F437154

General Info

Members Datasets Scaffolds Average Seq Length
410 262 820 363

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1003841|Ga0055540_10038413
Length 378
Sequence VNVPLSVLDLSPISEGSDAATALRNTVDLARHAERWGYRRYWLAEHHFVSVASSSPAVLIGQLAAATSRIQVGAAAVQLGYTTAVAVVESFGILDALYPGRIDLGVGRSGQRRHEAVXQXPSKASPSSPSSRVWHEVDGVVVPTPFDLSAMMRNPRLRARASVLQQPEAVAPDFADQVADILAMVEGTYRVGDVEVRAVPGEGAALRPWVFGXSKGQSARVAAKFGLPFVASYHITPATALEAVEVYRENFQPSAALPEPHVVVSADVVVADDTATAEHLASSYGQWVHAIRAGDGAVPYPDPESTPPLTADQLEVVRDRTATQFVGDPDEVAHRLDALQRLSGANELVITSVTHGHADRLRSHELIATRWGLNQPLP

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
255 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
256 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
257 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
258 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
259 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
260 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
261 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
262 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 0
Isolates 2.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.56
Nodule 0
Rhizoplane 9.51
Rhizosphere 73.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1003841 3300003792 Bacteria 7052
2 JGI24746J21847_1005007 3300001977 Bacteria 2076
3 JGI24744J21845_10004889 3300002077 Bacteria 2772
4 JGI24742J22300_10004258 3300002244 Bacteria 2338
5 JGI24751J29686_10010359 3300002459 Bacteria 1921
6 Ga0055540_1005631 3300003792 Bacteria 5204
7 Ga0055540_1011075 3300003792 Bacteria 2944
8 Ga0070690_100059621 3300005330 Bacteria 2454
9 Ga0068869_100018601 3300005334 Bacteria 4732
10 Ga0070666_10026541 3300005335 Bacteria 3786
11 Ga0070682_100027560 3300005337 Bacteria 3410
12 Ga0068868_100010607 3300005338 Bacteria 6676
13 Ga0068868_100178778 3300005338 Bacteria 1759
14 Ga0070689_100180841 3300005340 Bacteria 1713
15 Ga0070691_10003034 3300005341 Bacteria 7521
16 Ga0070692_10059379 3300005345 Bacteria 2010
17 Ga0070668_100000585 3300005347 Bacteria 24454
18 Ga0070668_100112763 3300005347 Bacteria 2165
19 Ga0070669_100002323 3300005353 Bacteria 13755
20 Ga0070675_100040300 3300005354 Bacteria 3812
21 Ga0070671_100047874 3300005355 Bacteria 3554
22 Ga0070671_100188882 3300005355 Bacteria 1746
23 Ga0070674_100001716 3300005356 Bacteria 11869
24 Ga0070674_100082467 3300005356 Bacteria 2300
25 Ga0070659_100050341 3300005366 Bacteria 3275
26 Ga0070667_100000029 3300005367 Bacteria 178990
27 Ga0070667_100005238 3300005367 Bacteria 10840
28 Ga0070667_100178452 3300005367 Bacteria 1877
29 Ga0070667_100205058 3300005367 Bacteria 1750
30 Ga0070667_100254224 3300005367 Bacteria 1571
31 Ga0070709_10046440 3300005434 Bacteria 2700
32 Ga0070710_10013570 3300005437 Bacteria 4084
33 Ga0070711_100003121 3300005439 Bacteria 9597
34 Ga0070711_100010780 3300005439 Bacteria 5668
35 Ga0070705_100020076 3300005440 Bacteria 3529
36 Ga0070700_100004903 3300005441 Bacteria 7035
37 Ga0070678_100005558 3300005456 Bacteria 7310
38 Ga0070662_100013581 3300005457 Bacteria 5422
39 Ga0068867_100012976 3300005459 Bacteria 5896
40 Ga0068867_100042100 3300005459 Bacteria 3339
41 Ga0070706_100166332 3300005467 Bacteria 2059
42 Ga0070697_100011789 3300005536 Bacteria 6840
43 Ga0068853_100035716 3300005539 Bacteria 4223
44 Ga0068853_100093071 3300005539 Bacteria 2653
45 Ga0068853_100204394 3300005539 Bacteria 1798
46 Ga0070686_100028141 3300005544 Bacteria 3406
47 Ga0070695_100142783 3300005545 Bacteria 1662
48 Ga0070696_100011502 3300005546 Bacteria 5928
49 Ga0070696_100196783 3300005546 Bacteria 1503
50 Ga0070693_100023041 3300005547 Bacteria 3322
51 Ga0070665_100033272 3300005548 Bacteria 5187
52 Ga0070665_100169184 3300005548 Bacteria 2187
53 Ga0070665_100402926 3300005548 Bacteria 1376
54 Ga0070704_100001371 3300005549 Bacteria 12924
55 Ga0070704_100080104 3300005549 Bacteria 2401
56 Ga0068854_100025503 3300005578 Bacteria 4057
