 325
174 3300035120 Ga0373957_0023505 Ga0373957_0023505_1035_2021 325
175 3300035170 Ga0373943_0001697 Ga0373943_0001697_7340_8326 325
176 3300035172 Ga0373955_0000145 Ga0373955_0000145_7005_7991 325
177 3300035410 Ga0373924_0017354 Ga0373924_0017354_942_1928 325
178 3300035692 Ga0373935_0000017 Ga0373935_0000017_57584_58570 325
179 3300035695 Ga0373927_0033671 Ga0373927_0033671_477_1463 325
180 3300035725 Ga0373947_0002594 Ga0373947_0002594_4396_5382 325
181 3300036401 Ga0373937_0000103 Ga0373937_0000103_57513_58499 325
182 3300036401 Ga0373937_0181430 Ga0373937_0181430_254_1231 325
183 3300037068 Ga0373925_0000058 Ga0373925_0000058_100338_101324 325
184 3300037471 Ga0395905_0047328 Ga0395905_0047328_1795_2772 325
185 3300038443 Ga0395901_0023119 Ga0395901_0023119_3505_4482 325
186 3300046454 Ga0495592_0000062 Ga0495592_0000062_19544_20530 325
187 3300046459 Ga0495629_0046217 Ga0495629_0046217_789_1775 325
188 3300046462 Ga0495651_0000952 Ga0495651_0000952_105_1091 325
189 3300046463 Ga0495653_0000072 Ga0495653_0000072_26904_27890 325
190 3300046476 Ga0495662_0055026 Ga0495662_0055026_182_1168 325
191 3300046477 Ga0495664_0000009 Ga0495664_0000009_188484_189470 325
192 3300046511 Ga0495608_0000061 Ga0495608_0000061_15172_16158 325
193 3300046514 Ga0495618_0000061 Ga0495618_0000061_57497_58483 325
194 3300046516 Ga0495628_0000012 Ga0495628_0000012_100177_101163 325
195 3300046517 Ga0495630_0000644 Ga0495630_0000644_20930_21916 325
196 3300046529 Ga0495652_0000021 Ga0495652_0000021_122966_123952 325
197 3300046533 Ga0495640_0000028 Ga0495640_0000028_51292_52278 325
198 3300046536 Ga0495587_0000033 Ga0495587_0000033_22822_23808 325
199 3300046543 Ga0495645_0000017 Ga0495645_0000017_112302_113288 325
200 3300046559 Ga0495667_0000011 Ga0495667_0000011_32865_33851 325
201 3300046642 Ga0495634_0000220 Ga0495634_0000220_32691_33677 325
202 3300046663 Ga0495635_0000019 Ga0495635_0000019_152426_153412 325
203 3300046675 Ga0495657_0000378 Ga0495657_0000378_7909_8895 325
204 3300046678 Ga0495599_0000024 Ga0495599_0000024_100002_100988 325
205 3300046679 Ga0495623_0000022 Ga0495623_0000022_40453_41439 325
206 3300046680 Ga0495646_0000033 Ga0495646_0000033_25350_26336 325
207 3300046683 Ga0495658_0020087 Ga0495658_0020087_1199_2185 325
208 3300046689 Ga0495613_0012981 Ga0495613_0012981_4218_5204 325
209 3300046809 Ga0495600_0000028 Ga0495600_0000028_32160_33146 325
210 3300047317 Ga0495604_0000011 Ga0495604_0000011_233576_234562 325
211 3300047319 Ga0495674_0000015 Ga0495674_0000015_100182_101168 325
212 3300047322 Ga0495680_0000895 Ga0495680_0000895_26921_27907 325
213 3300047444 Ga0495675_0000295 Ga0495675_0000295_1896_2882 325
214 3300047471 Ga0495684_0000036 Ga0495684_0000036_48583_49569 325
215 3300047673 Ga0495593_0001674 Ga0495593_0001674_2449_3435 325
216 3300048088 Ga0495602_0000018 Ga0495602_0000018_57459_58445 325
217 3300050509 nmdc:mga0qj67_143421_c1 nmdc:mga0qj67_143421_c1_874_1851 325
218 3300053077 Ga0495601_0000024 Ga0495601_0000024_112326_113312 325
219 3300053078 Ga0495612_0000079 Ga0495612_0000079_19231_20217 325
220 3300053084 Ga0495595_0000036 Ga0495595_0000036_20555_21541 325
221 3300053085 Ga0495619_0000034 Ga0495619_0000034_100142_101128 325
222 3300002459 JGI24751J29686_10011605 JGI24751J29686_100116052 326
223 3300003215 JGI25153J46596_10000737 JGI25153J46596_100007379 326
224 3300005327 Ga0070658_10093740 Ga0070658_100937403 326
225 3300005329 Ga0070683_100216108 Ga0070683_1002161082 326
226 3300005330 Ga0070690_100055677 Ga0070690_1000556773 326
227 3300005331 Ga0070670_100012722 Ga0070670_1000127225 326
228 3300005334 Ga0068869_100079602 Ga0068869_1000796023 326
229 3300005343 Ga0070687_100078362 Ga0070687_1000783621 326
230 3300005344 Ga0070661_100105667 Ga0070661_1001056672 326
