F437200

General Info

Members Datasets Scaffolds Average Seq Length
410 251 820 129

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100221576|Ga0068862_1002215762
Length 153
Sequence MFCRLLVTDPAWVYDRGSADETEEVIAMGQAEVRSYAANARSTDTFGRVLCNIRNHHFVIDGPVQNGCPGEEITPAEVFLVAIASCGVELLQGIARDQKAPLTGVKVEISGALDRANPVRKDLSVFNWVRLDFQLSGVTESQAADLVERFRGR

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
184 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
185 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.95
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 36.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100221576 3300005844 Bacteria 1713
2 Ga0065712_10131397 3300005290 Bacteria 1545
3 Ga0065712_10300283 3300005290 Bacteria 861
4 Ga0065707_10449594 3300005295 Bacteria 802
5 Ga0070676_10327400 3300005328 Bacteria 1047
6 Ga0070683_100010387 3300005329 Bacteria 8007
7 Ga0070683_100033077 3300005329 Bacteria 4713
8 Ga0070670_100164956 3300005331 Unclassified 1920
9 Ga0068869_100306685 3300005334 Unclassified 1283
10 Ga0068869_100792175 3300005334 Bacteria 814
11 Ga0070680_100020840 3300005336 Bacteria 5203
12 Ga0070680_100722871 3300005336 Bacteria 857
13 Ga0070682_100007337 3300005337 Bacteria 6219
14 Ga0068868_100115209 3300005338 Bacteria 2188
15 Ga0070660_100128422 3300005339 Bacteria 2027
16 Ga0070689_101025270 3300005340 Unclassified 735
17 Ga0070687_100056420 3300005343 Bacteria 2055
18 Ga0070692_10088597 3300005345 Unclassified 1679
19 Ga0070668_100051554 3300005347 Bacteria 3171
20 Ga0070669_100001516 3300005353 Bacteria 16791
21 Ga0070675_100132209 3300005354 Bacteria 2127
22 Ga0070675_100741944 3300005354 Unclassified 896
23 Ga0070671_100286372 3300005355 Bacteria 1402
24 Ga0070671_100375525 3300005355 Unclassified 1215
25 Ga0070671_100716371 3300005355 Unclassified 869
26 Ga0070673_100366503 3300005364 Unclassified 1282
27 Ga0070667_100467415 3300005367 Unclassified 1154
28 Ga0070709_10030741 3300005434 Bacteria 3225
29 Ga0070714_100141701 3300005435 Bacteria 2159
30 Ga0070713_101414403 3300005436 Unclassified 674
31 Ga0070705_100370460 3300005440 Unclassified 1051
32 Ga0070705_100574229 3300005440 Unclassified 868
33 Ga0070700_100247953 3300005441 Bacteria 1276
34 Ga0070694_100301359 3300005444 Bacteria 1228
35 Ga0070694_100632176 3300005444 Bacteria 865
36 Ga0070694_101459584 3300005444 Unclassified 578
37 Ga0070708_100000072 3300005445 Bacteria 65220
38 Ga0070708_100047171 3300005445 Unclassified 3804
39 Ga0070708_100117309 3300005445 Unclassified 2451
40 Ga0070708_100209562 3300005445 Unclassified 1826
41 Ga0070662_100331748 3300005457 Unclassified 1243
42 Ga0070681_10066956 3300005458 Bacteria 3560
43 Ga0070681_10203735 3300005458 Unclassified 1896
44 Ga0068867_100189612 3300005459 Bacteria 1640
45 Ga0068867_100330612 3300005459 Unclassified 1266
46 Ga0070706_100004811 3300005467 Bacteria 12932
47 Ga0070706_100005593 3300005467 Bacteria 11956
48 Ga0070706_100052046 3300005467 Bacteria 3780
49 Ga0070706_100489558 3300005467 Bacteria 1144
50 Ga0070706_100642247 3300005467 Unclassified 985
51 Ga0070707_100035624 3300005468 Bacteria 4748
52 Ga0070707_100116115 3300005468 Bacteria 2598
53 Ga0070707_100339648 3300005468 Bacteria 1459
54 Ga0070707_100519832 3300005468 Unclassified 1152
55 Ga0070707_101188808 3300005468 Bacteria 729
56 Ga0070707_102320701 3300005468 Unclassified 504
57 Ga0070698_100000183 3300005471 Bacteria 59252
58 Ga0070698_100137322 3300005471 Bacteria 2398
59 Ga0070698_100191682 3300005471 Bacteria 1981
60 Ga0070698_100285266 3300005471 Bacteria 1582
61 Ga0070698_100317572 3300005471 Bacteria 1488
62 Ga0070698_100343163 3300005471 Unclassified 1425
63 Ga0070698_100428812 3300005471 Bacteria 1257
64 Ga0070698_102156785 3300005471 Unclassified 511
65 Ga0070699_100009820 3300005518 Bacteria 8282
66 Ga0070699_100120920 3300005518 Bacteria 2303
67 Ga0070699_100743752 3300005518 Bacteria 897
68 Ga0070699_100842624 3300005518 Unclassified 839
69 Ga0070679_100007764 3300005530 Bacteria 10045