57 Ga0070702_100083673 3300005615 Bacteria 1917
58 Ga0068852_100155902 3300005616 Bacteria 2127
59 Ga0068852_100264464 3300005616 Bacteria 1653
60 Ga0068859_100006279 3300005617 Bacteria 12058
61 Ga0068859_100013060 3300005617 Bacteria 8345
62 Ga0068859_100234528 3300005617 Bacteria 1923
63 Ga0068866_10003004 3300005718 Bacteria 6967
64 Ga0068861_100003079 3300005719 Bacteria 11018
65 Ga0068861_100183760 3300005719 Bacteria 1742
66 Ga0068861_100352092 3300005719 Bacteria 1292
67 Ga0068863_100000120 3300005841 Bacteria 82283
68 Ga0068863_100057302 3300005841 Bacteria 3687
69 Ga0068858_100000958 3300005842 Bacteria 29861
70 Ga0068858_100049174 3300005842 Bacteria 3905
71 Ga0068860_100000088 3300005843 Bacteria 154416
72 Ga0068860_100001364 3300005843 Bacteria 26529
73 Ga0068862_100000056 3300005844 Bacteria 142257
74 Ga0068862_100006606 3300005844 Bacteria 9618
75 Ga0068862_100024261 3300005844 Bacteria 5088
76 Ga0068862_100042651 3300005844 Bacteria 3866
77 Ga0081455_10073617 3300005937 Bacteria 2824
78 Ga0075365_10089332 3300006038 Bacteria 2097
79 Ga0075365_10111069 3300006038 Bacteria 1884
80 Ga0075363_100003433 3300006048 Bacteria 6731
81 Ga0075363_100004810 3300006048 Bacteria 5960
82 Ga0075363_100008087 3300006048 Bacteria 4880
83 Ga0075363_100008182 3300006048 Bacteria 4857
84 Ga0075364_10003733 3300006051 Bacteria 8694
85 Ga0075364_10010374 3300006051 Bacteria 5626
86 Ga0075364_10017095 3300006051 Bacteria 4525
87 Ga0075364_10021451 3300006051 Bacteria 4071
88 Ga0070715_10002461 3300006163 Bacteria 5689
89 Ga0070716_100029624 3300006173 Bacteria 2962
90 Ga0070712_100005399 3300006175 Bacteria 7912
91 Ga0070712_100040423 3300006175 Bacteria 3197
92 Ga0075367_10006248 3300006178 Bacteria 6002
93 Ga0075369_10000916 3300006186 Bacteria 9759
94 Ga0075369_10006147 3300006186 Bacteria 4529
95 Ga0075369_10047628 3300006186 Bacteria 1848
96 Ga0097621_100164899 3300006237 Bacteria 1907
97 Ga0075370_10069059 3300006353 Bacteria 2019
98 Ga0075370_10078484 3300006353 Bacteria 1896
99 Ga0075428_100030455 3300006844 Bacteria 5968
100 Ga0068865_100001029 3300006881 Bacteria 16058
101 Ga0097620_100006279 3300006931 Bacteria 12058
102 Ga0097620_100013058 3300006931 Bacteria 8345
103 Ga0097620_100234513 3300006931 Bacteria 1923
104 Ga0099795_10007187 3300007788 Bacteria 3090
105 Ga0111539_10067506 3300009094 Bacteria 4223
106 Ga0105245_10001511 3300009098 Bacteria 21074
107 Ga0105245_10105505 3300009098 Bacteria 2614
108 Ga0105245_10297685 3300009098 Bacteria 1582
109 Ga0105247_10000008 3300009101 Bacteria 391450
110 Ga0105247_10002878 3300009101 Bacteria 11460
111 Ga0105247_10014525 3300009101 Bacteria 4723
112 Ga0114129_10022864 3300009147 Bacteria 8866
113 Ga0105243_10003449 3300009148 Bacteria 12792
114 Ga0105241_10095328 3300009174 Bacteria 2355
115 Ga0105242_10003348 3300009176 Bacteria 12467
116 Ga0105248_10000051 3300009177 Bacteria 150288
117 Ga0105248_10013467 3300009177 Bacteria 9005
118 Ga0105248_10500749 3300009177 Bacteria 1369
119 Ga0105237_10001908 3300009545 Bacteria 26595
120 Ga0105238_10230569 3300009551 Bacteria 1829
121 Ga0105238_10357313 3300009551 Bacteria 1450
122 Ga0105249_10000040 3300009553 Bacteria 196153
123 Ga0105249_10003250 3300009553 Bacteria 14076
124 Ga0105249_10114771 3300009553 Bacteria 2550
125 Ga0105239_10005473 3300010375 Bacteria 14898
126 Ga0105239_10158079 3300010375 Bacteria 2532
127 Ga0105239_10337417 3300010375 Bacteria 1700
128 Ga0105246_10014540 3300011119 Bacteria 4951
129 Ga0157369_10220610 3300013105 Bacteria 1985
130 Ga0157374_10017922 3300013296 Bacteria 6241
131 Ga0157378_10001284 3300013297 Bacteria 22586
132 Ga0157378_10032780 3300013297 Bacteria 4591
133 Ga0163162_10011149 3300013306 Bacteria 8756
134 Ga0163162_10059985 3300013306 Bacteria 3837
135 Ga0157372_10033235 3300013307 Bacteria 5663
136 Ga0157375_10001859 3300013308 Bacteria 18172
137 Ga0157375_10136352 3300013308 Bacteria 2578
138 Ga0163163_10053218 3300014325 Bacteria 3996
