F437100

General Info

Members Datasets Scaffolds Average Seq Length
409 182 408 251

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0004366|Ga0501040_0004366_2461_3309
Length 282
Sequence MLRQRSAGCQQAAPERRRLDGRPVTWQNSPSMASGLIVSIHSFRGGTGKSNTTANLAALLAAEGRRVGAIDTDIQSPGLHVLFGLDESRMTHSLNDYLWGKCAIEETAHDVTPRPEGAGRVLLIPSSLKAGEIARVLREGYDVSMLNDGFRRLIDALRLDVLMIDTHPGLNEETLLSIAVSQVLVVLLRPDHQDYQGTGVAVEVARKLDVPRLLLLVNKVPPLFDAADVRSRVETAYRAEVAAVLPHSDEMMALGSEGLFVLRYPDHPVTAALKQVAAKLVA

Samples

Sample ID Description Type Environment
1 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
103 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
116 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
117 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
122 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
123 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
124 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
125 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
126 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
127 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
130 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
131 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
169 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.22
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 3.18
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10024603 3300003322 Bacteria 4116
2 rootH1_10052350 3300003323 Bacteria 6467
3 JGI25407J50210_10001245 3300003373 Bacteria 5689
4 JGI25407J50210_10045589 3300003373 Bacteria 1117
5 Ga0058862_12772021 3300004803 Unclassified 1296
6 Ga0065712_10161402 3300005290 Bacteria 1295
7 Ga0065707_10118900 3300005295 Bacteria 2174
8 Ga0070687_100379748 3300005343 Unclassified 920
9 Ga0070668_100237314 3300005347 Bacteria 1509
10 Ga0070675_100117599 3300005354 Unclassified 2256
11 Ga0070675_100762700 3300005354 Bacteria 883
12 Ga0070671_100294986 3300005355 Bacteria 1380
13 Ga0070688_100324021 3300005365 Bacteria 1120
14 Ga0070713_100393738 3300005436 Bacteria 1293
15 Ga0070713_100600418 3300005436 Bacteria 1046
16 Ga0070705_100032327 3300005440 Bacteria 2906
17 Ga0070694_100641584 3300005444 Bacteria 859
18 Ga0070708_100017898 3300005445 Bacteria 5922
19 Ga0070708_100053596 3300005445 Bacteria 3579
20 Ga0070708_100109945 3300005445 Bacteria 2532
21 Ga0070708_100204794 3300005445 Bacteria 1848
22 Ga0070708_100317533 3300005445 Unclassified 1467
23 Ga0070708_100395328 3300005445 Bacteria 1303
24 Ga0070663_100238318 3300005455 Unclassified 1435
25 Ga0070706_100012872 3300005467 Bacteria 7743
26 Ga0070706_100016713 3300005467 Bacteria 6777
27 Ga0070706_100021246 3300005467 Bacteria 5979
28 Ga0070706_100041921 3300005467 Bacteria 4227
29 Ga0070706_100068581 3300005467 Bacteria 3279
30 Ga0070706_100095436 3300005467 Bacteria 2760
31 Ga0070706_100256809 3300005467 Bacteria 1631
32 Ga0070706_100754034 3300005467 Bacteria 902
33 Ga0070707_100025599 3300005468 Bacteria 5599
34 Ga0070707_100155575 3300005468 Bacteria 2227
35 Ga0070707_100157658 3300005468 Bacteria 2211
36 Ga0070707_100393246 3300005468 Bacteria 1346
37 Ga0070707_100487209 3300005468 Bacteria 1194
38 Ga0070698_100003911 3300005471 Bacteria 16380
39 Ga0070698_100006593 3300005471 Bacteria 12588
40 Ga0070698_100019423 3300005471 Bacteria 7134
41 Ga0070698_100080876 3300005471 Bacteria 3244
42 Ga0070698_100133947 3300005471 Bacteria 2432
43 Ga0070698_100221096 3300005471 Bacteria 1827
44 Ga0070698_100325712 3300005471 Bacteria 1467
45 Ga0070698_100483425 3300005471 Bacteria 1175
46 Ga0070698_100548731 3300005471 Unclassified 1095
47 Ga0070699_100010266 3300005518 Bacteria 8099
48 Ga0070699_100026187 3300005518 Bacteria 5031
49 Ga0070699_100074095 3300005518 Bacteria 2962
50 Ga0070699_100258679 3300005518 Bacteria 1556
51 Ga0070699_100310600 3300005518 Bacteria 1415
52 Ga0070697_100005436 3300005536 Bacteria 9820
53 Ga0070697_100014853 3300005536 Bacteria 6111
54 Ga0070697_100096492 3300005536 Bacteria 2452
55 Ga0070697_100275039 3300005536 Unclassified 1444
56 Ga0070697_100348994 3300005536 Bacteria 1278
57 Ga0070672_100724182 3300005543 Unclassified 872
58 Ga0070686_100255758 3300005544 Unclassified 1281
59 Ga0070696_100066538 3300005546 Bacteria 2527
60 Ga0070696_100169568 3300005546 Unclassified 1613
61 Ga0070704_100369491 3300005549 Bacteria 1216
62 Ga0068857_100106717 3300005577 Unclassified 2515
63 Ga0068859_100215531 3300005617 Bacteria 2007
64 Ga0068864_100467150 3300005618 Bacteria 1209
65 Ga0068861_100181990 3300005719 Unclassified 1750
66 Ga0068858_100230222 3300005842 Bacteria 1757
67 Ga0068860_100757107 3300005843 Bacteria 983
68 Ga0081455_10157863 3300005937 Unclassified 1741
69 Ga0081455_10253925 3300005937 Bacteria 1284
70 Ga0081538_10006117 3300005981 Bacteria 10689
71 Ga0081538_10007176 3300005981 Bacteria 9675
72 Ga0081538_10008332 3300005981 Bacteria 8824
73 Ga0081538_10009682 3300005981 Bacteria 8001
74 Ga0081538_10129872 3300005981 Bacteria 1187
75 Ga0081539_10011020 3300005985 Bacteria 7232
76 Ga0070716_100225149 3300006173 Unclassified 1262
77 Ga0070712_100134590 3300006175 Bacteria 1877
78 Ga0070712_100566848 3300006175 Unclassified 958
79 Ga0075367_10086004 3300006178 Bacteria 1908
80 Ga0075428_100001696 3300006844 Bacteria 23508
81 Ga0075428_100012618 3300006844 Bacteria 9395
82 Ga0075428_100017493 3300006844 Bacteria 7920
83 Ga0075428_100102386 3300006844 Bacteria 3122
84 Ga0075431_100002350 3300006847 Bacteria 18166
85 Ga0075431_100022967 3300006847 Bacteria 6375
86 Ga0075431_100138680 3300006847 Bacteria 2507
87 Ga0075433_10003629 3300006852 Bacteria 11924
88 Ga0075433_10135526 3300006852 Bacteria 2189
89 Ga0075434_100214360 3300006871 Bacteria 1945
90 Ga0075429_100005939 3300006880 Bacteria 10537
91 Ga0075429_100725873 3300006880 Bacteria 870
92 Ga0068865_100298372 3300006881 Unclassified 1289
93 Ga0075436_100092668 3300006914 Unclassified 2101
94 Ga0075436_100157049 3300006914 Bacteria 1602
95 Ga0075436_100217465 3300006914 Bacteria 1355
96 Ga0097620_100215522 3300006931 Bacteria 2007
97 Ga0075435_100155985 3300007076 Unclassified 1921
98 Ga0075435_100227090 3300007076 Bacteria 1586
99 Ga0075435_100356176 3300007076 Bacteria 1255
100 Ga0075435_100387008 3300007076 Bacteria 1202
101 Ga0111539_10103911 3300009094 Bacteria 3334
102 Ga0111539_10385093 3300009094 Bacteria 1633
103 Ga0114129_10003387 3300009147 Bacteria 22400
104 Ga0114129_10008672 3300009147 Bacteria 14490
105 Ga0114129_10011403 3300009147 Bacteria 12661
106 Ga0114129_10045810 3300009147 Bacteria 6147
107 Ga0114129_10069160 3300009147 Bacteria 4922
108 Ga0114129_10069884 3300009147 Bacteria 4896
109 Ga0114129_10097628 3300009147 Bacteria 4067