70 Ga0070679_100024648 3300005530 Bacteria 5896
71 Ga0070679_100048931 3300005530 Bacteria 4211
72 Ga0070679_100418285 3300005530 Bacteria 1286
73 Ga0070684_100002077 3300005535 Bacteria 14754
74 Ga0070684_100008326 3300005535 Bacteria 8099
75 Ga0070684_100117830 3300005535 Bacteria 2386
76 Ga0070684_100203516 3300005535 Bacteria 1803
77 Ga0070697_100002267 3300005536 Bacteria 14763
78 Ga0070697_100114591 3300005536 Bacteria 2250
79 Ga0070697_100138150 3300005536 Unclassified 2048
80 Ga0070697_101043933 3300005536 Unclassified 727
81 Ga0068853_100737584 3300005539 Bacteria 941
82 Ga0068853_102365053 3300005539 Unclassified 515
83 Ga0070672_100261050 3300005543 Bacteria 1461
84 Ga0070672_100268785 3300005543 Unclassified 1439
85 Ga0070696_101824379 3300005546 Unclassified 526
86 Ga0070693_100096854 3300005547 Unclassified 1789
87 Ga0070693_100289320 3300005547 Unclassified 1100
88 Ga0070704_100411514 3300005549 Bacteria 1156
89 Ga0068855_100036031 3300005563 Bacteria 5890
90 Ga0068855_100755716 3300005563 Unclassified 1036
91 Ga0070664_100058054 3300005564 Bacteria 3291
92 Ga0070664_100301546 3300005564 Bacteria 1448
93 Ga0070664_100373597 3300005564 Bacteria 1300
94 Ga0068857_100025943 3300005577 Bacteria 5162
95 Ga0068857_100227601 3300005577 Unclassified 1704
96 Ga0068856_100351986 3300005614 Unclassified 1491
97 Ga0068856_100401137 3300005614 Unclassified 1391
98 Ga0070702_100013766 3300005615 Bacteria 4091
99 Ga0070702_101502172 3300005615 Unclassified 554
100 Ga0068852_100332374 3300005616 Unclassified 1479
101 Ga0068859_100009164 3300005617 Bacteria 9995
102 Ga0068859_100071025 3300005617 Bacteria 3517
103 Ga0068864_100003806 3300005618 Bacteria 12441
104 Ga0068864_101170630 3300005618 Bacteria 767
105 Ga0068866_10325945 3300005718 Unclassified 968
106 Ga0068866_11291443 3300005718 Unclassified 530
107 Ga0068861_101875731 3300005719 Bacteria 596
108 Ga0068870_10010961 3300005840 Bacteria 4186
109 Ga0068870_10011620 3300005840 Unclassified 4091
110 Ga0068870_10020143 3300005840 Bacteria 3244
111 Ga0068870_10385853 3300005840 Unclassified 908
112 Ga0068863_100104183 3300005841 Bacteria 2699
113 Ga0068858_100120449 3300005842 Bacteria 2454
114 Ga0068860_100047669 3300005843 Bacteria 4083
115 Ga0068860_101332858 3300005843 Unclassified 739
116 Ga0068862_100000743 3300005844 Bacteria 32635
117 Ga0081539_10000290 3300005985 Bacteria 113852
118 Ga0070716_101419293 3300006173 Unclassified 565
119 Ga0070712_100222514 3300006175 Unclassified 1495
120 Ga0070712_100407101 3300006175 Bacteria 1125
121 Ga0097621_100084966 3300006237 Unclassified 2639
122 Ga0068871_100195138 3300006358 Unclassified 1745
123 Ga0075428_100706662 3300006844 Bacteria 1074
124 Ga0075428_101297300 3300006844 Unclassified 766
125 Ga0075430_100109646 3300006846 Bacteria 2302
126 Ga0075431_100001499 3300006847 Bacteria 21616
127 Ga0075431_100162477 3300006847 Unclassified 2296
128 Ga0075433_10188277 3300006852 Bacteria 1836
129 Ga0075429_100033450 3300006880 Bacteria 4467
130 Ga0075429_100510767 3300006880 Bacteria 1053
131 Ga0068865_101407371 3300006881 Unclassified 623
132 Ga0075436_100231226 3300006914 Bacteria 1314
133 Ga0075436_100989940 3300006914 Unclassified 631
134 Ga0097620_100009164 3300006931 Bacteria 9995
135 Ga0097620_100071025 3300006931 Bacteria 3517
136 Ga0075435_100690153 3300007076 Unclassified 887
137 Ga0075435_101114262 3300007076 Unclassified 690
138 Ga0105240_10522546 3300009093 Unclassified 1317
139 Ga0111539_10087283 3300009094 Unclassified 3665
140 Ga0111539_10719262 3300009094 Bacteria 1162
141 Ga0111539_12780145 3300009094 Unclassified 567
142 Ga0105245_10076058 3300009098 Bacteria 3058
143 Ga0105245_10809745 3300009098 Unclassified 975
144 Ga0105247_10422177 3300009101 Bacteria 955
145 Ga0105247_11378260 3300009101 Unclassified 570
146 Ga0114129_10025559 3300009147 Bacteria 8366
147 Ga0114129_10496863 3300009147 Bacteria 1594
148 Ga0105243_10606563 3300009148 Bacteria 1055
149 Ga0105243_10946554 3300009148 Unclassified 860