231 3300005347 Ga0070668_100141590 Ga0070668_1001415902 326
232 3300005356 Ga0070674_100215318 Ga0070674_1002153182 326
233 3300005364 Ga0070673_100201111 Ga0070673_1002011111 326
234 3300005365 Ga0070688_100088534 Ga0070688_1000885342 326
235 3300005367 Ga0070667_100026413 Ga0070667_1000264131 326
236 3300005435 Ga0070714_100089370 Ga0070714_1000893704 326
237 3300005438 Ga0070701_10006456 Ga0070701_100064565 326
238 3300005440 Ga0070705_100085520 Ga0070705_1000855202 326
239 3300005441 Ga0070700_100019982 Ga0070700_1000199825 326
240 3300005444 Ga0070694_100070876 Ga0070694_1000708762 326
241 3300005455 Ga0070663_100075945 Ga0070663_1000759452 326
242 3300005459 Ga0068867_100146030 Ga0068867_1001460303 326
243 3300005530 Ga0070679_100060960 Ga0070679_1000609602 326
244 3300005535 Ga0070684_100167367 Ga0070684_1001673672 326
245 3300005544 Ga0070686_100046860 Ga0070686_1000468602 326
246 3300005549 Ga0070704_100031036 Ga0070704_1000310364 326
247 3300005549 Ga0070704_100086152 Ga0070704_1000861523 326
248 3300005563 Ga0068855_100338156 Ga0068855_1003381562 326
249 3300005564 Ga0070664_100195579 Ga0070664_1001955792 326
250 3300005614 Ga0068856_100081718 Ga0068856_1000817182 326
251 3300005615 Ga0070702_100005939 Ga0070702_1000059392 326
252 3300005618 Ga0068864_100011942 Ga0068864_1000119428 326
253 3300005618 Ga0068864_100275442 Ga0068864_1002754422 326
254 3300005618 Ga0068864_100474287 Ga0068864_1004742871 326
255 3300005719 Ga0068861_100072444 Ga0068861_1000724443 326
256 3300005840 Ga0068870_10046279 Ga0068870_100462793 326
257 3300005841 Ga0068863_100008931 Ga0068863_1000089313 326
258 3300005842 Ga0068858_100006106 Ga0068858_1000061068 326
259 3300005844 Ga0068862_100081097 Ga0068862_1000810972 326
260 3300005985 Ga0081539_10021153 Ga0081539_100211535 326
261 3300006028 Ga0070717_10076237 Ga0070717_100762374 326
262 3300006038 Ga0075365_10026679 Ga0075365_100266793 326
263 3300006175 Ga0070712_100213930 Ga0070712_1002139302 326
264 3300006195 Ga0075366_10033724 Ga0075366_100337243 326
265 3300006358 Ga0068871_100021703 Ga0068871_1000217032 326
266 3300006844 Ga0075428_100101572 Ga0075428_1001015723 326
267 3300006846 Ga0075430_100000276 Ga0075430_10000027627 326
268 3300006871 Ga0075434_100070324 Ga0075434_1000703244 326
269 3300006881 Ga0068865_100042256 Ga0068865_1000422564 326
270 3300007265 Ga0099794_10090625 Ga0099794_100906252 326
271 3300007788 Ga0099795_10010801 Ga0099795_100108012 326
272 3300009093 Ga0105240_10104581 Ga0105240_101045812 326
273 3300009094 Ga0111539_10051024 Ga0111539_100510244 326
274 3300009094 Ga0111539_10411600 Ga0111539_104116002 326
275 3300009101 Ga0105247_10022463 Ga0105247_100224634 326
276 3300009147 Ga0114129_10011961 Ga0114129_1001196110 326
277 3300009148 Ga0105243_10080130 Ga0105243_100801303 326
278 3300009177 Ga0105248_10136151 Ga0105248_101361512 326
279 3300009553 Ga0105249_10023729 Ga0105249_100237292 326
280 3300010375 Ga0105239_10338115 Ga0105239_103381152 326
281 3300011119 Ga0105246_10095285 Ga0105246_100952853 326
282 3300013105 Ga0157369_10150261 Ga0157369_101502611 326
283 3300013308 Ga0157375_10131921 Ga0157375_101319212 326
284 3300014325 Ga0163163_10031013 Ga0163163_100310134 326
285 3300014326 Ga0157380_10278790 Ga0157380_102787902 326
286 3300014745 Ga0157377_10083697 Ga0157377_100836973 326
287 3300014969 Ga0157376_10116935 Ga0157376_101169352 326
288 3300025297 Ga0209758_1000798 Ga0209758_100079836 326
289 3300025297 Ga0209758_1049370 Ga0209758_10493702 326
290 3300025900 Ga0207710_10008469 Ga0207710_100084692 326
291 3300025901 Ga0207688_10011456 Ga0207688_100114564 326
292 3300025908 Ga0207643_10000769 Ga0207643_1000076911 326
293 3300025909 Ga0207705_10023497 Ga0207705_100234974 326