110 Ga0114129_10117655 3300009147 Bacteria 3661
111 Ga0114129_10130496 3300009147 Bacteria 3452
112 Ga0114129_10574842 3300009147 Bacteria 1463
113 Ga0114129_10620605 3300009147 Bacteria 1398
114 Ga0114129_10635000 3300009147 Bacteria 1380
115 Ga0114129_10947909 3300009147 Unclassified 1087
116 Ga0105237_10010359 3300009545 Bacteria 9928
117 Ga0105249_10068168 3300009553 Bacteria 3280
118 Ga0105246_10057544 3300011119 Unclassified 2690
119 Ga0105246_10726555 3300011119 Bacteria 873
120 Ga0157374_10829963 3300013296 Bacteria 941
121 Ga0163162_10005236 3300013306 Bacteria 12505
122 Ga0157375_10134022 3300013308 Bacteria 2599
123 Ga0157375_10181716 3300013308 Bacteria 2255
124 Ga0157375_10864955 3300013308 Bacteria 1050
125 Ga0163163_10119534 3300014325 Bacteria 2668
126 Ga0157379_10079851 3300014968 Bacteria 2930
127 Ga0157379_10251501 3300014968 Bacteria 1604
128 Ga0157379_10311565 3300014968 Bacteria 1436
129 Ga0206356_10255224 3300020070 Bacteria 2224
130 Ga0206352_10613749 3300020078 Unclassified 913
131 Ga0207684_10004847 3300025910 Bacteria 12589
132 Ga0207684_10017318 3300025910 Bacteria 6181
133 Ga0207684_10024378 3300025910 Bacteria 5159
134 Ga0207684_10049728 3300025910 Bacteria 3556
135 Ga0207684_10060614 3300025910 Bacteria 3214
136 Ga0207684_10066549 3300025910 Bacteria 3060
137 Ga0207684_10116108 3300025910 Bacteria 2293
138 Ga0207684_10153728 3300025910 Unclassified 1980
139 Ga0207684_10300585 3300025910 Bacteria 1384
140 Ga0207684_10322121 3300025910 Unclassified 1332
141 Ga0207684_10421910 3300025910 Bacteria 1146
142 Ga0207693_10117919 3300025915 Bacteria 2084
143 Ga0207646_10018382 3300025922 Bacteria 6521
144 Ga0207646_10033633 3300025922 Bacteria 4635
145 Ga0207646_10118853 3300025922 Bacteria 2374
146 Ga0207670_10350127 3300025936 Bacteria 1169
147 Ga0207704_10369742 3300025938 Unclassified 1122
148 Ga0207665_10100896 3300025939 Unclassified 2015
149 Ga0207712_10012794 3300025961 Bacteria 5366
150 Ga0207703_10110411 3300026035 Bacteria 2346
151 Ga0207708_10364549 3300026075 Unclassified 1188
152 Ga0207675_100130651 3300026118 Unclassified 2381
153 Ga0207675_100133859 3300026118 Bacteria 2351
154 Ga0207675_100373537 3300026118 Bacteria 1401
155 Ga0207428_10102644 3300027907 Bacteria 2208
156 Ga0268265_10023488 3300028380 Bacteria 4347
157 Ga0268264_10620085 3300028381 Bacteria 1068
158 Ga0265337_1005588 3300028556 Bacteria 4970
159 Ga0265326_10036190 3300028558 Bacteria 1404
160 Ga0265319_1002920 3300028563 Bacteria 9116
161 Ga0265334_10007698 3300028573 Bacteria 4614
162 Ga0265318_10003236 3300028577 Bacteria 8302
163 Ga0265338_10035504 3300028800 Bacteria 4790
164 Ga0265324_10000862 3300029957 Bacteria 19517
165 Ga0265332_10048698 3300031238 Bacteria 1822
166 Ga0265320_10007845 3300031240 Bacteria 6591
167 Ga0265320_10205828 3300031240 Bacteria 878
168 Ga0265325_10005559 3300031241 Bacteria 7778
169 Ga0265329_10077574 3300031242 Bacteria 1052
170 Ga0265340_10014113 3300031247 Bacteria 4182
171 Ga0265331_10017664 3300031250 Bacteria 3714
172 Ga0265313_10014515 3300031595 Bacteria 4649
173 Ga0316575_10045005 3300031665 Bacteria 1752
174 Ga0316579_10003682 3300031691 Bacteria 6030
175 Ga0316579_10078146 3300031691 Unclassified 1573
176 Ga0316579_10135998 3300031691 Unclassified 1184
177 Ga0316579_10148113 3300031691 Bacteria 1132
178 Ga0265314_10006671 3300031711 Bacteria 10144
179 Ga0316576_10031945 3300031727 Bacteria 3740
180 Ga0316576_10074948 3300031727 Bacteria 2503
181 Ga0316576_10078493 3300031727 Bacteria 2446
182 Ga0316576_10163760 3300031727 Bacteria 1678
183 Ga0316576_10281536 3300031727 Bacteria 1245
184 Ga0316578_10076721 3300031728 Unclassified 1984
185 Ga0316578_10204380 3300031728 Bacteria 1189
186 Ga0316578_10309485 3300031728 Bacteria 944
187 Ga0307405_10383560 3300031731 Bacteria 1095
188 Ga0316577_10007480 3300031733 Bacteria 5829
189 Ga0316577_10010150 3300031733 Bacteria 5077
190 Ga0316577_10024814 3300031733 Unclassified 3334
191 Ga0316577_10028947 3300031733 Unclassified 3092
192 Ga0316577_10054663 3300031733 Unclassified 2228
193 Ga0316577_10178605 3300031733 Unclassified 1199
194 Ga0316577_10182641 3300031733 Unclassified 1185
195 Ga0307413_10188473 3300031824 Unclassified 1478
196 Ga0307410_10036236 3300031852 Bacteria 3210
197 Ga0307407_10040666 3300031903 Bacteria 2594
198 Ga0307412_10191260 3300031911 Bacteria 1547
199 Ga0307409_100761851 3300031995 Bacteria 972
200 Ga0307416_100190665 3300032002 Bacteria 1933
201 Ga0307411_10182672 3300032005 Bacteria 1593
202 Ga0307415_100232039 3300032126 Bacteria 1487
203 Ga0316585_10008775 3300032137 Bacteria 2935
204 Ga0316586_1024533 3300033527 Bacteria 1012
205 Ga0316574_0000466 3300035398 Bacteria 16350
206 Ga0316574_0011951 3300035398 Unclassified 4952
207 Ga0316574_0064176 3300035398 Bacteria 2310
208 Ga0316574_0090708 3300035398 Bacteria 1948
209 Ga0373931_0086615 3300035691 Unclassified 1738
210 Ga0316582_0008099 3300036647 Bacteria 5627
211 Ga0316582_0010131 3300036647 Bacteria 5149
212 Ga0316582_0085320 3300036647 Bacteria 2069
213 Ga0316582_0087421 3300036647 Unclassified 2046
214 Ga0316582_0145481 3300036647 Bacteria 1600
215 Ga0316582_0189108 3300036647 Unclassified 1402
216 Ga0316582_0297336 3300036647 Unclassified 1109
217 Ga0316584_0028506 3300036712 Unclassified 4119
218 Ga0316584_0038646 3300036712 Bacteria 3551
219 Ga0316584_0044885 3300036712 Unclassified 3297
220 Ga0316584_0060763 3300036712 Bacteria 2830
221 Ga0316584_0082628 3300036712 Unclassified 2406
222 Ga0316584_0096730 3300036712 Bacteria 2210
223 Ga0316584_0239007 3300036712 Bacteria 1330
224 Ga0316584_0272663 3300036712 Unclassified 1231
225 Ga0316584_0286999 3300036712 Bacteria 1194
226 Ga0395899_0007026 3300037312 Bacteria 8710
227 Ga0395899_0010630 3300037312 Bacteria 7053
228 Ga0395899_0058280 3300037312 Bacteria 2849
229 Ga0395900_0002330 3300037418 Bacteria 21015
230 Ga0395900_0011390 3300037418 Bacteria 9101
231 Ga0395900_0026603 3300037418 Bacteria 5923
232 Ga0395900_0117452 3300037418 Bacteria 2729
233 Ga0395898_0005121 3300037466 Bacteria 14200
234 Ga0395898_0015908 3300037466 Bacteria 7709
235 Ga0395898_0062491 3300037466 Bacteria 3616
236 Ga0395898_0362327 3300037466 Bacteria 1382
237 Ga0395898_0414093 3300037466 Unclassified 1285
238 Ga0395898_0459228 3300037466 Bacteria 1213
239 Ga0395905_0005901 3300037471 Bacteria 12423
240 Ga0395905_0007391 3300037471 Bacteria 10923
241 Ga0395905_0069582 3300037471 Unclassified 3297
242 Ga0316581_0017313 3300037588 Bacteria 2079
243 Ga0316581_0024724 3300037588 Unclassified 1783
244 Ga0316581_0036659 3300037588 Bacteria 1488
245 Ga0436364_0319394 3300037853 Bacteria 2207
246 Ga0395901_0008287 3300038443 Bacteria 10502