150 Ga0105241_10122051 3300009174 Bacteria 2099
151 Ga0105242_10046407 3300009176 Bacteria 3524
152 Ga0105242_10188496 3300009176 Unclassified 1824
153 Ga0105242_10390768 3300009176 Unclassified 1295
154 Ga0105248_10026635 3300009177 Bacteria 6429
155 Ga0105248_10061399 3300009177 Unclassified 4220
156 Ga0105248_10240727 3300009177 Bacteria 2037
157 Ga0105248_13399795 3300009177 Bacteria 506
158 Ga0105237_10062807 3300009545 Unclassified 3713
159 Ga0105237_11554115 3300009545 Unclassified 668
160 Ga0105238_10145791 3300009551 Unclassified 2344
161 Ga0105238_11963474 3300009551 Unclassified 618
162 Ga0105249_10000075 3300009553 Bacteria 145150
163 Ga0105249_10053529 3300009553 Bacteria 3689
164 Ga0105249_10879008 3300009553 Bacteria 963
165 Ga0105239_10196770 3300010375 Unclassified 2257
166 Ga0105239_11599855 3300010375 Unclassified 754
167 Ga0105246_12332672 3300011119 Bacteria 523
168 Ga0157373_10118134 3300013100 Unclassified 1864
169 Ga0157373_10333712 3300013100 Unclassified 1080
170 Ga0157371_10018166 3300013102 Bacteria 5207
171 Ga0157370_10144896 3300013104 Bacteria 2212
172 Ga0157370_10775235 3300013104 Unclassified 873
173 Ga0157369_10365510 3300013105 Unclassified 1498
174 Ga0157369_11259173 3300013105 Unclassified 754
175 Ga0157374_10084796 3300013296 Unclassified 3012
176 Ga0157378_10030961 3300013297 Bacteria 4724
177 Ga0163162_10007839 3300013306 Bacteria 10407
178 Ga0163162_10987714 3300013306 Bacteria 951
179 Ga0157372_10149286 3300013307 Bacteria 2697
180 Ga0157372_10199852 3300013307 Bacteria 2315
181 Ga0157372_10284716 3300013307 Bacteria 1922
182 Ga0157372_10610409 3300013307 Unclassified 1271
183 Ga0157372_11952025 3300013307 Unclassified 675
184 Ga0157375_11004454 3300013308 Unclassified 974
185 Ga0157375_12050870 3300013308 Unclassified 680
186 Ga0163163_10023809 3300014325 Bacteria 5818
187 Ga0163163_10059074 3300014325 Bacteria 3792
188 Ga0157380_10042606 3300014326 Bacteria 3549
189 Ga0157380_11367685 3300014326 Unclassified 757
190 Ga0157377_10005545 3300014745 Bacteria 5940
191 Ga0157379_10347041 3300014968 Bacteria 1358
192 Ga0157376_10748900 3300014969 Bacteria 986
193 Ga0157376_11127303 3300014969 Unclassified 811
194 Ga0163161_11746714 3300017792 Bacteria 552
195 Ga0207692_10266502 3300025898 Unclassified 1032
196 Ga0207642_10324214 3300025899 Unclassified 900
197 Ga0207688_10203261 3300025901 Unclassified 1188
198 Ga0207680_10161704 3300025903 Unclassified 1502
199 Ga0207699_10035859 3300025906 Bacteria 2824
200 Ga0207643_10004102 3300025908 Bacteria 7841
201 Ga0207643_10024685 3300025908 Bacteria 3317
202 Ga0207643_10248422 3300025908 Unclassified 1095
203 Ga0207684_10004655 3300025910 Bacteria 12883
204 Ga0207684_10018705 3300025910 Bacteria 5928
205 Ga0207684_10039523 3300025910 Bacteria 4001
206 Ga0207684_10303568 3300025910 Bacteria 1376
207 Ga0207684_10551407 3300025910 Bacteria 986
208 Ga0207654_10099099 3300025911 Bacteria 1792
209 Ga0207707_10021669 3300025912 Bacteria 5616
210 Ga0207671_11224289 3300025914 Unclassified 587
211 Ga0207693_10300858 3300025915 Unclassified 1257
212 Ga0207693_10753238 3300025915 Bacteria 752
213 Ga0207660_10135695 3300025917 Bacteria 1877
214 Ga0207662_10219606 3300025918 Unclassified 1237
215 Ga0207657_10036903 3300025919 Bacteria 4371
216 Ga0207652_10092453 3300025921 Bacteria 2661
217 Ga0207646_10129322 3300025922 Bacteria 2272
218 Ga0207646_10167493 3300025922 Bacteria 1984
219 Ga0207646_10466866 3300025922 Unclassified 1138
220 Ga0207646_10869581 3300025922 Bacteria 801
221 Ga0207681_10000472 3300025923 Bacteria 28169
222 Ga0207694_10851248 3300025924 Unclassified 771
223 Ga0207650_10084621 3300025925 Unclassified 2411
224 Ga0207650_11355262 3300025925 Bacteria 605
225 Ga0207659_10243724 3300025926 Unclassified 1455
226 Ga0207659_10626240 3300025926 Unclassified 918
227 Ga0207687_10278083 3300025927 Unclassified 1341
228 Ga0207664_10144080 3300025929 Bacteria 2019
229 Ga0207644_10367251 3300025931 Unclassified 1172