294 3300025915 Ga0207693_10006096 Ga0207693_100060965 326
295 3300025918 Ga0207662_10016786 Ga0207662_100167862 326
296 3300025919 Ga0207657_10054159 Ga0207657_100541593 326
297 3300025921 Ga0207652_10105827 Ga0207652_101058271 326
298 3300025925 Ga0207650_10017407 Ga0207650_100174073 326
299 3300025926 Ga0207659_10066818 Ga0207659_100668182 326
300 3300025931 Ga0207644_10008179 Ga0207644_100081797 326
301 3300025935 Ga0207709_10081501 Ga0207709_100815013 326
302 3300025936 Ga0207670_10388481 Ga0207670_103884811 326
303 3300025937 Ga0207669_10044810 Ga0207669_100448102 326
304 3300025938 Ga0207704_10038142 Ga0207704_100381422 326
305 3300025940 Ga0207691_10058893 Ga0207691_100588931 326
306 3300025942 Ga0207689_10005268 Ga0207689_100052681 326
307 3300025944 Ga0207661_10360883 Ga0207661_103608832 326
308 3300025949 Ga0207667_10081194 Ga0207667_100811942 326
309 3300025960 Ga0207651_10084643 Ga0207651_100846433 326
310 3300025972 Ga0207668_10297589 Ga0207668_102975892 326
311 3300025986 Ga0207658_10018161 Ga0207658_100181611 326
312 3300026035 Ga0207703_10018493 Ga0207703_100184932 326
313 3300026041 Ga0207639_10103524 Ga0207639_101035242 326
314 3300026067 Ga0207678_10023862 Ga0207678_100238622 326
315 3300026075 Ga0207708_10016268 Ga0207708_100162686 326
316 3300026078 Ga0207702_10128174 Ga0207702_101281742 326
317 3300026089 Ga0207648_10077732 Ga0207648_100777323 326
318 3300026095 Ga0207676_10341028 Ga0207676_103410282 326
319 3300026118 Ga0207675_100002971 Ga0207675_1000029714 326
320 3300028017 Ga0265356_1000482 Ga0265356_10004824 326
321 3300030760 Ga0265762_1005543 Ga0265762_10055432 326
322 3300035086 Ga0373934_0002315 Ga0373934_0002315_5165_6151 326
323 3300035116 Ga0373945_0051313 Ga0373945_0051313_84_1064 326
324 3300035118 Ga0373954_0000201 Ga0373954_0000201_14783_15769 326
325 3300035119 Ga0373956_0045877 Ga0373956_0045877_738_1718 326
326 3300035170 Ga0373943_0007738 Ga0373943_0007738_136_1116 326
327 3300035171 Ga0373946_0014882 Ga0373946_0014882_1840_2820 326
328 3300035171 Ga0373946_0020063 Ga0373946_0020063_1135_2115 326
329 3300035172 Ga0373955_0001863 Ga0373955_0001863_6447_7433 326
330 3300035692 Ga0373935_0043911 Ga0373935_0043911_592_1572 326
331 3300035692 Ga0373935_0054499 Ga0373935_0054499_524_1504 326
332 3300035695 Ga0373927_0257480 Ga0373927_0257480_46_1026 326
333 3300035724 Ga0373933_0001257 Ga0373933_0001257_13365_14351 326
334 3300035724 Ga0373933_0072820 Ga0373933_0072820_579_1559 326
335 3300035725 Ga0373947_0037249 Ga0373947_0037249_1194_2174 326
336 3300035725 Ga0373947_0039380 Ga0373947_0039380_955_1935 326
337 3300035725 Ga0373947_0047012 Ga0373947_0047012_179_1159 326
338 3300036401 Ga0373937_0000123 Ga0373937_0000123_49016_50002 326
339 3300036401 Ga0373937_0018537 Ga0373937_0018537_4732_5712 326
340 3300036401 Ga0373937_0312548 Ga0373937_0312548_310_1290 326
341 3300037068 Ga0373925_0049283 Ga0373925_0049283_1176_2156 326
342 3300037068 Ga0373925_0095583 Ga0373925_0095583_426_1406 326
343 3300042006 Ga0439432_070988 Ga0439432_070988_51_1031 326
344 3300046455 Ga0495603_0052632 Ga0495603_0052632_74_1054 326
345 3300046459 Ga0495629_0042860 Ga0495629_0042860_1559_2539 326
346 3300046462 Ga0495651_0012045 Ga0495651_0012045_787_1773 326
347 3300046473 Ga0495582_0044578 Ga0495582_0044578_557_1537 326
348 3300046473 Ga0495582_0064008 Ga0495582_0064008_829_1809 326
349 3300046491 Ga0495584_0008237 Ga0495584_0008237_739_1719 326
350 3300046491 Ga0495584_0116092 Ga0495584_0116092_68_1048 326
351 3300046492 Ga0495585_0041488 Ga0495585_0041488_486_1466 326
352 3300046492 Ga0495585_0115094 Ga0495585_0115094_179_1159 326
353 3300046511 Ga0495608_0139145 Ga0495608_0139145_97_1083 326
354 3300046520 Ga0495637_0043387 Ga0495637_0043387_156_1136 326