139 Ga0163163_10072588 3300014325 Bacteria 3431
140 Ga0163163_10131830 3300014325 Bacteria 2539
141 Ga0157380_10013711 3300014326 Bacteria 5918
142 Ga0157380_10067380 3300014326 Bacteria 2882
143 Ga0157377_10004729 3300014745 Bacteria 6305
144 Ga0157379_10047546 3300014968 Bacteria 3827
145 Ga0157379_10119844 3300014968 Bacteria 2367
146 Ga0157379_10127991 3300014968 Bacteria 2285
147 Ga0157376_10109680 3300014969 Bacteria 2427
148 Ga0163161_10003622 3300017792 Bacteria 10841
149 Ga0213872_10012675 3300021361 Bacteria 3961
150 Ga0213876_10000666 3300021384 Bacteria 24572
151 Ga0209673_1010905 3300025273 Bacteria 3793
152 Ga0209051_1001438 3300025303 Bacteria 20303
153 Ga0209051_1004735 3300025303 Bacteria 8241
154 Ga0209051_1006508 3300025303 Bacteria 6568
155 Ga0207692_10026786 3300025898 Bacteria 2707
156 Ga0207642_10000442 3300025899 Bacteria 12557
157 Ga0207710_10000006 3300025900 Bacteria 538831
158 Ga0207710_10014357 3300025900 Bacteria 3339
159 Ga0207710_10028418 3300025900 Bacteria 2428
160 Ga0207688_10003969 3300025901 Bacteria 8064
161 Ga0207688_10033578 3300025901 Bacteria 2839
162 Ga0207699_10067921 3300025906 Bacteria 2169
163 Ga0207671_10019348 3300025914 Bacteria 5206
164 Ga0207693_10000832 3300025915 Bacteria 27450
165 Ga0207693_10005372 3300025915 Bacteria 10707
166 Ga0207663_10014848 3300025916 Bacteria 4280
167 Ga0207681_10002196 3300025923 Bacteria 12443
168 Ga0207681_10062368 3300025923 Bacteria 2567
169 Ga0207650_10109561 3300025925 Bacteria 2136
170 Ga0207659_10013377 3300025926 Bacteria 5252
171 Ga0207659_10136734 3300025926 Bacteria 1898
172 Ga0207687_10003776 3300025927 Bacteria 10177
173 Ga0207644_10021322 3300025931 Bacteria 4412
174 Ga0207644_10075719 3300025931 Bacteria 2474
175 Ga0207690_10028400 3300025932 Bacteria 3546
176 Ga0207706_10021949 3300025933 Bacteria 5730
177 Ga0207706_10033121 3300025933 Bacteria 4600
178 Ga0207686_10003707 3300025934 Bacteria 8191
179 Ga0207709_10010153 3300025935 Bacteria 5186
180 Ga0207670_10040696 3300025936 Bacteria 3051
181 Ga0207669_10004121 3300025937 Bacteria 6368
182 Ga0207704_10003125 3300025938 Bacteria 7488
183 Ga0207665_10037676 3300025939 Bacteria 3218
184 Ga0207691_10136285 3300025940 Bacteria 2165
185 Ga0207711_10000095 3300025941 Bacteria 93602
186 Ga0207689_10029755 3300025942 Bacteria 4556
187 Ga0207712_10000017 3300025961 Bacteria 337943
188 Ga0207712_10010028 3300025961 Bacteria 6004
189 Ga0207668_10000524 3300025972 Bacteria 24019
190 Ga0207668_10033161 3300025972 Bacteria 3418
191 Ga0207668_10119088 3300025972 Bacteria 1996
192 Ga0207640_10010763 3300025981 Bacteria 5161
193 Ga0207658_10000016 3300025986 Bacteria 215618
194 Ga0207658_10004038 3300025986 Bacteria 10265
195 Ga0207658_10078917 3300025986 Bacteria 2517
196 Ga0207677_10029247 3300026023 Bacteria 3498
197 Ga0207677_10047958 3300026023 Bacteria 2872
198 Ga0207703_10037146 3300026035 Bacteria 3880
199 Ga0207639_10026730 3300026041 Bacteria 4195
200 Ga0207678_10041272 3300026067 Bacteria 4000
201 Ga0207678_10050247 3300026067 Bacteria 3603
202 Ga0207678_10266322 3300026067 Bacteria 1469
203 Ga0207708_10003727 3300026075 Bacteria 11246
204 Ga0207641_10000670 3300026088 Bacteria 37268
205 Ga0207648_10007897 3300026089 Bacteria 10380
206 Ga0207648_10016627 3300026089 Bacteria 6716
207 Ga0207675_100004096 3300026118 Bacteria 14105
208 Ga0207675_100150579 3300026118 Bacteria 2214
209 Ga0207683_10004692 3300026121 Bacteria 11782
210 Ga0268266_10009733 3300028379 Bacteria 8451
211 Ga0268266_10032646 3300028379 Bacteria 4423
212 Ga0268265_10000068 3300028380 Bacteria 142272
213 Ga0268264_10000056 3300028381 Bacteria 310339
214 Ga0268264_10035585 3300028381 Bacteria 4099
215 Ga0265318_10000106 3300028577 Bacteria 78364
216 Ga0265330_10000077 3300031235 Bacteria 84499
217 Ga0265332_10000171 3300031238 Bacteria 52909
218 Ga0265332_10037342 3300031238 Bacteria 2107
219 Ga0265328_10014635 3300031239 Bacteria 3085