230 Ga0207644_11156746 3300025931 Unclassified 650
231 Ga0207690_10068347 3300025932 Bacteria 2440
232 Ga0207706_10006508 3300025933 Bacteria 10836
233 Ga0207706_10026038 3300025933 Bacteria 5237
234 Ga0207706_10349882 3300025933 Bacteria 1285
235 Ga0207686_10031850 3300025934 Unclassified 3134
236 Ga0207686_10456923 3300025934 Bacteria 983
237 Ga0207709_11457933 3300025935 Bacteria 567
238 Ga0207670_10173075 3300025936 Unclassified 1620
239 Ga0207669_10053361 3300025937 Unclassified 2435
240 Ga0207704_10605622 3300025938 Bacteria 897
241 Ga0207691_10030714 3300025940 Bacteria 5018
242 Ga0207711_10171215 3300025941 Unclassified 1970
243 Ga0207711_11127732 3300025941 Unclassified 725
244 Ga0207689_10021057 3300025942 Bacteria 5481
245 Ga0207689_11036775 3300025942 Bacteria 692
246 Ga0207661_10003602 3300025944 Bacteria 10775
247 Ga0207661_10007934 3300025944 Bacteria 7569
248 Ga0207661_10029747 3300025944 Unclassified 4199
249 Ga0207661_10066391 3300025944 Bacteria 2931
250 Ga0207679_10283790 3300025945 Bacteria 1421
251 Ga0207679_10704051 3300025945 Bacteria 917
252 Ga0207667_10279373 3300025949 Unclassified 1706
253 Ga0207651_10184595 3300025960 Unclassified 1658
254 Ga0207712_10000281 3300025961 Bacteria 48578
255 Ga0207712_11875922 3300025961 Unclassified 537
256 Ga0207668_10127564 3300025972 Bacteria 1937
257 Ga0207668_11245222 3300025972 Unclassified 669
258 Ga0207658_10982419 3300025986 Unclassified 770
259 Ga0207677_10069652 3300026023 Bacteria 2474
260 Ga0207703_10185566 3300026035 Unclassified 1838
261 Ga0207639_12194664 3300026041 Unclassified 513
262 Ga0207708_10276842 3300026075 Bacteria 1359
263 Ga0207641_10043870 3300026088 Bacteria 3758
264 Ga0207648_10004544 3300026089 Bacteria 14229
265 Ga0207648_10452018 3300026089 Bacteria 1170
266 Ga0207676_10650037 3300026095 Unclassified 1017
267 Ga0207676_11566147 3300026095 Bacteria 656
268 Ga0207674_10000277 3300026116 Bacteria 64755
269 Ga0207674_10005557 3300026116 Bacteria 14953
270 Ga0207675_100020266 3300026118 Bacteria 6200
271 Ga0207683_10513350 3300026121 Unclassified 1107
272 Ga0207698_10269195 3300026142 Unclassified 1570
273 Ga0209983_1007311 3300027665 Bacteria 2265
274 Ga0209974_10115874 3300027876 Bacteria 946
275 Ga0207428_10044056 3300027907 Unclassified 3600
276 Ga0207428_10637606 3300027907 Bacteria 765
277 Ga0268265_10001283 3300028380 Bacteria 21622
278 Ga0268265_10162568 3300028380 Bacteria 1899
279 Ga0307408_100497978 3300031548 Bacteria 1066
280 Ga0307413_10090585 3300031824 Unclassified 1990
281 Ga0307410_10411460 3300031852 Unclassified 1095
282 Ga0307406_10013869 3300031901 Bacteria 4626
283 Ga0307406_10845856 3300031901 Unclassified 775
284 Ga0307407_10194001 3300031903 Bacteria 1356
285 Ga0307409_101534877 3300031995 Bacteria 694
286 Ga0307416_100591447 3300032002 Bacteria 1188
287 Ga0307416_100671351 3300032002 Unclassified 1123
288 Ga0307414_10002723 3300032004 Bacteria 9297
289 Ga0307414_10040796 3300032004 Unclassified 3138
290 Ga0307414_11401886 3300032004 Unclassified 649
291 Ga0307411_10004568 3300032005 Bacteria 6655
292 Ga0307411_11248056 3300032005 Unclassified 675
293 Ga0307415_100122649 3300032126 Viruses 1952
294 Ga0307415_100503104 3300032126 Bacteria 1060
295 Ga0307415_100937184 3300032126 Bacteria 801
296 Ga0373926_0279233 3300035083 Unclassified 650
297 Ga0373934_0000556 3300035086 Bacteria 13169
298 Ga0373923_0039975 3300035111 Bacteria 1928
299 Ga0373939_0116649 3300035114 Bacteria 937
300 Ga0373945_0057608 3300035116 Bacteria 1444
301 Ga0373956_0000439 3300035119 Bacteria 16928
302 Ga0373943_0828297 3300035170 Unclassified 551
303 Ga0373955_0000707 3300035172 Bacteria 14386
304 Ga0373955_0018533 3300035172 Unclassified 3463
305 Ga0373924_0023310 3300035410 Unclassified 2427
306 Ga0373924_0040737 3300035410 Bacteria 1902
307 Ga0373924_0046933 3300035410 Bacteria 1781
308 Ga0373931_0211304 3300035691 Bacteria 1164
309 Ga0373931_0281972 3300035691 Bacteria 1020
310 Ga0373935_0097675 3300035692 Bacteria 1932