247 Ga0395901_0011603 3300038443 Bacteria 8927
248 Ga0395901_0014028 3300038443 Bacteria 8154
249 Ga0395901_0029860 3300038443 Bacteria 5614
250 Ga0395901_0074579 3300038443 Bacteria 3539
251 Ga0395901_0194483 3300038443 Bacteria 2127
252 Ga0395901_0267464 3300038443 Bacteria 1779
253 Ga0395901_0619429 3300038443 Unclassified 1089
254 Ga0242422_04265 3300038699 Unclassified 904
255 Ga0400489_10700 3300039093 Bacteria 10380
256 Ga0400489_30680 3300039093 Unclassified 2974
257 Ga0400487_63449 3300039110 Bacteria 1240
258 Ga0436360_0261807 3300039438 Bacteria 2043
259 Ga0436360_0311355 3300039438 Unclassified 1161
260 Ga0439443_000811 3300042003 Bacteria 3111
261 Ga0439448_0001975 3300042005 Bacteria 5482
262 Ga0439450_000917 3300042008 Bacteria 4090
263 Ga0439454_010080 3300042011 Bacteria 1239
264 Ga0439455_0005191 3300042012 Bacteria 2629
265 Ga0439456_001980 3300042013 Bacteria 4126
266 Ga0439463_001353 3300042016 Bacteria 6531
267 Ga0450900_005477 3300042136 Bacteria 1501
268 Ga0450902_001605 3300042137 Bacteria 3110
269 Ga0439458_0002103 3300042157 Bacteria 4941
270 Ga0439435_0024920 3300042436 Bacteria 1582
271 Ga0439444_0001567 3300042437 Bacteria 3007
272 Ga0439460_0024295 3300042461 Bacteria 1677
273 Ga0451577_0006425 3300042876 Bacteria 11726
274 Ga0451577_0046204 3300042876 Bacteria 3896
275 Ga0451577_0078459 3300042876 Unclassified 2944
276 Ga0451577_0096816 3300042876 Bacteria 2635
277 Ga0451577_0163584 3300042876 Bacteria 2005
278 Ga0451577_0241129 3300042876 Bacteria 1636
279 Ga0451577_0340937 3300042876 Bacteria 1359
280 Ga0439440_0005710 3300042993 Bacteria 2476
281 Ga0466972_0003336 3300044658 Bacteria 7962
282 Ga0453683_0005842 3300044673 Bacteria 8518
283 Ga0453683_0018399 3300044673 Viruses 4486
284 Ga0453683_0023542 3300044673 Bacteria 3924
285 Ga0453683_0025795 3300044673 Bacteria 3731
286 Ga0466965_0000476 3300044683 Bacteria 14178
287 Ga0466963_0177174 3300044694 Unclassified 1488
288 Ga0453684_0000003 3300044712 Bacteria 1481694
289 Ga0453684_0000074 3300044712 Bacteria 438364
290 Ga0453684_0000106 3300044712 Bacteria 364365
291 Ga0453684_0000599 3300044712 Bacteria 133150
292 Ga0453684_0000933 3300044712 Bacteria 96683
293 Ga0453684_0000958 3300044712 Bacteria 94987
294 Ga0453684_0001419 3300044712 Bacteria 68999
295 Ga0453684_0002081 3300044712 Bacteria 50801
296 Ga0453684_0003342 3300044712 Bacteria 36400
297 Ga0453684_0004013 3300044712 Bacteria 32067
298 Ga0453684_0004448 3300044712 Bacteria 29576
299 Ga0453684_0006288 3300044712 Bacteria 22720
300 Ga0453684_0010070 3300044712 Bacteria 16248
301 Ga0453684_0013691 3300044712 Bacteria 13141
302 Ga0453684_0015503 3300044712 Bacteria 12042
303 Ga0453684_0015883 3300044712 Bacteria 11838
304 Ga0453684_0019648 3300044712 Bacteria 10266
305 Ga0453684_0022466 3300044712 Bacteria 9353
306 Ga0453684_0074299 3300044712 Unclassified 4281
307 Ga0453684_0161845 3300044712 Bacteria 2646
308 Ga0453684_0170096 3300044712 Bacteria 2569
309 Ga0453684_0201276 3300044712 Bacteria 2321
310 Ga0453684_0206671 3300044712 Bacteria 2285
311 Ga0453684_0293389 3300044712 Viruses 1851
312 Ga0453684_0314426 3300044712 Bacteria 1776
313 Ga0453684_0347126 3300044712 Unclassified 1674
314 Ga0453684_0351231 3300044712 Unclassified 1663
315 Ga0453684_0378265 3300044712 Bacteria 1591
316 Ga0453684_0457061 3300044712 Bacteria 1420
317 Ga0453684_0496012 3300044712 Bacteria 1353
318 Ga0453684_0519820 3300044712 Bacteria 1315
319 Ga0453684_0559638 3300044712 Bacteria 1258
320 Ga0453684_0647490 3300044712 Unclassified 1153
321 Ga0453684_0662930 3300044712 Bacteria 1137
322 Ga0453684_0684118 3300044712 Unclassified 1116
323 Ga0453684_0723249 3300044712 Unclassified 1080
324 Ga0453684_0769179 3300044712 Unclassified 1041
325 Ga0453684_0779411 3300044712 Unclassified 1033
326 Ga0453684_0795561 3300044712 Bacteria 1020
327 Ga0466968_0001583 3300044735 Bacteria 8201
328 Ga0466968_0060632 3300044735 Bacteria 1631
329 Ga0466968_0230577 3300044735 Bacteria 875
330 Ga0466957_0019542 3300044842 Bacteria 3984
331 Ga0466957_0072393 3300044842 Unclassified 2134
332 Ga0466960_0000421 3300044901 Bacteria 14555
333 Ga0451576_0033104 3300045051 Bacteria 5495
334 Ga0451576_0033705 3300045051 Bacteria 5442
335 Ga0451576_0054863 3300045051 Bacteria 4171
336 Ga0451576_0108132 3300045051 Unclassified 2894
337 Ga0451576_0741824 3300045051 Bacteria 1031
338 Ga0466958_0021545 3300045836 Bacteria 3768
339 Ga0466958_0097947 3300045836 Bacteria 1820
340 Ga0466967_0038149 3300045976 Unclassified 4118
341 Ga0466967_0762091 3300045976 Bacteria 960
342 Ga0495653_0091546 3300046463 Bacteria 2223
343 Ga0495618_0576148 3300046514 Bacteria 672
344 Ga0495640_0086473 3300046533 Unclassified 2076
345 Ga0495684_0077556 3300047471 Bacteria 2522
346 Ga0496102_0152675 3300048905 Bacteria 2171
347 Ga0496104_0016403 3300048907 Bacteria 6728
348 Ga0496106_0077443 3300048909 Bacteria 2550
349 Ga0496107_0079735 3300048910 Bacteria 2387
350 Ga0496108_0106817 3300048911 Bacteria 2390
351 Ga0496110_0232973 3300048913 Bacteria 1675
352 Ga0496111_0026238 3300048914 Bacteria 4113
353 Ga0496112_0223994 3300048915 Bacteria 1836
354 Ga0496112_0234304 3300048915 Bacteria 1790
355 Ga0496112_0654526 3300048915 Bacteria 980
356 Ga0496113_0052557 3300048916 Unclassified 3044
357 Ga0496113_0321898 3300048916 Bacteria 1239
358 Ga0496114_0313141 3300048917 Bacteria 1386
359 Ga0501308_008109 3300049128 Bacteria 1117
360 Ga0501034_0220818 3300049571 Bacteria 1848
361 Ga0501040_0004366 3300049576 Bacteria 9191
362 Ga0501040_0180865 3300049576 Bacteria 1495
363 Ga0501042_0082622 3300049578 Bacteria 2303
364 Ga0501046_0416447 3300049580 Unclassified 969
365 Ga0501071_0341177 3300049587 Unclassified 1139
366 Ga0501075_0061287 3300049591 Bacteria 2835
367 Ga0501076_0308596 3300049592 Unclassified 1297
368 Ga0501077_0160386 3300049593 Bacteria 1428
369 Ga0501199_012933 3300049650 Bacteria 916
370 Ga0501233_069255 3300049668 Bacteria 891
371 Ga0501079_0473278 3300049741 Bacteria 984
372 nmdc:mga05p37_10800_c1 3300050507 Bacteria 10840
373 nmdc:mga05p37_1360812_c1 3300050507 Unclassified 718
374 nmdc:mga05p37_136090_c1 3300050507 Bacteria 3013
375 nmdc:mga05p37_14417_c1 3300050507 Bacteria 9488
376 nmdc:mga05p37_30473_c1 3300050507 Bacteria 6582
377 nmdc:mga05p37_337027_c1 3300050507 Bacteria 1779
378 nmdc:mga05p37_34068_c1 3300050507 Bacteria 6238
379 nmdc:mga05p37_348084_c1 3300050507 Bacteria 1745
380 nmdc:mga05p37_395043_c1 3300050507 Bacteria 1616
381 nmdc:mga05p37_428724_c1 3300050507 Unclassified 1537
382 nmdc:mga05p37_466497_c1 3300050507 Unclassified 1458
383 nmdc:mga05p37_483005_c1 3300050507 Bacteria 1426
384 nmdc:mga05p37_606137_c1 3300050507 Bacteria 1235