220 Ga0265320_10000074 3300031240 Bacteria 86360
221 Ga0265325_10031910 3300031241 Bacteria 2816
222 Ga0265329_10001701 3300031242 Bacteria 10530
223 Ga0265339_10013036 3300031249 Bacteria 5051
224 Ga0265339_10082249 3300031249 Bacteria 1700
225 Ga0265331_10000136 3300031250 Bacteria 96265
226 Ga0265331_10009067 3300031250 Bacteria 5619
227 Ga0265316_10003260 3300031344 Bacteria 16489
228 Ga0265313_10000238 3300031595 Bacteria 59676
229 Ga0265314_10000229 3300031711 Bacteria 83603
230 Ga0265342_10003850 3300031712 Bacteria 12075
231 Ga0307409_100081665 3300031995 Bacteria 2614
232 Ga0373943_0007347 3300035170 Bacteria 4946
233 Ga0373962_0030668 3300035242 Bacteria 1472
234 Ga0373931_0051013 3300035691 Bacteria 2202
235 Ga0373933_0224097 3300035724 Bacteria 1207
236 Ga0373937_0158915 3300036401 Bacteria 2119
237 Ga0436364_0053786 3300037853 Bacteria 10554
238 Ga0436364_0548436 3300037853 Bacteria 3079
239 Ga0436365_0882949 3300039437 Bacteria 4814
240 Ga0436365_1597372 3300039437 Bacteria 42103
241 Ga0436361_0323995 3300039447 Bacteria 3029
242 Ga0436363_0136645 3300039450 Bacteria 2662
243 Ga0436363_0779739 3300039450 Bacteria 1162
244 Ga0439466_0026419 3300041411 Bacteria 2018
245 Ga0439466_0041216 3300041411 Bacteria 1541
246 Ga0439465_0003322 3300041413 Bacteria 5251
247 Ga0439431_0004471 3300041997 Bacteria 3075
248 Ga0439431_0006318 3300041997 Bacteria 2618
249 Ga0439434_0002658 3300042435 Bacteria 5208
250 Ga0439435_0017888 3300042436 Bacteria 1798
251 Ga0466969_0025064 3300044656 Bacteria 3068
252 Ga0466972_0022977 3300044658 Bacteria 3103
253 Ga0466966_0014578 3300044684 Bacteria 5203
254 Ga0466961_0002580 3300044693 Bacteria 11232
255 Ga0466961_0019352 3300044693 Bacteria 4380
256 Ga0466968_0036964 3300044735 Bacteria 2047
257 Ga0466970_0024154 3300044765 Bacteria 3178
258 Ga0466970_0057554 3300044765 Bacteria 2079
259 Ga0466957_0003566 3300044842 Bacteria 8573
260 Ga0466957_0220212 3300044842 Bacteria 1253
261 Ga0466960_0000043 3300044901 Bacteria 40805
262 Ga0466959_0004891 3300045049 Bacteria 9073
263 Ga0466958_0073016 3300045836 Bacteria 2101
264 Ga0466967_0061833 3300045976 Bacteria 3323
265 Ga0466967_0119321 3300045976 Bacteria 2434
266 Ga0466967_0221998 3300045976 Bacteria 1796
267 Ga0495629_0033843 3300046459 Bacteria 3614
268 Ga0495641_0019964 3300046461 Bacteria 3414
269 Ga0495582_0120930 3300046473 Bacteria 1475
270 Ga0495583_0037695 3300046506 Bacteria 2290
271 Ga0495606_0022740 3300046507 Bacteria 4557
272 Ga0495648_0002641 3300046524 Bacteria 16273
273 Ga0495665_0033879 3300046531 Bacteria 2731
274 Ga0495640_0027082 3300046533 Bacteria 4138
275 Ga0495668_0029704 3300046616 Bacteria 3088
276 Ga0495611_0007934 3300046648 Bacteria 4507
277 Ga0495581_0049843 3300047315 Bacteria 2418
278 Ga0495674_0013653 3300047319 Bacteria 7632
279 Ga0495672_0003103 3300047320 Bacteria 14505
280 Ga0495672_0095516 3300047320 Bacteria 1623
281 Ga0495673_0002306 3300047469 Bacteria 13646
282 Ga0495686_0010564 3300047472 Bacteria 6560
283 Ga0496100_0022868 3300048903 Bacteria 3788
284 Ga0496100_0024333 3300048903 Bacteria 3693
285 Ga0496101_0000115 3300048904 Bacteria 79334
286 Ga0496101_0003368 3300048904 Bacteria 9962
287 Ga0496101_0132623 3300048904 Bacteria 1893
288 Ga0496102_0000009 3300048905 Bacteria 344149
289 Ga0496102_0001200 3300048905 Bacteria 23510
290 Ga0496102_0004129 3300048905 Bacteria 12310
291 Ga0496102_0037886 3300048905 Bacteria 4349
292 Ga0496102_0048329 3300048905 Bacteria 3868
293 Ga0496102_0162257 3300048905 Bacteria 2103
294 Ga0496103_0000051 3300048906 Bacteria 150397
295 Ga0496103_0000288 3300048906 Bacteria 47116
296 Ga0496103_0001276 3300048906 Bacteria 17179
297 Ga0496103_0057198 3300048906 Bacteria 2421
298 Ga0496104_0016197 3300048907 Bacteria 6768
299 Ga0496104_0038782 3300048907 Bacteria 4459
300 Ga0496105_0083227 3300048908 Bacteria 2643
301 Ga0496105_0128995 3300048908 Bacteria 2085
302 Ga0496106_0004948 3300048909 Bacteria 9856