355 3300046523 Ga0495644_0049293 Ga0495644_0049293_123_1103 326
356 3300046536 Ga0495587_0003929 Ga0495587_0003929_4448_5434 326
357 3300046679 Ga0495623_0051694 Ga0495623_0051694_1354_2340 326
358 3300046690 Ga0495624_0039712 Ga0495624_0039712_513_1493 326
359 3300046690 Ga0495624_0157593 Ga0495624_0157593_311_1291 326
360 3300047317 Ga0495604_0003069 Ga0495604_0003069_8416_9402 326
361 3300047444 Ga0495675_0026377 Ga0495675_0026377_818_1804 326
362 3300048088 Ga0495602_0000362 Ga0495602_0000362_40123_41109 326
363 3300048903 Ga0496100_0002533 Ga0496100_0002533_1249_2229 326
364 3300048904 Ga0496101_0022442 Ga0496101_0022442_2950_3930 326
365 3300048905 Ga0496102_0122205 Ga0496102_0122205_1111_2091 326
366 3300048906 Ga0496103_0014648 Ga0496103_0014648_2546_3526 326
367 3300048907 Ga0496104_0008767 Ga0496104_0008767_18_998 326
368 3300048907 Ga0496104_0112100 Ga0496104_0112100_1294_2274 326
369 3300048908 Ga0496105_0005925 Ga0496105_0005925_7331_8311 326
370 3300048911 Ga0496108_0001908 Ga0496108_0001908_9471_10451 326
371 3300048912 Ga0496109_0006772 Ga0496109_0006772_5990_6970 326
372 3300048913 Ga0496110_0017717 Ga0496110_0017717_3705_4685 326
373 3300048914 Ga0496111_0001877 Ga0496111_0001877_11059_12039 326
374 3300048914 Ga0496111_0080244 Ga0496111_0080244_524_1504 326
375 3300048915 Ga0496112_0007911 Ga0496112_0007911_8104_9084 326
376 3300048915 Ga0496112_0108703 Ga0496112_0108703_1294_2274 326
377 3300048915 Ga0496112_0233100 Ga0496112_0233100_283_1263 326
378 3300048916 Ga0496113_0000265 Ga0496113_0000265_19438_20418 326
379 3300048916 Ga0496113_0014723 Ga0496113_0014723_2759_3739 326
380 3300048917 Ga0496114_0115898 Ga0496114_0115898_741_1721 326
381 3300048918 Ga0496115_0059523 Ga0496115_0059523_1016_1996 326
382 3300049571 Ga0501034_0149620 Ga0501034_0149620_176_1180 326
383 3300049574 Ga0501038_0186706 Ga0501038_0186706_560_1540 326
384 3300049575 Ga0501039_0008714 Ga0501039_0008714_5999_6979 326
385 3300049576 Ga0501040_0090790 Ga0501040_0090790_350_1330 326
386 3300049577 Ga0501041_0108278 Ga0501041_0108278_205_1185 326
387 3300049579 Ga0501043_0038145 Ga0501043_0038145_1302_2282 326
388 3300049580 Ga0501046_0044225 Ga0501046_0044225_1070_2050 326
389 3300049585 Ga0501069_0198800 Ga0501069_0198800_160_1140 326
390 3300049587 Ga0501071_0004137 Ga0501071_0004137_2923_3903 326
391 3300049590 Ga0501074_0351287 Ga0501074_0351287_29_1036 326
392 3300049591 Ga0501075_0010380 Ga0501075_0010380_3547_4527 326
393 3300049592 Ga0501076_0025931 Ga0501076_0025931_325_1305 326
394 3300049593 Ga0501077_0017571 Ga0501077_0017571_2541_3521 326
395 3300049741 Ga0501079_0006645 Ga0501079_0006645_2319_3299 326
396 3300049742 Ga0501080_0054801 Ga0501080_0054801_1580_2560 326
397 3300049743 Ga0501081_0000033 Ga0501081_0000033_3223_4203 326
398 3300049744 Ga0501083_0099920 Ga0501083_0099920_852_1859 326
399 3300049823 Ga0501044_0339509 Ga0501044_0339509_223_1230 326
400 3300050492 nmdc:mga0yw44_118296_c1 nmdc:mga0yw44_118296_c1_111_1091 326
401 3300050493 nmdc:mga0k408_51560_c1 nmdc:mga0k408_51560_c1_1142_2122 326
402 3300050507 nmdc:mga05p37_5101_c1 nmdc:mga05p37_5101_c1_5201_6181 326
403 3300050509 nmdc:mga0qj67_18_c1 nmdc:mga0qj67_18_c1_72660_73640 326
404 3300050511 nmdc:mga08y16_137081_c1 nmdc:mga08y16_137081_c1_909_1889 326
405 3300050512 nmdc:mga0n895_124402_c1 nmdc:mga0n895_124402_c1_1440_2420 326
406 3300053085 Ga0495619_0017057 Ga0495619_0017057_3217_4203 326
407 3300053085 Ga0495619_0093306 Ga0495619_0093306_290_1270 326
408 3300053153 Ga0500616_0010004 Ga0500616_0010004_353_1333 326
409 3300060353 Ga0501082_0003399 Ga0501082_0003399_10589_11569 326
410 3300061734 Ga0530510_0071140 Ga0530510_0071140_1384_2364 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