311 Ga0373927_0008382 3300035695 Bacteria 6957
312 Ga0373927_0078983 3300035695 Unclassified 2131
313 Ga0373933_0001498 3300035724 Bacteria 13660
314 Ga0373947_0093432 3300035725 Unclassified 1880
315 Ga0373947_0187482 3300035725 Bacteria 1349
316 Ga0373937_0000405 3300036401 Bacteria 40196
317 Ga0373937_0015511 3300036401 Bacteria 6740
318 Ga0373925_0002334 3300037068 Bacteria 15264
319 Ga0373925_0017609 3300037068 Bacteria 5183
320 Ga0373925_0119131 3300037068 Unclassified 2048
321 Ga0395900_1062303 3300037418 Unclassified 728
322 Ga0436365_0035116 3300039437 Bacteria 1789
323 Ga0439461_0081968 3300041410 Bacteria 762
324 Ga0439441_065336 3300042001 Unclassified 772
325 Ga0439456_109027 3300042013 Bacteria 630
326 Ga0439462_0099514 3300042015 Unclassified 801
327 Ga0453683_0125502 3300044673 Bacteria 1616
328 Ga0466961_0515334 3300044693 Bacteria 722
329 Ga0466963_0144615 3300044694 Bacteria 1649
330 Ga0466971_0353583 3300044719 Unclassified 711
331 Ga0451576_0111575 3300045051 Bacteria 2846
332 Ga0451576_0146910 3300045051 Bacteria 2458
333 Ga0451576_0727760 3300045051 Unclassified 1042
334 Ga0451576_1021430 3300045051 Bacteria 866
335 Ga0466958_0436703 3300045836 Bacteria 847
336 Ga0466967_0467594 3300045976 Unclassified 1234
337 Ga0495592_0020167 3300046454 Bacteria 5070
338 Ga0495629_0016545 3300046459 Bacteria 5294
339 Ga0495651_0000582 3300046462 Bacteria 28355
340 Ga0495653_0000157 3300046463 Bacteria 56338
341 Ga0495582_0161178 3300046473 Bacteria 1275
342 Ga0495582_0369782 3300046473 Unclassified 826
343 Ga0495639_0054471 3300046475 Bacteria 1823
344 Ga0495639_0076987 3300046475 Bacteria 1548
345 Ga0495639_0435245 3300046475 Unclassified 665
346 Ga0495594_0012980 3300046499 Bacteria 4344
347 Ga0495608_0000401 3300046511 Bacteria 30323
348 Ga0495618_0043132 3300046514 Bacteria 2846
349 Ga0495628_0000635 3300046516 Bacteria 32118
350 Ga0495630_0017605 3300046517 Bacteria 5237
351 Ga0495630_0100833 3300046517 Unclassified 2184
352 Ga0495666_0224502 3300046526 Bacteria 860
353 Ga0495652_0000971 3300046529 Bacteria 32778
354 Ga0495665_0084305 3300046531 Bacteria 1670
355 Ga0495665_0177878 3300046531 Bacteria 1106
356 Ga0495665_0618838 3300046531 Unclassified 540
357 Ga0495586_0033162 3300046535 Bacteria 2771
358 Ga0495587_0000848 3300046536 Bacteria 20213
359 Ga0495645_0001016 3300046543 Bacteria 19077
360 Ga0495645_0262147 3300046543 Bacteria 1144
361 Ga0495667_0000461 3300046559 Bacteria 26022
362 Ga0495635_0000574 3300046663 Bacteria 23595
363 Ga0495657_0002107 3300046675 Bacteria 16908
364 Ga0495599_0000286 3300046678 Bacteria 30892
365 Ga0495623_0000029 3300046679 Bacteria 85797
366 Ga0495646_0000137 3300046680 Bacteria 37174
367 Ga0495647_0137893 3300046681 Bacteria 1038
368 Ga0495647_0171673 3300046681 Unclassified 939
369 Ga0495600_0000523 3300046809 Bacteria 19907
370 Ga0495581_0005266 3300047315 Bacteria 7479
371 Ga0495581_0127389 3300047315 Unclassified 1483
372 Ga0495581_0283474 3300047315 Bacteria 968
373 Ga0495581_0779522 3300047315 Bacteria 549
374 Ga0495604_0000464 3300047317 Bacteria 35933
375 Ga0495674_0040062 3300047319 Bacteria 4193
376 Ga0495680_0000845 3300047322 Bacteria 33973
377 Ga0495675_0001938 3300047444 Bacteria 12335
378 Ga0495677_0393578 3300047445 Unclassified 548
379 Ga0495684_0000367 3300047471 Bacteria 36773
380 Ga0495593_0155347 3300047673 Unclassified 1156
381 Ga0495602_0001323 3300048088 Bacteria 24444
382 Ga0496102_0372861 3300048905 Bacteria 1343
383 Ga0496104_0317589 3300048907 Bacteria 1471
384 Ga0496108_0098868 3300048911 Bacteria 2486
385 Ga0496109_0259994 3300048912 Bacteria 1635
386 Ga0496110_0598973 3300048913 Bacteria 1000
387 Ga0496111_1296058 3300048914 Unclassified 513
388 Ga0496112_1554141 3300048915 Bacteria 575
389 Ga0496113_0083633 3300048916 Bacteria 2449
390 Ga0501041_0899519 3300049577 Unclassified 569
391 Ga0501072_0479186 3300049588 Bacteria 985
392 Ga0501072_0858953 3300049588 Bacteria 709
393 Ga0501045_0852960 3300049824 Bacteria 670
394 nmdc:mga05p37_947015_c1 3300050507 Unclassified 922