303 Ga0496106_0008777 3300048909 Bacteria 7469
304 Ga0496106_0138579 3300048909 Bacteria 1912
305 Ga0496107_0002511 3300048910 Bacteria 11931
306 Ga0496107_0005201 3300048910 Bacteria 8887
307 Ga0496107_0034401 3300048910 Bacteria 3630
308 Ga0496107_0094259 3300048910 Bacteria 2190
309 Ga0496108_0003040 3300048911 Bacteria 13484
310 Ga0496108_0036415 3300048911 Bacteria 4094
311 Ga0496108_0079812 3300048911 Bacteria 2771
312 Ga0496109_0018148 3300048912 Bacteria 6178
313 Ga0496112_0021619 3300048915 Bacteria 6119
314 Ga0496112_0024843 3300048915 Bacteria 5748
315 Ga0496112_0052094 3300048915 Bacteria 4016
316 Ga0496112_0238313 3300048915 Bacteria 1772
317 Ga0496113_0124794 3300048916 Bacteria 2015
318 Ga0496114_0021313 3300048917 Bacteria 5271
319 Ga0496114_0213681 3300048917 Bacteria 1692
320 Ga0496114_0444346 3300048917 Bacteria 1148
321 Ga0496115_0041268 3300048918 Bacteria 3671
322 Ga0496116_0000141 3300048919 Bacteria 150405
323 Ga0496116_0007303 3300048919 Bacteria 9842
324 Ga0496116_0066232 3300048919 Bacteria 2312
325 Ga0496117_0000019 3300048920 Bacteria 469256
326 Ga0496117_0000631 3300048920 Bacteria 57010
327 Ga0496117_0038056 3300048920 Bacteria 3574
328 Ga0496118_0000020 3300048921 Bacteria 470521
329 Ga0496118_0003202 3300048921 Bacteria 20888
330 Ga0496118_0003681 3300048921 Bacteria 19010
331 Ga0496119_0003857 3300048922 Bacteria 15313
332 Ga0496120_0005805 3300048923 Bacteria 9675
333 Ga0496120_0024763 3300048923 Bacteria 3736
334 Ga0496121_0000159 3300048924 Bacteria 147049
335 Ga0496121_0000510 3300048924 Bacteria 74197
336 Ga0496121_0002244 3300048924 Bacteria 30111
337 Ga0496122_0024116 3300048925 Bacteria 5333
338 Ga0496123_0027439 3300048926 Bacteria 4241
339 Ga0496124_0060944 3300048927 Bacteria 3164
340 Ga0496124_0125680 3300048927 Bacteria 2043
341 Ga0496125_0000005 3300048928 Bacteria 827598
342 Ga0496126_0006902 3300048929 Bacteria 12577
343 Ga0496126_0015142 3300048929 Bacteria 7768
344 Ga0496126_0019767 3300048929 Bacteria 6626
345 Ga0496126_0034019 3300048929 Bacteria 4791
346 Ga0501032_0001513 3300049569 Bacteria 18568
347 Ga0501032_0064113 3300049569 Bacteria 2460
348 Ga0501033_0083959 3300049570 Bacteria 2334
349 Ga0501033_0341858 3300049570 Bacteria 1049
350 Ga0501034_0006503 3300049571 Bacteria 12569
351 Ga0501034_0141072 3300049571 Bacteria 2389
352 Ga0501036_0031945 3300049572 Bacteria 4448
353 Ga0501036_0036001 3300049572 Bacteria 4188
354 Ga0501037_0002187 3300049573 Bacteria 14141
355 Ga0501038_0014059 3300049574 Bacteria 7293
356 Ga0501038_0107428 3300049574 Bacteria 2315
357 Ga0501039_0024456 3300049575 Bacteria 4639
358 Ga0501039_0106834 3300049575 Bacteria 2186
359 Ga0501040_0000659 3300049576 Bacteria 21283
360 Ga0501041_0000871 3300049577 Bacteria 16281
361 Ga0501042_0002939 3300049578 Bacteria 10578
362 Ga0501043_0001034 3300049579 Bacteria 24438
363 Ga0501046_0008703 3300049580 Bacteria 8821
364 Ga0501047_0023993 3300049581 Bacteria 5857
365 Ga0501047_0249438 3300049581 Bacteria 1624
366 Ga0501048_0017273 3300049582 Bacteria 5316
367 Ga0501067_0001819 3300049583 Bacteria 11727
368 Ga0501068_0001102 3300049584 Bacteria 14311
369 Ga0501068_0028647 3300049584 Bacteria 3295
370 Ga0501069_0016416 3300049585 Bacteria 3978
371 Ga0501070_0050403 3300049586 Bacteria 3456
372 Ga0501071_0004943 3300049587 Bacteria 8513
373 Ga0501072_0004427 3300049588 Bacteria 10675
374 Ga0501073_0018494 3300049589 Bacteria 5038
375 Ga0501073_0204681 3300049589 Bacteria 1364
376 Ga0501073_0273259 3300049589 Bacteria 1166
377 Ga0501075_0064048 3300049591 Bacteria 2772
378 Ga0501076_0144821 3300049592 Bacteria 1931
379 Ga0501077_0004921 3300049593 Bacteria 8110
380 Ga0501079_0002195 3300049741 Bacteria 14074
381 Ga0501081_0002623 3300049743 Bacteria 11367
382 Ga0501083_0075730 3300049744 Bacteria 2234
383 Ga0501083_0117827 3300049744 Bacteria 1742
384 Ga0501035_0002825 3300049822 Bacteria 16793
385 Ga0501044_0023738 3300049823 Bacteria 6522