385 nmdc:mga05p37_77323_c1 3300050507 Bacteria 4097
386 nmdc:mga09592_13101_c1 3300050508 Bacteria 6767
387 nmdc:mga09592_20811_c1 3300050508 Bacteria 5399
388 nmdc:mga09592_635977_c1 3300050508 Bacteria 912
389 nmdc:mga06r32_123701_c1 3300050510 Bacteria 2553
390 nmdc:mga06r32_147804_c1 3300050510 Unclassified 2327
391 nmdc:mga06r32_3513_c1 3300050510 Bacteria 14000
392 nmdc:mga06r32_9474_c1 3300050510 Bacteria 8790
393 nmdc:mga0n895_206319_c1 3300050512 Bacteria 1996
394 nmdc:mga0n895_407471_c1 3300050512 Bacteria 1375
395 nmdc:mga0rr50_211484_c1 3300050513 Unclassified 1598
396 nmdc:mga0rr50_21613_c1 3300050513 Unclassified 4396
397 nmdc:mga08x19_113493_c1 3300050514 Bacteria 1809
398 nmdc:mga08x19_200305_c1 3300050514 Bacteria 1368
399 nmdc:mga0a205_132680_c1 3300050515 Bacteria 2391
400 nmdc:mga0a205_200879_c1 3300050515 Bacteria 1884
401 nmdc:mga0a205_5065_c1 3300050515 Bacteria 11856
402 Ga0495612_0098589 3300053078 Bacteria 1243
403 Ga0495619_0028878 3300053085 Unclassified 3579
404 Ga0495619_0532842 3300053085 Bacteria 806
405 Ga0501084_0251333 3300054114 Bacteria 1492
406 Ga0501084_0258823 3300054114 Unclassified 1469
407 Ga0590074_002575 3300059423 Bacteria 2981
408 Ga0530510_0123373 3300061734 Unclassified 1903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046514 Ga0495618_0576148 Ga0495618_0576148_17_637 199
2 3300053085 Ga0495619_0532842 Ga0495619_0532842_154_783 203
3 3300050507 nmdc:mga05p37_1360812_c1 nmdc:mga05p37_1360812_c1_54_695 211
4 3300044712 Ga0453684_0723249 Ga0453684_0723249_371_1018 214
5 3300045051 Ga0451576_0741824 Ga0451576_0741824_10_660 215
6 3300059423 Ga0590074_002575 Ga0590074_002575_2042_2701 215
7 3300044694 Ga0466963_0177174 Ga0466963_0177174_17_673 217
8 3300044712 Ga0453684_0314426 Ga0453684_0314426_72_743 222
9 3300044712 Ga0453684_0496012 Ga0453684_0496012_38_709 222
10 3300044712 Ga0453684_0769179 Ga0453684_0769179_340_1008 222
11 3300042876 Ga0451577_0006425 Ga0451577_0006425_4119_4877 223
12 3300044712 Ga0453684_0000958 Ga0453684_0000958_73207_73965 223
13 3300050513 nmdc:mga0rr50_211484_c1 nmdc:mga0rr50_211484_c1_15_695 225
14 3300044712 Ga0453684_0004013 Ga0453684_0004013_17569_18324 235
15 3300026075 Ga0207708_10364549 Ga0207708_103645492 236
16 3300044712 Ga0453684_0457061 Ga0453684_0457061_539_1339 238
17 3300044712 Ga0453684_0002081 Ga0453684_0002081_31445_32200 241
18 3300031691 Ga0316579_10078146 Ga0316579_100781463 245
19 3300031691 Ga0316579_10135998 Ga0316579_101359981 245
20 3300031727 Ga0316576_10163760 Ga0316576_101637603 245
21 3300031733 Ga0316577_10010150 Ga0316577_100101506 245
22 3300036647 Ga0316582_0297336 Ga0316582_0297336_293_1051 245
23 3300036712 Ga0316584_0096730 Ga0316584_0096730_606_1364 245
24 3300037588 Ga0316581_0036659 Ga0316581_0036659_266_1024 245
25 3300049576 Ga0501040_0004366 Ga0501040_0004366_2461_3309 245
26 3300005440 Ga0070705_100032327 Ga0070705_1000323273 246
27 3300031733 Ga0316577_10024814 Ga0316577_100248144 246
28 3300039093 Ga0400489_10700 Ga0400489_10700_4080_4835 246
29 iso_pu_bacteria 2671180531 2673167978 246
30 3300031691 Ga0316579_10003682 Ga0316579_100036825 247
31 3300031727 Ga0316576_10281536 Ga0316576_102815361 247
32 3300031733 Ga0316577_10007480 Ga0316577_100074803 247
33 3300035398 Ga0316574_0011951 Ga0316574_0011951_2101_2850 247
34 3300036647 Ga0316582_0008099 Ga0316582_0008099_3467_4216 247
35 3300036712 Ga0316584_0044885 Ga0316584_0044885_1735_2484 247
36 3300038443 Ga0395901_0014028 Ga0395901_0014028_5859_6605 247
37 3300038699 Ga0242422_04265 Ga0242422_04265_59_808 247
38 3300049571 Ga0501034_0220818 Ga0501034_0220818_804_1556 247
39 3300005290 Ga0065712_10161402 Ga0065712_101614022 248
40 3300005365 Ga0070688_100324021 Ga0070688_1003240211 248
41 3300005577 Ga0068857_100106717 Ga0068857_1001067172 248
42 3300005618 Ga0068864_100467150 Ga0068864_1004671501 248
43 3300045976 Ga0466967_0038149 Ga0466967_0038149_613_1368 248
44 3300003323 rootH1_10052350 rootH1_100523504 249
45 3300005347 Ga0070668_100237314 Ga0070668_1002373141 249
46 3300005354 Ga0070675_100117599 Ga0070675_1001175992 249
47 3300005445 Ga0070708_100017898 Ga0070708_1000178985 249
48 3300005445 Ga0070708_100317533 Ga0070708_1003175331 249
49 3300005467 Ga0070706_100012872 Ga0070706_1000128724 249
50 3300005518 Ga0070699_100074095 Ga0070699_1000740954 249
51 3300005843 Ga0068860_100757107 Ga0068860_1007571072 249
52 3300013308 Ga0157375_10864955 Ga0157375_108649552 249
53 3300025910 Ga0207684_10060614 Ga0207684_100606142 249
54 3300025910 Ga0207684_10300585 Ga0207684_103005852 249
55 3300028381 Ga0268264_10620085 Ga0268264_106200852 249
56 3300044658 Ga0466972_0003336 Ga0466972_0003336_2172_2921 249
57 3300044683 Ga0466965_0000476 Ga0466965_0000476_6763_7512 249
58 3300044712 Ga0453684_0000106 Ga0453684_0000106_27333_28091 249
59 3300044712 Ga0453684_0000599 Ga0453684_0000599_75645_76433 249
60 3300044712 Ga0453684_0004448 Ga0453684_0004448_2610_3359 249
61 3300044712 Ga0453684_0006288 Ga0453684_0006288_10261_11013 249
62 3300044712 Ga0453684_0015503 Ga0453684_0015503_9066_9827 249
63 3300044735 Ga0466968_0001583 Ga0466968_0001583_2678_3427 249
64 3300044901 Ga0466960_0000421 Ga0466960_0000421_6763_7512 249
65 3300050507 nmdc:mga05p37_466497_c1 nmdc:mga05p37_466497_c1_530_1282 249
66 3300003373 JGI25407J50210_10001245 JGI25407J50210_100012453 250
67 3300003373 JGI25407J50210_10045589 JGI25407J50210_100455892 250
68 3300004803 Ga0058862_12772021 Ga0058862_127720211 250
69 3300005295 Ga0065707_10118900 Ga0065707_101189001 250
70 3300005343 Ga0070687_100379748 Ga0070687_1003797481 250
71 3300005354 Ga0070675_100762700 Ga0070675_1007627001 250
72 3300005355 Ga0070671_100294986 Ga0070671_1002949861 250
73 3300005436 Ga0070713_100393738 Ga0070713_1003937381 250
74 3300005436 Ga0070713_100600418 Ga0070713_1006004182 250
75 3300005444 Ga0070694_100641584 Ga0070694_1006415841 250
76 3300005445 Ga0070708_100053596 Ga0070708_1000535962 250
77 3300005445 Ga0070708_100109945 Ga0070708_1001099452 250
78 3300005445 Ga0070708_100395328 Ga0070708_1003953282 250
79 3300005455 Ga0070663_100238318 Ga0070663_1002383182 250
80 3300005467 Ga0070706_100016713 Ga0070706_1000167133 250
81 3300005467 Ga0070706_100021246 Ga0070706_1000212464 250
82 3300005467 Ga0070706_100041921 Ga0070706_1000419212 250
83 3300005467 Ga0070706_100068581 Ga0070706_1000685812 250
84 3300005467 Ga0070706_100095436 Ga0070706_1000954362 250
85 3300005467 Ga0070706_100256809 Ga0070706_1002568092 250
86 3300005467 Ga0070706_100754034 Ga0070706_1007540341 250
87 3300005468 Ga0070707_100025599 Ga0070707_1000255993 250
88 3300005468 Ga0070707_100155575 Ga0070707_1001555753 250
89 3300005468 Ga0070707_100157658 Ga0070707_1001576582 250
