F437082

General Info

Members Datasets Scaffolds Average Seq Length
409 242 407 117

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0161131|Ga0495686_0161131_534_941
Length 135
Sequence MPCGCRRLGRRRGAARDNGRMTTLYGIPNCDTVKRARDWLATHGVDFRFHDFRKQGVPADRLAAWVAAAGWERVLNRKGTTWRKLDEAQRSAVVDAASAQALMREQASVIKRPVVEWSDGRITVGFDADDWAARV

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
113 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
146 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
147 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
151 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
230 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
231 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
232 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
241 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.92
Nodule 0.98
Rhizoplane 1.71
Rhizosphere 54.77
Stem 0
Stem Tuber 0
Unclassified 16.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10033667 3300002077 Bacteria 974
2 JGI25156J39149_1000038 3300002705 Bacteria 108421
3 JGI25156J39149_1000044 3300002705 Bacteria 104222
4 JGI25154J39366_1001342 3300002738 Bacteria 9015
5 JGI25157J39369_1000064 3300002741 Bacteria 102472
6 rootH1_10024327 3300003316 Bacteria 2723
7 rootH2_10026377 3300003320 Bacteria 12098
8 rootH1_10011368 3300003323 Bacteria 2839
9 Ga0055525_1000011 3300003759 Bacteria 503124
10 Ga0055525_1000046 3300003759 Bacteria 261587
11 Ga0055524_1002614 3300003775 Bacteria 9159
12 Ga0055530_10003256 3300003791 Bacteria 9461
13 Ga0055540_1000004 3300003792 Bacteria 395545
14 Ga0055540_1000035 3300003792 Bacteria 166843
15 Ga0055540_1043880 3300003792 Bacteria 952
16 Ga0070658_10942367 3300005327 Bacteria 751
17 Ga0070658_10956766 3300005327 Bacteria 745
18 Ga0070690_100090178 3300005330 Bacteria 2018
19 Ga0068869_100014709 3300005334 Bacteria 5233
20 Ga0068869_100408019 3300005334 Bacteria 1119
21 Ga0070660_100022088 3300005339 Bacteria 4701
22 Ga0070660_100484031 3300005339 Bacteria 1028
23 Ga0070689_100354808 3300005340 Bacteria 1231
24 Ga0070661_100085397 3300005344 Bacteria 2332
25 Ga0070668_101513558 3300005347 Bacteria 613
26 Ga0070669_100035697 3300005353 Bacteria 3602
27 Ga0070669_100455415 3300005353 Bacteria 1055
28 Ga0070671_100123140 3300005355 Bacteria 2183
29 Ga0070673_100049517 3300005364 Bacteria 3281
30 Ga0070659_100110917 3300005366 Bacteria 2214
31 Ga0070659_100273953 3300005366 Bacteria 1403
32 Ga0070659_100679440 3300005366 Bacteria 889
33 Ga0070667_100510833 3300005367 Bacteria 1102
34 Ga0070667_101147221 3300005367 Bacteria 727
35 Ga0070667_101929851 3300005367 Bacteria 556
36 Ga0070714_100420961 3300005435 Bacteria 1265
37 Ga0070700_100129915 3300005441 Bacteria 1699
38 Ga0070708_100554580 3300005445 Bacteria 1084
39 Ga0070663_100039271 3300005455 Bacteria 3307
40 Ga0070662_100093551 3300005457 Bacteria 2261