395 nmdc:mga09592_244221_c1 3300050508 Bacteria 1556
396 nmdc:mga0qj67_108112_c1 3300050509 Unclassified 2244
397 nmdc:mga0qj67_20976_c1 3300050509 Bacteria 5007
398 nmdc:mga0qj67_480074_c1 3300050509 Unclassified 1000
399 nmdc:mga06r32_118661_c1 3300050510 Bacteria 2608
400 nmdc:mga06r32_1883523_c1 3300050510 Unclassified 533
401 nmdc:mga06r32_455539_c1 3300050510 Bacteria 1259
402 nmdc:mga08y16_24081_c1 3300050511 Bacteria 6428
403 nmdc:mga0rr50_142644_c1 3300050513 Bacteria 1928
404 nmdc:mga08x19_45225_c1 3300050514 Unclassified 2813
405 nmdc:mga0a205_533146_c1 3300050515 Unclassified 1030
406 Ga0495601_0004013 3300053077 Bacteria 8479
407 Ga0495612_0001147 3300053078 Bacteria 10881
408 Ga0495595_0095151 3300053084 Bacteria 1433
409 Ga0495619_0025363 3300053085 Bacteria 3807
410 Ga0501082_1695934 3300060353 Bacteria 551
411 Ga0068862_100221576
412 Ga0065712_10131397
413 Ga0065712_10300283
414 Ga0065707_10449594
415 Ga0070676_10327400
416 Ga0070683_100010387
417 Ga0070683_100033077
418 Ga0070670_100164956
419 Ga0068869_100306685
420 Ga0068869_100792175
421 Ga0070680_100020840
422 Ga0070680_100722871
423 Ga0070682_100007337
424 Ga0068868_100115209
425 Ga0070660_100128422
426 Ga0070689_101025270
427 Ga0070687_100056420
428 Ga0070692_10088597
429 Ga0070668_100051554
430 Ga0070669_100001516
431 Ga0070675_100132209
432 Ga0070675_100741944
433 Ga0070671_100286372
434 Ga0070671_100375525
435 Ga0070671_100716371
436 Ga0070673_100366503
437 Ga0070667_100467415
438 Ga0070709_10030741
439 Ga0070714_100141701
440 Ga0070713_101414403
441 Ga0070705_100370460
442 Ga0070705_100574229
443 Ga0070700_100247953
444 Ga0070694_100301359
445 Ga0070694_100632176
446 Ga0070694_101459584
447 Ga0070708_100000072
448 Ga0070708_100047171
449 Ga0070708_100117309
450 Ga0070708_100209562
451 Ga0070662_100331748
452 Ga0070681_10066956
453 Ga0070681_10203735
454 Ga0068867_100189612
455 Ga0068867_100330612
456 Ga0070706_100004811
457 Ga0070706_100005593
458 Ga0070706_100052046
459 Ga0070706_100489558
460 Ga0070706_100642247
461 Ga0070707_100035624
462 Ga0070707_100116115
463 Ga0070707_100339648
464 Ga0070707_100519832
465 Ga0070707_101188808
466 Ga0070707_102320701
467 Ga0070698_100000183
468 Ga0070698_100137322
469 Ga0070698_100191682
470 Ga0070698_100285266
471 Ga0070698_100317572
472 Ga0070698_100343163
473 Ga0070698_100428812
474 Ga0070698_102156785
475 Ga0070699_100009820
476 Ga0070699_100120920
477 Ga0070699_100743752
478 Ga0070699_100842624
479 Ga0070679_100007764
480 Ga0070679_100024648
481 Ga0070679_100048931
482 Ga0070679_100418285
483 Ga0070684_100002077
484 Ga0070684_100008326
485 Ga0070684_100117830
486 Ga0070684_100203516
487 Ga0070697_100002267
488 Ga0070697_100114591
489 Ga0070697_100138150
490 Ga0070697_101043933
491 Ga0068853_100737584
492 Ga0068853_102365053
493 Ga0070672_100261050
494 Ga0070672_100268785
495 Ga0070696_101824379
496 Ga0070693_100096854
497 Ga0070693_100289320
498 Ga0070704_100411514
499 Ga0068855_100036031
500 Ga0068855_100755716
501 Ga0070664_100058054
502 Ga0070664_100301546
503 Ga0070664_100373597
504 Ga0068857_100025943
505 Ga0068857_100227601
506 Ga0068856_100351986
507 Ga0068856_100401137
508 Ga0070702_100013766
509 Ga0070702_101502172
510 Ga0068852_100332374
511 Ga0068859_100009164
512 Ga0068859_100071025
513 Ga0068864_100003806
514 Ga0068864_101170630
515 Ga0068866_10325945
516 Ga0068866_11291443
517 Ga0068861_101875731
518 Ga0068870_10010961
519 Ga0068870_10011620
520 Ga0068870_10020143
521 Ga0068870_10385853
522 Ga0068863_100104183
523 Ga0068858_100120449
524 Ga0068860_100047669
525 Ga0068860_101332858
526 Ga0068862_100000743
527 Ga0081539_10000290
528 Ga0070716_101419293
529 Ga0070712_100222514
530 Ga0070712_100407101
531 Ga0097621_100084966
532 Ga0068871_100195138
533 Ga0075428_100706662
534 Ga0075428_101297300
535 Ga0075430_100109646
536 Ga0075431_100001499
537 Ga0075431_100162477
538 Ga0075433_10188277
539 Ga0075429_100033450
540 Ga0075429_100510767
541 Ga0068865_101407371