386 Ga0501045_0004286 3300049824 Bacteria 9836
387 nmdc:mga03n38_34147_c1 3300050490 Bacteria 2170
388 nmdc:mga03n38_5754_c1 3300050490 Bacteria 4251
389 nmdc:mga00v17_5979_c1 3300050491 Bacteria 6438
390 nmdc:mga07m45_2984_c1 3300050496 Bacteria 8056
391 nmdc:mga07m45_342_c1 3300050496 Bacteria 18938
392 nmdc:mga05p37_22501_c1 3300050507 Bacteria 7643
393 nmdc:mga08y16_31849_c1 3300050511 Bacteria 5544
394 nmdc:mga0sz30_1522_c1 3300050516 Bacteria 8256
395 Ga0495619_0075902 3300053085 Bacteria 2256
396 Ga0500643_000866 3300053087 Bacteria 19257
397 Ga0500652_001982 3300053131 Bacteria 6167
398 Ga0501084_0057142 3300054114 Bacteria 3265
399 Ga0501082_0001476 3300060353 Bacteria 20662
400 Ga0466962_0026574 3300061719 Bacteria 2778
401 Ga0530510_0003205 3300061734 Bacteria 11233
402 2644487431 2643221687 Bacteria 6500351
403 2644639029 2643221715 Bacteria 6671032
404 2738887854 2738541308 Bacteria 7020677
405 2902794343 2902792274 Bacteria 7270173
406 2902813137 2902810491 Bacteria 6794147
407 2902839527 2902837492 Bacteria 6697721
408 2929213069 2929212328 Bacteria 7708288
409 2939587169 2939582691 Bacteria 7088898
410 2941481576
411 Ga0055540_1003841
412 JGI24746J21847_1005007
413 JGI24744J21845_10004889
414 JGI24742J22300_10004258
415 JGI24751J29686_10010359
416 Ga0055540_1005631
417 Ga0055540_1011075
418 Ga0070690_100059621
419 Ga0068869_100018601
420 Ga0070666_10026541
421 Ga0070682_100027560
422 Ga0068868_100010607
423 Ga0068868_100178778
424 Ga0070689_100180841
425 Ga0070691_10003034
426 Ga0070692_10059379
427 Ga0070668_100000585
428 Ga0070668_100112763
429 Ga0070669_100002323
430 Ga0070675_100040300
431 Ga0070671_100047874
432 Ga0070671_100188882
433 Ga0070674_100001716
434 Ga0070674_100082467
435 Ga0070659_100050341
436 Ga0070667_100000029
437 Ga0070667_100005238
438 Ga0070667_100178452
439 Ga0070667_100205058
440 Ga0070667_100254224
441 Ga0070709_10046440
442 Ga0070710_10013570
443 Ga0070711_100003121
444 Ga0070711_100010780
445 Ga0070705_100020076
446 Ga0070700_100004903
447 Ga0070678_100005558
448 Ga0070662_100013581
449 Ga0068867_100012976
450 Ga0068867_100042100
451 Ga0070706_100166332
452 Ga0070697_100011789
453 Ga0068853_100035716
454 Ga0068853_100093071
455 Ga0068853_100204394
456 Ga0070686_100028141
457 Ga0070695_100142783
458 Ga0070696_100011502
459 Ga0070696_100196783
460 Ga0070693_100023041
461 Ga0070665_100033272
462 Ga0070665_100169184
463 Ga0070665_100402926
464 Ga0070704_100001371
465 Ga0070704_100080104
466 Ga0068854_100025503
467 Ga0070702_100083673
468 Ga0068852_100155902
469 Ga0068852_100264464
470 Ga0068859_100006279
471 Ga0068859_100013060
472 Ga0068859_100234528
473 Ga0068866_10003004
474 Ga0068861_100003079
475 Ga0068861_100183760
476 Ga0068861_100352092
477 Ga0068863_100000120
478 Ga0068863_100057302
479 Ga0068858_100000958
480 Ga0068858_100049174
481 Ga0068860_100000088
482 Ga0068860_100001364
483 Ga0068862_100000056
484 Ga0068862_100006606
485 Ga0068862_100024261
486 Ga0068862_100042651
487 Ga0081455_10073617
488 Ga0075365_10089332
489 Ga0075365_10111069
490 Ga0075363_100003433
491 Ga0075363_100004810
492 Ga0075363_100008087
493 Ga0075363_100008182
494 Ga0075364_10003733
495 Ga0075364_10010374
496 Ga0075364_10017095
497 Ga0075364_10021451
498 Ga0070715_10002461
499 Ga0070716_100029624
500 Ga0070712_100005399
501 Ga0070712_100040423
502 Ga0075367_10006248
503 Ga0075369_10000916
504 Ga0075369_10006147
505 Ga0075369_10047628
506 Ga0097621_100164899
507 Ga0075370_10069059
508 Ga0075370_10078484
509 Ga0075428_100030455
510 Ga0068865_100001029
511 Ga0097620_100006279
512 Ga0097620_100013058
513 Ga0097620_100234513
514 Ga0099795_10007187
515 Ga0111539_10067506
516 Ga0105245_10001511
517 Ga0105245_10105505
518 Ga0105245_10297685
519 Ga0105247_10000008
520 Ga0105247_10002878
521 Ga0105247_10014525
522 Ga0114129_10022864
523 Ga0105243_10003449
524 Ga0105241_10095328
525 Ga0105242_10003348
526 Ga0105248_10000051