41 Ga0068867_100109122 3300005459 Bacteria 2124
42 Ga0068867_100182660 3300005459 Bacteria 1668
43 Ga0070672_100031528 3300005543 Bacteria 3990
44 Ga0068855_100201203 3300005563 Bacteria 2242
45 Ga0068855_100420075 3300005563 Bacteria 1463
46 Ga0068857_100074835 3300005577 Bacteria 3019
47 Ga0068857_100187459 3300005577 Bacteria 1883
48 Ga0068854_100216390 3300005578 Bacteria 1513
49 Ga0068859_100353556 3300005617 Bacteria 1564
50 Ga0068861_100019290 3300005719 Bacteria 4872
51 Ga0068861_100033036 3300005719 Bacteria 3814
52 Ga0068861_100383918 3300005719 Bacteria 1242
53 Ga0068860_100501654 3300005843 Bacteria 1211
54 Ga0068860_101039449 3300005843 Bacteria 838
55 Ga0068862_100022507 3300005844 Bacteria 5272
56 Ga0068862_102403568 3300005844 Bacteria 539
57 Ga0075365_10424969 3300006038 Bacteria 938
58 Ga0075368_10006619 3300006042 Bacteria 4061
59 Ga0075368_10008245 3300006042 Bacteria 3703
60 Ga0075363_100023457 3300006048 Bacteria 3127
61 Ga0075363_100075670 3300006048 Bacteria 1835
62 Ga0075363_100935647 3300006048 Bacteria 532
63 Ga0075364_10084712 3300006051 Bacteria 2099
64 Ga0075362_10002180 3300006177 Bacteria 6488
65 Ga0075362_10010740 3300006177 Bacteria 3585
66 Ga0075362_10474263 3300006177 Bacteria 638
67 Ga0075367_10009220 3300006178 Bacteria 5150
68 Ga0075367_10026340 3300006178 Bacteria 3297
69 Ga0075367_10420495 3300006178 Bacteria 846
70 Ga0075369_10008910 3300006186 Bacteria 3881
71 Ga0075369_10012965 3300006186 Bacteria 3298
72 Ga0075366_10000574 3300006195 Bacteria 17235
73 Ga0075366_10013431 3300006195 Bacteria 4662
74 Ga0075366_10034108 3300006195 Bacteria 2998
75 Ga0075366_10097268 3300006195 Bacteria 1765
76 Ga0075366_10202501 3300006195 Bacteria 1207
77 Ga0075366_10229893 3300006195 Bacteria 1130
78 Ga0075366_10481485 3300006195 Bacteria 767
79 Ga0075370_10000101 3300006353 Bacteria 27175
80 Ga0075370_10003590 3300006353 Bacteria 7422
81 Ga0075370_10006011 3300006353 Bacteria 6079
82 Ga0075370_10008892 3300006353 Bacteria 5188
83 Ga0075370_10043381 3300006353 Bacteria 2542
84 Ga0075370_10058755 3300006353 Bacteria 2188
85 Ga0075370_10258991 3300006353 Bacteria 1031
86 Ga0075370_10285034 3300006353 Bacteria 981
87 Ga0075370_10480760 3300006353 Bacteria 749
88 Ga0075370_10556947 3300006353 Bacteria 693
89 Ga0075370_10626327 3300006353 Bacteria 652
90 Ga0075370_10626328 3300006353 Bacteria 652
91 Ga0075370_10806146 3300006353 Bacteria 572
92 Ga0068871_101634213 3300006358 Bacteria 610
93 Ga0075430_100022789 3300006846 Bacteria 5326
94 Ga0075431_101072901 3300006847 Bacteria 771
95 Ga0068865_100102582 3300006881 Bacteria 2096
96 Ga0068865_101151777 3300006881 Bacteria 685
97 Ga0097620_100353604 3300006931 Bacteria 1564
98 Ga0099823_1000023 3300006944 Bacteria 75509
99 Ga0079104_1000024 3300006946 Bacteria 219543
100 Ga0105240_10144070 3300009093 Bacteria 2845
101 Ga0105240_12050781 3300009093 Bacteria 594