542 Ga0075436_100231226
543 Ga0075436_100989940
544 Ga0097620_100009164
545 Ga0097620_100071025
546 Ga0075435_100690153
547 Ga0075435_101114262
548 Ga0105240_10522546
549 Ga0111539_10087283
550 Ga0111539_10719262
551 Ga0111539_12780145
552 Ga0105245_10076058
553 Ga0105245_10809745
554 Ga0105247_10422177
555 Ga0105247_11378260
556 Ga0114129_10025559
557 Ga0114129_10496863
558 Ga0105243_10606563
559 Ga0105243_10946554
560 Ga0105241_10122051
561 Ga0105242_10046407
562 Ga0105242_10188496
563 Ga0105242_10390768
564 Ga0105248_10026635
565 Ga0105248_10061399
566 Ga0105248_10240727
567 Ga0105248_13399795
568 Ga0105237_10062807
569 Ga0105237_11554115
570 Ga0105238_10145791
571 Ga0105238_11963474
572 Ga0105249_10000075
573 Ga0105249_10053529
574 Ga0105249_10879008
575 Ga0105239_10196770
576 Ga0105239_11599855
577 Ga0105246_12332672
578 Ga0157373_10118134
579 Ga0157373_10333712
580 Ga0157371_10018166
581 Ga0157370_10144896
582 Ga0157370_10775235
583 Ga0157369_10365510
584 Ga0157369_11259173
585 Ga0157374_10084796
586 Ga0157378_10030961
587 Ga0163162_10007839
588 Ga0163162_10987714
589 Ga0157372_10149286
590 Ga0157372_10199852
591 Ga0157372_10284716
592 Ga0157372_10610409
593 Ga0157372_11952025
594 Ga0157375_11004454
595 Ga0157375_12050870
596 Ga0163163_10023809
597 Ga0163163_10059074
598 Ga0157380_10042606
599 Ga0157380_11367685
600 Ga0157377_10005545
601 Ga0157379_10347041
602 Ga0157376_10748900
603 Ga0157376_11127303
604 Ga0163161_11746714
605 Ga0207692_10266502
606 Ga0207642_10324214
607 Ga0207688_10203261
608 Ga0207680_10161704
609 Ga0207699_10035859
610 Ga0207643_10004102
611 Ga0207643_10024685
612 Ga0207643_10248422
613 Ga0207684_10004655
614 Ga0207684_10018705
615 Ga0207684_10039523
616 Ga0207684_10303568
617 Ga0207684_10551407
618 Ga0207654_10099099
619 Ga0207707_10021669
620 Ga0207671_11224289
621 Ga0207693_10300858
622 Ga0207693_10753238
623 Ga0207660_10135695
624 Ga0207662_10219606
625 Ga0207657_10036903
626 Ga0207652_10092453
627 Ga0207646_10129322
628 Ga0207646_10167493
629 Ga0207646_10466866
630 Ga0207646_10869581
631 Ga0207681_10000472
632 Ga0207694_10851248
633 Ga0207650_10084621
634 Ga0207650_11355262
635 Ga0207659_10243724
636 Ga0207659_10626240
637 Ga0207687_10278083
638 Ga0207664_10144080
639 Ga0207644_10367251
640 Ga0207644_11156746
641 Ga0207690_10068347
642 Ga0207706_10006508
643 Ga0207706_10026038
644 Ga0207706_10349882
645 Ga0207686_10031850
646 Ga0207686_10456923
647 Ga0207709_11457933
648 Ga0207670_10173075
649 Ga0207669_10053361
650 Ga0207704_10605622
651 Ga0207691_10030714
652 Ga0207711_10171215
653 Ga0207711_11127732
654 Ga0207689_10021057
655 Ga0207689_11036775
656 Ga0207661_10003602
657 Ga0207661_10007934
658 Ga0207661_10029747
659 Ga0207661_10066391
660 Ga0207679_10283790
661 Ga0207679_10704051
662 Ga0207667_10279373
663 Ga0207651_10184595
664 Ga0207712_10000281
665 Ga0207712_11875922
666 Ga0207668_10127564
667 Ga0207668_11245222
668 Ga0207658_10982419
669 Ga0207677_10069652
670 Ga0207703_10185566
671 Ga0207639_12194664
672 Ga0207708_10276842
673 Ga0207641_10043870
674 Ga0207648_10004544
675 Ga0207648_10452018
676 Ga0207676_10650037
677 Ga0207676_11566147
678 Ga0207674_10000277
679 Ga0207674_10005557
680 Ga0207675_100020266
681 Ga0207683_10513350
682 Ga0207698_10269195
683 Ga0209983_1007311
684 Ga0209974_10115874
685 Ga0207428_10044056
686 Ga0207428_10637606
687 Ga0268265_10001283
688 Ga0268265_10162568
689 Ga0307408_100497978
690 Ga0307413_10090585
691 Ga0307410_10411460
692 Ga0307406_10013869
693 Ga0307406_10845856
694 Ga0307407_10194001
695 Ga0307409_101534877
696 Ga0307416_100591447
697 Ga0307416_100671351
698 Ga0307414_10002723
699 Ga0307414_10040796
700 Ga0307414_11401886
701 Ga0307411_10004568
702 Ga0307411_11248056
703 Ga0307415_100122649
704 Ga0307415_100503104
705 Ga0307415_100937184
706 Ga0373926_0279233
707 Ga0373934_0000556
708 Ga0373923_0039975
709 Ga0373939_0116649
710 Ga0373945_0057608
711 Ga0373956_0000439
712 Ga0373943_0828297
713 Ga0373955_0000707
714 Ga0373955_0018533
715 Ga0373924_0023310