527 Ga0105248_10013467
528 Ga0105248_10500749
529 Ga0105237_10001908
530 Ga0105238_10230569
531 Ga0105238_10357313
532 Ga0105249_10000040
533 Ga0105249_10003250
534 Ga0105249_10114771
535 Ga0105239_10005473
536 Ga0105239_10158079
537 Ga0105239_10337417
538 Ga0105246_10014540
539 Ga0157369_10220610
540 Ga0157374_10017922
541 Ga0157378_10001284
542 Ga0157378_10032780
543 Ga0163162_10011149
544 Ga0163162_10059985
545 Ga0157372_10033235
546 Ga0157375_10001859
547 Ga0157375_10136352
548 Ga0163163_10053218
549 Ga0163163_10072588
550 Ga0163163_10131830
551 Ga0157380_10013711
552 Ga0157380_10067380
553 Ga0157377_10004729
554 Ga0157379_10047546
555 Ga0157379_10119844
556 Ga0157379_10127991
557 Ga0157376_10109680
558 Ga0163161_10003622
559 Ga0213872_10012675
560 Ga0213876_10000666
561 Ga0209673_1010905
562 Ga0209051_1001438
563 Ga0209051_1004735
564 Ga0209051_1006508
565 Ga0207692_10026786
566 Ga0207642_10000442
567 Ga0207710_10000006
568 Ga0207710_10014357
569 Ga0207710_10028418
570 Ga0207688_10003969
571 Ga0207688_10033578
572 Ga0207699_10067921
573 Ga0207671_10019348
574 Ga0207693_10000832
575 Ga0207693_10005372
576 Ga0207663_10014848
577 Ga0207681_10002196
578 Ga0207681_10062368
579 Ga0207650_10109561
580 Ga0207659_10013377
581 Ga0207659_10136734
582 Ga0207687_10003776
583 Ga0207644_10021322
584 Ga0207644_10075719
585 Ga0207690_10028400
586 Ga0207706_10021949
587 Ga0207706_10033121
588 Ga0207686_10003707
589 Ga0207709_10010153
590 Ga0207670_10040696
591 Ga0207669_10004121
592 Ga0207704_10003125
593 Ga0207665_10037676
594 Ga0207691_10136285
595 Ga0207711_10000095
596 Ga0207689_10029755
597 Ga0207712_10000017
598 Ga0207712_10010028
599 Ga0207668_10000524
600 Ga0207668_10033161
601 Ga0207668_10119088
602 Ga0207640_10010763
603 Ga0207658_10000016
604 Ga0207658_10004038
605 Ga0207658_10078917
606 Ga0207677_10029247
607 Ga0207677_10047958
608 Ga0207703_10037146
609 Ga0207639_10026730
610 Ga0207678_10041272
611 Ga0207678_10050247
612 Ga0207678_10266322
613 Ga0207708_10003727
614 Ga0207641_10000670
615 Ga0207648_10007897
616 Ga0207648_10016627
617 Ga0207675_100004096
618 Ga0207675_100150579
619 Ga0207683_10004692
620 Ga0268266_10009733
621 Ga0268266_10032646
622 Ga0268265_10000068
623 Ga0268264_10000056
624 Ga0268264_10035585
625 Ga0265318_10000106
626 Ga0265330_10000077
627 Ga0265332_10000171
628 Ga0265332_10037342
629 Ga0265328_10014635
630 Ga0265320_10000074
631 Ga0265325_10031910
632 Ga0265329_10001701
633 Ga0265339_10013036
634 Ga0265339_10082249
635 Ga0265331_10000136
636 Ga0265331_10009067
637 Ga0265316_10003260
638 Ga0265313_10000238
639 Ga0265314_10000229
640 Ga0265342_10003850
641 Ga0307409_100081665
642 Ga0373943_0007347
643 Ga0373962_0030668
644 Ga0373931_0051013
645 Ga0373933_0224097
646 Ga0373937_0158915
647 Ga0436364_0053786
648 Ga0436364_0548436
649 Ga0436365_0882949
650 Ga0436365_1597372
651 Ga0436361_0323995
652 Ga0436363_0136645
653 Ga0436363_0779739
654 Ga0439466_0026419
655 Ga0439466_0041216
656 Ga0439465_0003322
657 Ga0439431_0004471
658 Ga0439431_0006318
659 Ga0439434_0002658
660 Ga0439435_0017888
661 Ga0466969_0025064
662 Ga0466972_0022977
663 Ga0466966_0014578
664 Ga0466961_0002580
665 Ga0466961_0019352
666 Ga0466968_0036964
667 Ga0466970_0024154
668 Ga0466970_0057554
669 Ga0466957_0003566
670 Ga0466957_0220212
671 Ga0466960_0000043
672 Ga0466959_0004891
673 Ga0466958_0073016
674 Ga0466967_0061833
675 Ga0466967_0119321
676 Ga0466967_0221998
677 Ga0495629_0033843
678 Ga0495641_0019964
679 Ga0495582_0120930
680 Ga0495583_0037695
681 Ga0495606_0022740
682 Ga0495648_0002641
683 Ga0495665_0033879
684 Ga0495640_0027082
685 Ga0495668_0029704
686 Ga0495611_0007934
687 Ga0495581_0049843
688 Ga0495674_0013653
689 Ga0495672_0003103
690 Ga0495672_0095516
691 Ga0495673_0002306
692 Ga0495686_0010564
693 Ga0496100_0022868
694 Ga0496100_0024333
695 Ga0496101_0000115
696 Ga0496101_0003368
697 Ga0496101_0132623
698 Ga0496102_0000009
699 Ga0496102_0001200
700 Ga0496102_0004129