102 Ga0105245_10099315 3300009098 Bacteria 2691
103 Ga0114129_12599759 3300009147 Bacteria 604
104 Ga0105243_10095691 3300009148 Bacteria 2455
105 Ga0105241_10245723 3300009174 Bacteria 1515
106 Ga0105241_10611733 3300009174 Bacteria 985
107 Ga0105242_10043053 3300009176 Bacteria 3650
108 Ga0105242_10140350 3300009176 Bacteria 2096
109 Ga0105237_10018505 3300009545 Bacteria 7209
110 Ga0105239_10237400 3300010375 Bacteria 2046
111 Ga0105239_11181522 3300010375 Bacteria 881
112 Ga0105239_13080887 3300010375 Bacteria 543
113 Ga0105246_10286546 3300011119 Bacteria 1324
114 Ga0105246_10327574 3300011119 Bacteria 1247
115 Ga0163162_11298237 3300013306 Bacteria 827
116 Ga0157372_11630295 3300013307 Bacteria 743
117 Ga0157375_11054512 3300013308 Bacteria 950
118 Ga0157380_10162352 3300014326 Bacteria 1943
119 Ga0213872_10000074 3300021361 Bacteria 90986
120 Ga0213872_10000129 3300021361 Bacteria 69032
121 Ga0213872_10000710 3300021361 Bacteria 25046
122 Ga0209563_100005 3300025230 Bacteria 1774893
123 Ga0209563_105371 3300025230 Bacteria 2333
124 Ga0209646_1000094 3300025246 Bacteria 182874
125 Ga0209026_1000009 3300025250 Bacteria 531812
126 Ga0209677_100097 3300025253 Bacteria 97418
127 Ga0209759_1000065 3300025256 Bacteria 187612
128 Ga0209759_1002423 3300025256 Bacteria 8202
129 Ga0209759_1004832 3300025256 Bacteria 4901
130 Ga0209565_1027091 3300025263 Bacteria 1143
131 Ga0209673_1006737 3300025273 Bacteria 5471
132 Ga0209673_1055090 3300025273 Bacteria 1026
133 Ga0209758_1057959 3300025297 Bacteria 1298
134 Ga0209050_1000488 3300025298 Bacteria 68812
135 Ga0209050_1002883 3300025298 Bacteria 13584
136 Ga0209256_1000011 3300025299 Bacteria 865309
137 Ga0209256_1000742 3300025299 Bacteria 42803
138 Ga0209051_1000016 3300025303 Bacteria 541891
139 Ga0209051_1008508 3300025303 Bacteria 5422
140 Ga0209257_1000102 3300025304 Bacteria 251074
141 Ga0209257_1005027 3300025304 Bacteria 9627
142 Ga0209257_1013125 3300025304 Bacteria 3727
143 Ga0207645_10159249 3300025907 Bacteria 1476
144 Ga0207705_10478141 3300025909 Bacteria 967
145 Ga0207654_10591044 3300025911 Bacteria 791
146 Ga0207695_10110717 3300025913 Bacteria 2726
147 Ga0207671_10180787 3300025914 Bacteria 1641
148 Ga0207657_10156029 3300025919 Bacteria 1856
149 Ga0207657_10161587 3300025919 Bacteria 1819
150 Ga0207681_10166980 3300025923 Bacteria 1664
151 Ga0207681_10386799 3300025923 Bacteria 1127
152 Ga0207650_11065160 3300025925 Bacteria 688
153 Ga0207687_10187945 3300025927 Bacteria 1605
154 Ga0207664_10822873 3300025929 Bacteria 835
155 Ga0207644_10244352 3300025931 Bacteria 1430
156 Ga0207690_10040792 3300025932 Bacteria 3037
157 Ga0207690_11002770 3300025932 Bacteria 695
158 Ga0207706_10130562 3300025933 Bacteria 2210
159 Ga0207686_10007360 3300025934 Bacteria 5925
160 Ga0207709_10070833 3300025935 Bacteria 2212
161 Ga0207670_10298399 3300025936 Bacteria 1261
162 Ga0207704_10065322 3300025938 Bacteria 2277