716 Ga0373924_0040737
717 Ga0373924_0046933
718 Ga0373931_0211304
719 Ga0373931_0281972
720 Ga0373935_0097675
721 Ga0373927_0008382
722 Ga0373927_0078983
723 Ga0373933_0001498
724 Ga0373947_0093432
725 Ga0373947_0187482
726 Ga0373937_0000405
727 Ga0373937_0015511
728 Ga0373925_0002334
729 Ga0373925_0017609
730 Ga0373925_0119131
731 Ga0395900_1062303
732 Ga0436365_0035116
733 Ga0439461_0081968
734 Ga0439441_065336
735 Ga0439456_109027
736 Ga0439462_0099514
737 Ga0453683_0125502
738 Ga0466961_0515334
739 Ga0466963_0144615
740 Ga0466971_0353583
741 Ga0451576_0111575
742 Ga0451576_0146910
743 Ga0451576_0727760
744 Ga0451576_1021430
745 Ga0466958_0436703
746 Ga0466967_0467594
747 Ga0495592_0020167
748 Ga0495629_0016545
749 Ga0495651_0000582
750 Ga0495653_0000157
751 Ga0495582_0161178
752 Ga0495582_0369782
753 Ga0495639_0054471
754 Ga0495639_0076987
755 Ga0495639_0435245
756 Ga0495594_0012980
757 Ga0495608_0000401
758 Ga0495618_0043132
759 Ga0495628_0000635
760 Ga0495630_0017605
761 Ga0495630_0100833
762 Ga0495666_0224502
763 Ga0495652_0000971
764 Ga0495665_0084305
765 Ga0495665_0177878
766 Ga0495665_0618838
767 Ga0495586_0033162
768 Ga0495587_0000848
769 Ga0495645_0001016
770 Ga0495645_0262147
771 Ga0495667_0000461
772 Ga0495635_0000574
773 Ga0495657_0002107
774 Ga0495599_0000286
775 Ga0495623_0000029
776 Ga0495646_0000137
777 Ga0495647_0137893
778 Ga0495647_0171673
779 Ga0495600_0000523
780 Ga0495581_0005266
781 Ga0495581_0127389
782 Ga0495581_0283474
783 Ga0495581_0779522
784 Ga0495604_0000464
785 Ga0495674_0040062
786 Ga0495680_0000845
787 Ga0495675_0001938
788 Ga0495677_0393578
789 Ga0495684_0000367
790 Ga0495593_0155347
791 Ga0495602_0001323
792 Ga0496102_0372861
793 Ga0496104_0317589
794 Ga0496108_0098868
795 Ga0496109_0259994
796 Ga0496110_0598973
797 Ga0496111_1296058
798 Ga0496112_1554141
799 Ga0496113_0083633
800 Ga0501041_0899519
801 Ga0501072_0479186
802 Ga0501072_0858953
803 Ga0501045_0852960
804 nmdc:mga05p37_947015_c1
805 nmdc:mga09592_244221_c1
806 nmdc:mga0qj67_108112_c1
807 nmdc:mga0qj67_20976_c1
808 nmdc:mga0qj67_480074_c1
809 nmdc:mga06r32_118661_c1
810 nmdc:mga06r32_1883523_c1
811 nmdc:mga06r32_455539_c1
812 nmdc:mga08y16_24081_c1
813 nmdc:mga0rr50_142644_c1
814 nmdc:mga08x19_45225_c1
815 nmdc:mga0a205_533146_c1
816 Ga0495601_0004013
817 Ga0495612_0001147
818 Ga0495595_0095151
819 Ga0495619_0025363
820 Ga0501082_1695934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

68

153

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mwm-assembly1.cif.gz_A bat coronavirus hku4 sud-c 0.7358 20 43
3cje-assembly1.cif.gz_A-2 crystal structure of an osmc-like hydroperoxide resistance protein (jann_2040) from jannaschia sp. ccs1 at 1.70 a resolution 0.6934 5 125
3cje-assembly1.cif.gz_A-2 crystal structure of an osmc-like hydroperoxide resistance protein (jann_2040) from jannaschia sp. ccs1 at 1.70 a resolution 0.6637 5 125
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.6449 12 126
6mjn-assembly2.cif.gz_C crystal structure of an organic hydroperoxide resistance protein osmc, predicted redox protein, regulator of sulfide bond formation from legionella pneumophila 0.6223 12 123
ID Description Score Start End Superfamily
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.874 47 125 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8544 45 126 3.30.300.20
af_Q18859_251_714_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7571 17 41 2.130.10.10
af_Q57993_77_188_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7362 39 126 3.30.300.20
af_A8XK66_45_174_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.728 12 40 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1F3ZWM4-F1-model_v4 Osmotically inducible protein C 0.9138 41 126
AF-A0A1H6R4Z1-F1-model_v4 OsmC-like protein 0.825 2 124
AF-A0A1F3ZWM4-F1-model_v4 Osmotically inducible protein C 0.8225 41 126
AF-A0A7C4PID5-F1-model_v4 OsmC family peroxiredoxin 0.8089 41 126
AF-A0A7V8XCX4-F1-model_v4 OsmC family protein 0.8038 41 125

Map