90 3300005468 Ga0070707_100393246 Ga0070707_1003932461 250
91 3300005468 Ga0070707_100487209 Ga0070707_1004872092 250
92 3300005471 Ga0070698_100003911 Ga0070698_1000039114 250
93 3300005471 Ga0070698_100006593 Ga0070698_1000065933 250
94 3300005471 Ga0070698_100019423 Ga0070698_1000194233 250
95 3300005471 Ga0070698_100080876 Ga0070698_1000808763 250
96 3300005471 Ga0070698_100133947 Ga0070698_1001339472 250
97 3300005471 Ga0070698_100221096 Ga0070698_1002210962 250
98 3300005471 Ga0070698_100325712 Ga0070698_1003257122 250
99 3300005471 Ga0070698_100483425 Ga0070698_1004834251 250
100 3300005471 Ga0070698_100548731 Ga0070698_1005487311 250
101 3300005518 Ga0070699_100010266 Ga0070699_1000102663 250
102 3300005518 Ga0070699_100026187 Ga0070699_1000261875 250
103 3300005518 Ga0070699_100258679 Ga0070699_1002586792 250
104 3300005518 Ga0070699_100310600 Ga0070699_1003106002 250
105 3300005536 Ga0070697_100005436 Ga0070697_1000054363 250
106 3300005536 Ga0070697_100014853 Ga0070697_1000148532 250
107 3300005536 Ga0070697_100096492 Ga0070697_1000964922 250
108 3300005536 Ga0070697_100275039 Ga0070697_1002750391 250
109 3300005536 Ga0070697_100348994 Ga0070697_1003489941 250
110 3300005543 Ga0070672_100724182 Ga0070672_1007241822 250
111 3300005544 Ga0070686_100255758 Ga0070686_1002557581 250
112 3300005546 Ga0070696_100066538 Ga0070696_1000665382 250
113 3300005546 Ga0070696_100169568 Ga0070696_1001695682 250
114 3300005549 Ga0070704_100369491 Ga0070704_1003694912 250
115 3300005617 Ga0068859_100215531 Ga0068859_1002155313 250
116 3300005719 Ga0068861_100181990 Ga0068861_1001819902 250
117 3300005842 Ga0068858_100230222 Ga0068858_1002302222 250
118 3300005937 Ga0081455_10157863 Ga0081455_101578631 250
119 3300005937 Ga0081455_10253925 Ga0081455_102539252 250
120 3300005981 Ga0081538_10006117 Ga0081538_100061173 250
121 3300005981 Ga0081538_10007176 Ga0081538_100071764 250
122 3300005981 Ga0081538_10008332 Ga0081538_100083323 250
123 3300005981 Ga0081538_10009682 Ga0081538_100096822 250
124 3300005981 Ga0081538_10129872 Ga0081538_101298722 250
125 3300005985 Ga0081539_10011020 Ga0081539_100110204 250
126 3300006173 Ga0070716_100225149 Ga0070716_1002251492 250
127 3300006175 Ga0070712_100134590 Ga0070712_1001345902 250
128 3300006175 Ga0070712_100566848 Ga0070712_1005668481 250
129 3300006178 Ga0075367_10086004 Ga0075367_100860042 250
130 3300006844 Ga0075428_100001696 Ga0075428_10000169610 250
131 3300006844 Ga0075428_100012618 Ga0075428_1000126184 250
132 3300006844 Ga0075428_100017493 Ga0075428_1000174933 250
133 3300006844 Ga0075428_100102386 Ga0075428_1001023861 250
134 3300006847 Ga0075431_100002350 Ga0075431_10000235014 250
135 3300006847 Ga0075431_100022967 Ga0075431_1000229673 250
136 3300006847 Ga0075431_100138680 Ga0075431_1001386803 250
137 3300006852 Ga0075433_10003629 Ga0075433_100036295 250
138 3300006852 Ga0075433_10135526 Ga0075433_101355262 250
139 3300006871 Ga0075434_100214360 Ga0075434_1002143602 250
140 3300006880 Ga0075429_100005939 Ga0075429_1000059395 250
141 3300006880 Ga0075429_100725873 Ga0075429_1007258731 250
142 3300006881 Ga0068865_100298372 Ga0068865_1002983722 250
143 3300006914 Ga0075436_100092668 Ga0075436_1000926681 250
144 3300006914 Ga0075436_100157049 Ga0075436_1001570492 250
145 3300006914 Ga0075436_100217465 Ga0075436_1002174651 250
146 3300006931 Ga0097620_100215522 Ga0097620_1002155223 250
147 3300007076 Ga0075435_100155985 Ga0075435_1001559852 250
148 3300007076 Ga0075435_100227090 Ga0075435_1002270902 250
149 3300007076 Ga0075435_100356176 Ga0075435_1003561762 250
150 3300007076 Ga0075435_100387008 Ga0075435_1003870082 250
151 3300009094 Ga0111539_10103911 Ga0111539_101039112 250
152 3300009094 Ga0111539_10385093 Ga0111539_103850932 250
153 3300009147 Ga0114129_10003387 Ga0114129_1000338710 250
154 3300009147 Ga0114129_10008672 Ga0114129_100086723 250
155 3300009147 Ga0114129_10011403 Ga0114129_100114039 250
156 3300009147 Ga0114129_10045810 Ga0114129_100458103 250
157 3300009147 Ga0114129_10069160 Ga0114129_100691603 250
158 3300009147 Ga0114129_10069884 Ga0114129_100698848 250
159 3300009147 Ga0114129_10097628 Ga0114129_100976282 250
160 3300009147 Ga0114129_10117655 Ga0114129_101176552 250
161 3300009147 Ga0114129_10130496 Ga0114129_101304962 250
162 3300009147 Ga0114129_10574842 Ga0114129_105748422 250
163 3300009147 Ga0114129_10620605 Ga0114129_106206052 250
164 3300009147 Ga0114129_10635000 Ga0114129_106350003 250
165 3300009147 Ga0114129_10947909 Ga0114129_109479091 250
166 3300009545 Ga0105237_10010359 Ga0105237_100103598 250
167 3300009553 Ga0105249_10068168 Ga0105249_100681682 250
168 3300011119 Ga0105246_10057544 Ga0105246_100575442 250
169 3300011119 Ga0105246_10726555 Ga0105246_107265551 250
170 3300013296 Ga0157374_10829963 Ga0157374_108299631 250
171 3300013306 Ga0163162_10005236 Ga0163162_1000523612 250
172 3300013308 Ga0157375_10134022 Ga0157375_101340222 250
173 3300013308 Ga0157375_10181716 Ga0157375_101817161 250
174 3300014325 Ga0163163_10119534 Ga0163163_101195342 250
175 3300014968 Ga0157379_10079851 Ga0157379_100798511 250
176 3300014968 Ga0157379_10251501 Ga0157379_102515011 250
177 3300014968 Ga0157379_10311565 Ga0157379_103115652 250
178 3300020070 Ga0206356_10255224 Ga0206356_102552242 250
179 3300020078 Ga0206352_10613749 Ga0206352_106137492 250
180 3300025910 Ga0207684_10004847 Ga0207684_100048473 250
181 3300025910 Ga0207684_10017318 Ga0207684_100173183 250
182 3300025910 Ga0207684_10024378 Ga0207684_100243782 250
183 3300025910 Ga0207684_10049728 Ga0207684_100497283 250
184 3300025910 Ga0207684_10066549 Ga0207684_100665492 250
185 3300025910 Ga0207684_10116108 Ga0207684_101161082 250
186 3300025910 Ga0207684_10153728 Ga0207684_101537282 250
187 3300025910 Ga0207684_10322121 Ga0207684_103221212 250
188 3300025910 Ga0207684_10421910 Ga0207684_104219102 250
189 3300025915 Ga0207693_10117919 Ga0207693_101179192 250
190 3300025922 Ga0207646_10018382 Ga0207646_100183822 250
191 3300025922 Ga0207646_10033633 Ga0207646_100336333 250
192 3300025922 Ga0207646_10118853 Ga0207646_101188531 250
193 3300025936 Ga0207670_10350127 Ga0207670_103501271 250
194 3300025938 Ga0207704_10369742 Ga0207704_103697421 250
195 3300025939 Ga0207665_10100896 Ga0207665_101008962 250
196 3300025961 Ga0207712_10012794 Ga0207712_100127945 250
197 3300026035 Ga0207703_10110411 Ga0207703_101104113 250
198 3300026118 Ga0207675_100130651 Ga0207675_1001306511 250
199 3300026118 Ga0207675_100133859 Ga0207675_1001338592 250
200 3300026118 Ga0207675_100373537 Ga0207675_1003735372 250
201 3300027907 Ga0207428_10102644 Ga0207428_101026442 250
202 3300028380 Ga0268265_10023488 Ga0268265_100234884 250