163 Ga0207691_10086850 3300025940 Bacteria 2806
164 Ga0207689_10011578 3300025942 Bacteria 7558
165 Ga0207689_10015594 3300025942 Bacteria 6436
166 Ga0207667_10217753 3300025949 Bacteria 1956
167 Ga0207667_11213259 3300025949 Bacteria 734
168 Ga0207651_10036025 3300025960 Bacteria 3225
169 Ga0207651_11055878 3300025960 Bacteria 727
170 Ga0207712_10029215 3300025961 Bacteria 3696
171 Ga0207712_10262173 3300025961 Bacteria 1402
172 Ga0207668_10181520 3300025972 Bacteria 1660
173 Ga0207640_10091653 3300025981 Bacteria 2106
174 Ga0207658_10083463 3300025986 Bacteria 2456
175 Ga0207678_10041662 3300026067 Bacteria 3981
176 Ga0207678_10874547 3300026067 Bacteria 794
177 Ga0207648_10071794 3300026089 Bacteria 3017
178 Ga0207648_10105149 3300026089 Bacteria 2476
179 Ga0207674_10088561 3300026116 Bacteria 3088
180 Ga0207674_10195510 3300026116 Bacteria 1972
181 Ga0207674_10684077 3300026116 Bacteria 990
182 Ga0207675_100063671 3300026118 Bacteria 3446
183 Ga0207698_10067836 3300026142 Bacteria 2814
184 Ga0209281_1000104 3300027111 Bacteria 221056
185 Ga0209389_1004479 3300027296 Bacteria 11650
186 Ga0209813_10006668 3300027866 Bacteria 2858
187 Ga0209813_10160973 3300027866 Bacteria 810
188 Ga0268266_10926573 3300028379 Bacteria 843
189 Ga0268265_10027962 3300028380 Bacteria 4033
190 Ga0268264_11160701 3300028381 Bacteria 781
191 Ga0307517_10000810 3300028786 Bacteria 53724
192 Ga0307517_10204529 3300028786 Bacteria 1228
193 Ga0307517_10317613 3300028786 Bacteria 864
194 Ga0307517_10320301 3300028786 Bacteria 858
195 Ga0307517_10353413 3300028786 Bacteria 797
196 Ga0307517_10596243 3300028786 Bacteria 545
197 Ga0307515_10000842 3300028794 Bacteria 70481
198 Ga0307515_10002513 3300028794 Bacteria 39723
199 Ga0307515_10011118 3300028794 Bacteria 17118
200 Ga0307515_10012271 3300028794 Bacteria 16134
201 Ga0307515_10166850 3300028794 Bacteria 2215
202 Ga0307515_10190480 3300028794 Bacteria 1963
203 Ga0307515_10200353 3300028794 Bacteria 1874
204 Ga0307515_10379597 3300028794 Bacteria 1046
205 Ga0307515_10723626 3300028794 Bacteria 612
206 Ga0307511_10164269 3300030521 Bacteria 1237
207 Ga0265328_10008350 3300031239 Bacteria 4277
208 Ga0265331_10010000 3300031250 Bacteria 5276
209 Ga0265327_10000078 3300031251 Bacteria 207398
210 Ga0307513_10053140 3300031456 Bacteria 4357
211 Ga0307513_10095772 3300031456 Bacteria 3008
212 Ga0307513_10197003 3300031456 Bacteria 1859
213 Ga0307513_10643703 3300031456 Bacteria 767
214 Ga0307513_10982960 3300031456 Bacteria 553
215 Ga0307509_10016656 3300031507 Bacteria 8496
216 Ga0307509_10036552 3300031507 Bacteria 5375
217 Ga0307509_10122415 3300031507 Bacteria 2576
218 Ga0307509_10142003 3300031507 Bacteria 2334
219 Ga0307509_10772253 3300031507 Bacteria 626
220 Ga0307508_10000333 3300031616 Bacteria 57002
221 Ga0307508_10002132 3300031616 Bacteria 21213
222 Ga0307508_10051273 3300031616 Bacteria 3668