701 Ga0496102_0037886
702 Ga0496102_0048329
703 Ga0496102_0162257
704 Ga0496103_0000051
705 Ga0496103_0000288
706 Ga0496103_0001276
707 Ga0496103_0057198
708 Ga0496104_0016197
709 Ga0496104_0038782
710 Ga0496105_0083227
711 Ga0496105_0128995
712 Ga0496106_0004948
713 Ga0496106_0008777
714 Ga0496106_0138579
715 Ga0496107_0002511
716 Ga0496107_0005201
717 Ga0496107_0034401
718 Ga0496107_0094259
719 Ga0496108_0003040
720 Ga0496108_0036415
721 Ga0496108_0079812
722 Ga0496109_0018148
723 Ga0496112_0021619
724 Ga0496112_0024843
725 Ga0496112_0052094
726 Ga0496112_0238313
727 Ga0496113_0124794
728 Ga0496114_0021313
729 Ga0496114_0213681
730 Ga0496114_0444346
731 Ga0496115_0041268
732 Ga0496116_0000141
733 Ga0496116_0007303
734 Ga0496116_0066232
735 Ga0496117_0000019
736 Ga0496117_0000631
737 Ga0496117_0038056
738 Ga0496118_0000020
739 Ga0496118_0003202
740 Ga0496118_0003681
741 Ga0496119_0003857
742 Ga0496120_0005805
743 Ga0496120_0024763
744 Ga0496121_0000159
745 Ga0496121_0000510
746 Ga0496121_0002244
747 Ga0496122_0024116
748 Ga0496123_0027439
749 Ga0496124_0060944
750 Ga0496124_0125680
751 Ga0496125_0000005
752 Ga0496126_0006902
753 Ga0496126_0015142
754 Ga0496126_0019767
755 Ga0496126_0034019
756 Ga0501032_0001513
757 Ga0501032_0064113
758 Ga0501033_0083959
759 Ga0501033_0341858
760 Ga0501034_0006503
761 Ga0501034_0141072
762 Ga0501036_0031945
763 Ga0501036_0036001
764 Ga0501037_0002187
765 Ga0501038_0014059
766 Ga0501038_0107428
767 Ga0501039_0024456
768 Ga0501039_0106834
769 Ga0501040_0000659
770 Ga0501041_0000871
771 Ga0501042_0002939
772 Ga0501043_0001034
773 Ga0501046_0008703
774 Ga0501047_0023993
775 Ga0501047_0249438
776 Ga0501048_0017273
777 Ga0501067_0001819
778 Ga0501068_0001102
779 Ga0501068_0028647
780 Ga0501069_0016416
781 Ga0501070_0050403
782 Ga0501071_0004943
783 Ga0501072_0004427
784 Ga0501073_0018494
785 Ga0501073_0204681
786 Ga0501073_0273259
787 Ga0501075_0064048
788 Ga0501076_0144821
789 Ga0501077_0004921
790 Ga0501079_0002195
791 Ga0501081_0002623
792 Ga0501083_0075730
793 Ga0501083_0117827
794 Ga0501035_0002825
795 Ga0501044_0023738
796 Ga0501045_0004286
797 nmdc:mga03n38_34147_c1
798 nmdc:mga03n38_5754_c1
799 nmdc:mga00v17_5979_c1
800 nmdc:mga07m45_2984_c1
801 nmdc:mga07m45_342_c1
802 nmdc:mga05p37_22501_c1
803 nmdc:mga08y16_31849_c1
804 nmdc:mga0sz30_1522_c1
805 Ga0495619_0075902
806 Ga0500643_000866
807 Ga0500652_001982
808 Ga0501084_0057142
809 Ga0501082_0001476
810 Ga0466962_0026574
811 Ga0530510_0003205
812 2644487431
813 2644639029
814 2738887854
815 2902794343
816 2902813137
817 2902839527
818 2929213069
819 2939587169
820 2941481576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

3

125

0.92

PF00296

Bac_luciferase

Luciferase-like monooxygenase

165

346

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.8558 3 372
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.8407 3 372
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.8385 3 372
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.8328 3 372
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.8308 3 372
ID Description Score Start End Superfamily
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9046 2 368 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8939 2 368 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8884 1 370 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8858 1 370 3.20.20.30
af_Q2G151_1_332_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8547 3 368 3.20.20.30
ID Description Score Start End GO Terms
AF-X8AXJ0-F1-model_v4 deleted 0.9925 222 373
AF-H0JTF8-F1-model_v4 Luciferase-like monooxygenase 0.9919 261 373 GO:0016705
AF-A0A1V3WS52-F1-model_v4 Luciferase-like monooxygenase family protein 0.9855 140 372 GO:0004497
GO:0005829
GO:0016705
AF-A0A495NM38-F1-model_v4 deleted 0.9774 236 373
AF-A0A1V3WS52-F1-model_v4 Luciferase-like monooxygenase family protein 0.9772 140 372 GO:0004497
GO:0005829
GO:0016705

Map