203 3300028556 Ga0265337_1005588 Ga0265337_10055882 250
204 3300028558 Ga0265326_10036190 Ga0265326_100361902 250
205 3300028563 Ga0265319_1002920 Ga0265319_10029202 250
206 3300028573 Ga0265334_10007698 Ga0265334_100076984 250
207 3300028577 Ga0265318_10003236 Ga0265318_100032362 250
208 3300028800 Ga0265338_10035504 Ga0265338_100355043 250
209 3300029957 Ga0265324_10000862 Ga0265324_100008622 250
210 3300031238 Ga0265332_10048698 Ga0265332_100486982 250
211 3300031240 Ga0265320_10007845 Ga0265320_100078452 250
212 3300031240 Ga0265320_10205828 Ga0265320_102058281 250
213 3300031241 Ga0265325_10005559 Ga0265325_100055592 250
214 3300031242 Ga0265329_10077574 Ga0265329_100775741 250
215 3300031247 Ga0265340_10014113 Ga0265340_100141132 250
216 3300031250 Ga0265331_10017664 Ga0265331_100176643 250
217 3300031595 Ga0265313_10014515 Ga0265313_100145152 250
218 3300031665 Ga0316575_10045005 Ga0316575_100450051 250
219 3300031691 Ga0316579_10148113 Ga0316579_101481132 250
220 3300031711 Ga0265314_10006671 Ga0265314_100066716 250
221 3300031727 Ga0316576_10031945 Ga0316576_100319453 250
222 3300031727 Ga0316576_10074948 Ga0316576_100749482 250
223 3300031727 Ga0316576_10078493 Ga0316576_100784931 250
224 3300031728 Ga0316578_10076721 Ga0316578_100767212 250
225 3300031728 Ga0316578_10204380 Ga0316578_102043801 250
226 3300031728 Ga0316578_10309485 Ga0316578_103094851 250
227 3300031731 Ga0307405_10383560 Ga0307405_103835602 250
228 3300031733 Ga0316577_10028947 Ga0316577_100289472 250
229 3300031733 Ga0316577_10054663 Ga0316577_100546634 250
230 3300031733 Ga0316577_10178605 Ga0316577_101786052 250
231 3300031733 Ga0316577_10182641 Ga0316577_101826412 250
232 3300031824 Ga0307413_10188473 Ga0307413_101884732 250
233 3300031852 Ga0307410_10036236 Ga0307410_100362362 250
234 3300031903 Ga0307407_10040666 Ga0307407_100406663 250
235 3300031911 Ga0307412_10191260 Ga0307412_101912601 250
236 3300031995 Ga0307409_100761851 Ga0307409_1007618511 250
237 3300032002 Ga0307416_100190665 Ga0307416_1001906652 250
238 3300032005 Ga0307411_10182672 Ga0307411_101826722 250
239 3300032126 Ga0307415_100232039 Ga0307415_1002320392 250
240 3300032137 Ga0316585_10008775 Ga0316585_100087751 250
241 3300033527 Ga0316586_1024533 Ga0316586_10245332 250
242 3300035398 Ga0316574_0000466 Ga0316574_0000466_10641_11396 250
243 3300035398 Ga0316574_0064176 Ga0316574_0064176_1463_2215 250
244 3300035691 Ga0373931_0086615 Ga0373931_0086615_377_1132 250
245 3300036647 Ga0316582_0010131 Ga0316582_0010131_130_882 250
246 3300036647 Ga0316582_0085320 Ga0316582_0085320_535_1290 250
247 3300036647 Ga0316582_0087421 Ga0316582_0087421_734_1489 250
248 3300036647 Ga0316582_0145481 Ga0316582_0145481_142_903 250
249 3300036647 Ga0316582_0189108 Ga0316582_0189108_98_868 250
250 3300036712 Ga0316584_0028506 Ga0316584_0028506_2335_3090 250
251 3300036712 Ga0316584_0038646 Ga0316584_0038646_538_1296 250
252 3300036712 Ga0316584_0060763 Ga0316584_0060763_542_1297 250
253 3300036712 Ga0316584_0082628 Ga0316584_0082628_928_1683 250
254 3300036712 Ga0316584_0239007 Ga0316584_0239007_242_1003 250
255 3300036712 Ga0316584_0272663 Ga0316584_0272663_159_929 250
256 3300036712 Ga0316584_0286999 Ga0316584_0286999_303_1061 250
257 3300037312 Ga0395899_0007026 Ga0395899_0007026_7121_7876 250
258 3300037312 Ga0395899_0010630 Ga0395899_0010630_5821_6576 250
259 3300037312 Ga0395899_0058280 Ga0395899_0058280_1303_2058 250
260 3300037418 Ga0395900_0002330 Ga0395900_0002330_7633_8388 250
261 3300037418 Ga0395900_0011390 Ga0395900_0011390_6567_7322 250
262 3300037418 Ga0395900_0026603 Ga0395900_0026603_535_1293 250
263 3300037418 Ga0395900_0117452 Ga0395900_0117452_986_1741 250
264 3300037466 Ga0395898_0005121 Ga0395898_0005121_6314_7069 250
265 3300037466 Ga0395898_0015908 Ga0395898_0015908_5365_6120 250
266 3300037466 Ga0395898_0062491 Ga0395898_0062491_1996_2751 250
267 3300037466 Ga0395898_0362327 Ga0395898_0362327_417_1172 250
268 3300037466 Ga0395898_0414093 Ga0395898_0414093_373_1128 250
269 3300037466 Ga0395898_0459228 Ga0395898_0459228_259_1014 250
270 3300037471 Ga0395905_0005901 Ga0395905_0005901_7092_7847 250
271 3300037471 Ga0395905_0007391 Ga0395905_0007391_3307_4062 250
272 3300037471 Ga0395905_0069582 Ga0395905_0069582_80_835 250
273 3300037588 Ga0316581_0017313 Ga0316581_0017313_848_1603 250
274 3300037588 Ga0316581_0024724 Ga0316581_0024724_17_772 250
275 3300037853 Ga0436364_0319394 Ga0436364_0319394_1379_2134 250
276 3300038443 Ga0395901_0008287 Ga0395901_0008287_3254_4009 250
277 3300038443 Ga0395901_0011603 Ga0395901_0011603_5144_5902 250
278 3300038443 Ga0395901_0029860 Ga0395901_0029860_3154_3909 250
279 3300038443 Ga0395901_0074579 Ga0395901_0074579_1479_2234 250
280 3300038443 Ga0395901_0194483 Ga0395901_0194483_463_1221 250
281 3300038443 Ga0395901_0267464 Ga0395901_0267464_570_1325 250
282 3300038443 Ga0395901_0619429 Ga0395901_0619429_317_1072 250
283 3300039093 Ga0400489_30680 Ga0400489_30680_1409_2164 250
284 3300039110 Ga0400487_63449 Ga0400487_63449_31_789 250
285 3300039438 Ga0436360_0261807 Ga0436360_0261807_736_1518 250
286 3300039438 Ga0436360_0311355 Ga0436360_0311355_275_1057 250
287 3300042003 Ga0439443_000811 Ga0439443_000811_335_1090 250
288 3300042005 Ga0439448_0001975 Ga0439448_0001975_1377_2132 250
289 3300042008 Ga0439450_000917 Ga0439450_000917_1314_2069 250
290 3300042011 Ga0439454_010080 Ga0439454_010080_402_1157 250
291 3300042012 Ga0439455_0005191 Ga0439455_0005191_878_1633 250
292 3300042013 Ga0439456_001980 Ga0439456_001980_921_1676 250
293 3300042016 Ga0439463_001353 Ga0439463_001353_3501_4256 250
294 3300042136 Ga0450900_005477 Ga0450900_005477_391_1146 250
295 3300042137 Ga0450902_001605 Ga0450902_001605_907_1662 250
296 3300042157 Ga0439458_0002103 Ga0439458_0002103_2504_3259 250
297 3300042436 Ga0439435_0024920 Ga0439435_0024920_720_1475 250
298 3300042437 Ga0439444_0001567 Ga0439444_0001567_881_1636 250
299 3300042461 Ga0439460_0024295 Ga0439460_0024295_49_804 250
300 3300042876 Ga0451577_0046204 Ga0451577_0046204_1574_2329 250
301 3300042876 Ga0451577_0078459 Ga0451577_0078459_1287_2042 250
302 3300042876 Ga0451577_0096816 Ga0451577_0096816_1684_2451 250
303 3300042876 Ga0451577_0163584 Ga0451577_0163584_381_1136 250
304 3300042876 Ga0451577_0241129 Ga0451577_0241129_175_933 250
305 3300042876 Ga0451577_0340937 Ga0451577_0340937_554_1309 250
306 3300042993 Ga0439440_0005710 Ga0439440_0005710_1438_2193 250
307 3300044673 Ga0453683_0005842 Ga0453683_0005842_2412_3167 250
308 3300044673 Ga0453683_0018399 Ga0453683_0018399_1005_1760 250
309 3300044673 Ga0453683_0023542 Ga0453683_0023542_1168_1923 250
310 3300044673 Ga0453683_0025795 Ga0453683_0025795_1010_1765 250