155

270

0.93

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

18

333

0.92

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

114

300

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7va1-assembly1.cif.gz_B crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 0.9093 98 296
7va1-assembly1.cif.gz_B crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 0.887 98 296
7cvp-assembly1.cif.gz_B the crystal structure of human phgdh from biortus. 0.8853 95 309
6rj6-assembly1.cif.gz_A crystal structure of phgdh in complex with bi-4924 0.8627 96 309
6rj6-assembly1.cif.gz_A crystal structure of phgdh in complex with bi-4924 0.8512 96 309
ID Description Score Start End Superfamily
af_Q7SZY8_153_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9385 146 291 3.40.50.720
af_Q2FVW4_141_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9362 142 291 3.40.50.720
af_Q2FZW9_121_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9337 146 291 3.40.50.720
af_Q9VII9_150_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9322 143 291 3.40.50.720
af_Q7SZY8_153_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9258 146 291 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8Y224-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9632 98 281 GO:0051287
AF-A0A6L7NCT7-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9371 141 296 GO:0016614
GO:0051287
AF-A0A2V8Y224-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9147 98 281 GO:0051287
AF-A0A7C7TLI3-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.8788 112 322 GO:0016491
GO:0051287
AF-A0A847IL05-F1-model_v4 deleted 0.8721 96 321

Feature Viewer

pLDDT pTM Quality
89.33 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map