311 3300044712 Ga0453684_0000003 Ga0453684_0000003_842857_843612 250
312 3300044712 Ga0453684_0000074 Ga0453684_0000074_225538_226293 250
313 3300044712 Ga0453684_0000933 Ga0453684_0000933_13276_14034 250
314 3300044712 Ga0453684_0001419 Ga0453684_0001419_59219_59974 250
315 3300044712 Ga0453684_0003342 Ga0453684_0003342_6361_7116 250
316 3300044712 Ga0453684_0010070 Ga0453684_0010070_13431_14189 250
317 3300044712 Ga0453684_0013691 Ga0453684_0013691_10760_11527 250
318 3300044712 Ga0453684_0015883 Ga0453684_0015883_4032_4787 250
319 3300044712 Ga0453684_0019648 Ga0453684_0019648_6727_7494 250
320 3300044712 Ga0453684_0022466 Ga0453684_0022466_29_784 250
321 3300044712 Ga0453684_0074299 Ga0453684_0074299_3086_3841 250
322 3300044712 Ga0453684_0161845 Ga0453684_0161845_346_1104 250
323 3300044712 Ga0453684_0170096 Ga0453684_0170096_1150_1905 250
324 3300044712 Ga0453684_0201276 Ga0453684_0201276_451_1206 250
325 3300044712 Ga0453684_0206671 Ga0453684_0206671_121_885 250
326 3300044712 Ga0453684_0293389 Ga0453684_0293389_983_1738 250
327 3300044712 Ga0453684_0347126 Ga0453684_0347126_843_1607 250
328 3300044712 Ga0453684_0351231 Ga0453684_0351231_434_1219 250
329 3300044712 Ga0453684_0378265 Ga0453684_0378265_184_939 250
330 3300044712 Ga0453684_0519820 Ga0453684_0519820_255_1010 250
331 3300044712 Ga0453684_0559638 Ga0453684_0559638_405_1160 250
332 3300044712 Ga0453684_0647490 Ga0453684_0647490_275_1030 250
333 3300044712 Ga0453684_0662930 Ga0453684_0662930_130_885 250
334 3300044712 Ga0453684_0684118 Ga0453684_0684118_169_924 250
335 3300044712 Ga0453684_0779411 Ga0453684_0779411_230_1012 250
336 3300044712 Ga0453684_0795561 Ga0453684_0795561_171_926 250
337 3300044735 Ga0466968_0060632 Ga0466968_0060632_299_1054 250
338 3300044735 Ga0466968_0230577 Ga0466968_0230577_105_860 250
339 3300044842 Ga0466957_0019542 Ga0466957_0019542_1584_2339 250
340 3300044842 Ga0466957_0072393 Ga0466957_0072393_542_1297 250
341 3300045051 Ga0451576_0033104 Ga0451576_0033104_3465_4220 250
342 3300045051 Ga0451576_0033705 Ga0451576_0033705_180_935 250
343 3300045051 Ga0451576_0054863 Ga0451576_0054863_282_1037 250
344 3300045051 Ga0451576_0108132 Ga0451576_0108132_2129_2884 250
345 3300045836 Ga0466958_0021545 Ga0466958_0021545_2126_2881 250
346 3300045836 Ga0466958_0097947 Ga0466958_0097947_103_858 250
347 3300046463 Ga0495653_0091546 Ga0495653_0091546_97_858 250
348 3300046533 Ga0495640_0086473 Ga0495640_0086473_528_1289 250
349 3300047471 Ga0495684_0077556 Ga0495684_0077556_1612_2373 250
350 3300048905 Ga0496102_0152675 Ga0496102_0152675_797_1561 250
351 3300048907 Ga0496104_0016403 Ga0496104_0016403_5034_5798 250
352 3300048909 Ga0496106_0077443 Ga0496106_0077443_754_1518 250
353 3300048910 Ga0496107_0079735 Ga0496107_0079735_273_1037 250
354 3300048911 Ga0496108_0106817 Ga0496108_0106817_922_1686 250
355 3300048913 Ga0496110_0232973 Ga0496110_0232973_528_1292 250
356 3300048914 Ga0496111_0026238 Ga0496111_0026238_2016_2780 250
357 3300048915 Ga0496112_0223994 Ga0496112_0223994_690_1454 250
358 3300048915 Ga0496112_0234304 Ga0496112_0234304_945_1709 250
359 3300048915 Ga0496112_0654526 Ga0496112_0654526_45_800 250
360 3300048916 Ga0496113_0052557 Ga0496113_0052557_909_1673 250
361 3300048916 Ga0496113_0321898 Ga0496113_0321898_217_981 250
362 3300048917 Ga0496114_0313141 Ga0496114_0313141_125_889 250
363 3300049128 Ga0501308_008109 Ga0501308_008109_308_1063 250
364 3300049576 Ga0501040_0180865 Ga0501040_0180865_149_904 250
365 3300049578 Ga0501042_0082622 Ga0501042_0082622_1523_2278 250
366 3300049580 Ga0501046_0416447 Ga0501046_0416447_48_803 250
367 3300049591 Ga0501075_0061287 Ga0501075_0061287_290_1045 250
368 3300049592 Ga0501076_0308596 Ga0501076_0308596_25_780 250
369 3300049593 Ga0501077_0160386 Ga0501077_0160386_93_848 250
370 3300049650 Ga0501199_012933 Ga0501199_012933_116_871 250
371 3300049668 Ga0501233_069255 Ga0501233_069255_37_792 250
372 3300049741 Ga0501079_0473278 Ga0501079_0473278_20_775 250
373 3300050507 nmdc:mga05p37_10800_c1 nmdc:mga05p37_10800_c1_5624_6379 250
374 3300050507 nmdc:mga05p37_136090_c1 nmdc:mga05p37_136090_c1_1109_1873 250
375 3300050507 nmdc:mga05p37_14417_c1 nmdc:mga05p37_14417_c1_7017_7787 250
376 3300050507 nmdc:mga05p37_30473_c1 nmdc:mga05p37_30473_c1_5162_5941 250
377 3300050507 nmdc:mga05p37_337027_c1 nmdc:mga05p37_337027_c1_404_1159 250
378 3300050507 nmdc:mga05p37_34068_c1 nmdc:mga05p37_34068_c1_2424_3179 250
379 3300050507 nmdc:mga05p37_348084_c1 nmdc:mga05p37_348084_c1_365_1120 250
380 3300050507 nmdc:mga05p37_395043_c1 nmdc:mga05p37_395043_c1_412_1167 250
381 3300050507 nmdc:mga05p37_428724_c1 nmdc:mga05p37_428724_c1_403_1158 250
382 3300050507 nmdc:mga05p37_483005_c1 nmdc:mga05p37_483005_c1_598_1353 250
383 3300050507 nmdc:mga05p37_606137_c1 nmdc:mga05p37_606137_c1_13_768 250
384 3300050507 nmdc:mga05p37_77323_c1 nmdc:mga05p37_77323_c1_1871_2623 250
385 3300050508 nmdc:mga09592_13101_c1 nmdc:mga09592_13101_c1_916_1686 250
386 3300050508 nmdc:mga09592_20811_c1 nmdc:mga09592_20811_c1_1611_2366 250
387 3300050508 nmdc:mga09592_635977_c1 nmdc:mga09592_635977_c1_116_880 250
388 3300050510 nmdc:mga06r32_123701_c1 nmdc:mga06r32_123701_c1_1505_2260 250
389 3300050510 nmdc:mga06r32_147804_c1 nmdc:mga06r32_147804_c1_1152_1907 250
390 3300050510 nmdc:mga06r32_3513_c1 nmdc:mga06r32_3513_c1_8354_9109 250
391 3300050510 nmdc:mga06r32_9474_c1 nmdc:mga06r32_9474_c1_2752_3531 250
392 3300050512 nmdc:mga0n895_206319_c1 nmdc:mga0n895_206319_c1_640_1395 250
393 3300050512 nmdc:mga0n895_407471_c1 nmdc:mga0n895_407471_c1_261_1016 250
394 3300050513 nmdc:mga0rr50_21613_c1 nmdc:mga0rr50_21613_c1_3343_4098 250
395 3300050514 nmdc:mga08x19_113493_c1 nmdc:mga08x19_113493_c1_704_1459 250
396 3300050514 nmdc:mga08x19_200305_c1 nmdc:mga08x19_200305_c1_170_925 250
397 3300050515 nmdc:mga0a205_132680_c1 nmdc:mga0a205_132680_c1_637_1392 250
398 3300050515 nmdc:mga0a205_200879_c1 nmdc:mga0a205_200879_c1_948_1703 250
399 3300050515 nmdc:mga0a205_5065_c1 nmdc:mga0a205_5065_c1_6943_7698 250
400 3300053078 Ga0495612_0098589 Ga0495612_0098589_417_1178 250
401 3300053085 Ga0495619_0028878 Ga0495619_0028878_1153_1914 250
402 3300054114 Ga0501084_0258823 Ga0501084_0258823_42_797 250
403 3300061734 Ga0530510_0123373 Ga0530510_0123373_65_832 250
404 3300003322 rootL2_10024603 rootL2_100246033 251
405 3300005445 Ga0070708_100204794 Ga0070708_1002047942 251
406 3300035398 Ga0316574_0090708 Ga0316574_0090708_925_1719 251
407 3300045976 Ga0466967_0762091 Ga0466967_0762091_97_870 251
408 3300049587 Ga0501071_0341177 Ga0501071_0341177_223_990 251
409 3300054114 Ga0501084_0251333 Ga0501084_0251333_490_1284 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

38

261

0.9

PF09140

MipZ

ATPase MipZ

36

98

0.85

PF13614

AAA_31

AAA domain

35

209

0.82

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

35

281

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1g3r-assembly1.cif.gz_A crystal structure analysis of pyrococcus furiosus cell division atpase mind 0.8929 1 250
1ion-assembly1.cif.gz_A the septum site-determining protein mind complexed with mg-adp from pyrococcus horikoshii ot3 0.8898 1 246
1g3r-assembly1.cif.gz_A crystal structure analysis of pyrococcus furiosus cell division atpase mind 0.8789 1 250
4v03-assembly1.cif.gz_A mind cell division protein, aquifex aeolicus 0.8679 2 250
4v02-assembly1.cif.gz_A minc:mind cell division protein complex, aquifex aeolicus 0.8661 2 250
ID Description Score Start End Superfamily
af_Q57633_4_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8844 4 247 3.40.50.300
af_Q57633_4_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.87 4 247 3.40.50.300
4v02A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8661 2 250 3.40.50.300
1hyqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8637 3 247 3.40.50.300
1ionA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8612 2 246 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A352AID9-F1-model_v4 CDP-3, 6-dideoxy-D-glycero-L-glycero-4-hexulose-4-reductase 0.9882 1 251 GO:0005524
AF-A0A3N5SSN7-F1-model_v4 MinD/ParA family protein 0.9878 120 251
AF-A0A7V1SJY8-F1-model_v4 MinD/ParA family protein 0.9858 1 206
AF-A0A349H145-F1-model_v4 CDP-3, 6-dideoxy-D-glycero-L-glycero-4-hexulose-4-reductase 0.9851 1 251 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A7W2BXZ1-F1-model_v4 deleted 0.9843 1 251

Feature Viewer

pLDDT pTM Quality
93.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map