223 Ga0307508_10130418 3300031616 Bacteria 2117
224 Ga0307508_10326615 3300031616 Bacteria 1126
225 Ga0307514_10020610 3300031649 Bacteria 5381
226 Ga0307516_10003115 3300031730 Bacteria 21581
227 Ga0307516_10009389 3300031730 Bacteria 10913
228 Ga0307516_10153822 3300031730 Bacteria 2057
229 Ga0307516_10166305 3300031730 Bacteria 1950
230 Ga0307516_10244838 3300031730 Bacteria 1490
231 Ga0307516_10354666 3300031730 Bacteria 1132
232 Ga0307516_10479827 3300031730 Bacteria 898
233 Ga0307516_10844445 3300031730 Bacteria 579
234 Ga0307405_10409537 3300031731 Bacteria 1064
235 Ga0307407_10731648 3300031903 Bacteria 748
236 Ga0307411_11636353 3300032005 Bacteria 595
237 Ga0307507_10017782 3300033179 Bacteria 8137
238 Ga0307507_10189462 3300033179 Bacteria 1449
239 Ga0307507_10624945 3300033179 Bacteria 551
240 Ga0307510_10005587 3300033180 Bacteria 14987
241 Ga0307510_10134394 3300033180 Bacteria 2136
242 Ga0373940_0034398 3300035088 Bacteria 1367
243 Ga0373946_0572047 3300035171 Bacteria 584
244 Ga0373935_0608815 3300035692 Bacteria 799
245 Ga0373925_0911444 3300037068 Bacteria 724
246 Ga0395900_0039544 3300037418 Bacteria 4859
247 Ga0395898_0018447 3300037466 Bacteria 7114
248 Ga0395898_0539343 3300037466 Bacteria 1108
249 Ga0395905_0152747 3300037471 Bacteria 2172
250 Ga0395905_0513119 3300037471 Bacteria 1099
251 Ga0395905_0727217 3300037471 Bacteria 895
252 Ga0395901_0353025 3300038443 Bacteria 1517
253 Ga0436361_0060431 3300039447 Bacteria 1307
254 Ga0436361_0146317 3300039447 Bacteria 92155
255 Ga0436361_0650099 3300039447 Bacteria 16105
256 Ga0436361_0731225 3300039447 Bacteria 3632
257 Ga0436361_0768142 3300039447 Bacteria 56393
258 Ga0451804_0161830 3300041463 Bacteria 717
259 Ga0451807_0159790 3300041486 Bacteria 648
260 Ga0451807_2332763 3300041486 Bacteria 1078
261 Ga0451841_0910340 3300041498 Bacteria 910
262 Ga0451847_0116265 3300041503 Bacteria 786
263 Ga0451843_1396408 3300041509 Bacteria 1256
264 Ga0451853_0604540 3300041512 Bacteria 545
265 Ga0451853_0700982 3300041512 Bacteria 1043
266 Ga0439431_0028768 3300041997 Bacteria 1370
267 Ga0439437_033057 3300042000 Bacteria 655
268 Ga0439455_0169533 3300042012 Bacteria 626
269 Ga0439462_0004347 3300042015 Bacteria 3452
270 Ga0439446_0188609 3300042156 Bacteria 692
271 Ga0439458_0011207 3300042157 Bacteria 2003
272 Ga0466969_0000116 3300044656 Bacteria 42280
273 Ga0466969_0008267 3300044656 Bacteria 5521
274 Ga0466969_0020677 3300044656 Bacteria 3406
275 Ga0466972_0015163 3300044658 Bacteria 3852
276 Ga0466972_0100029 3300044658 Bacteria 1372
277 Ga0466965_0074245 3300044683 Bacteria 1713
278 Ga0466965_0141246 3300044683 Bacteria 1254
279 Ga0466966_0011764 3300044684 Bacteria 5798
280 Ga0466966_0017980 3300044684 Bacteria 4667
281 Ga0466961_0027291 3300044693 Bacteria 3671
282 Ga0453684_0945877 3300044712 Bacteria 920
283 Ga0466971_0235633 3300044719 Bacteria 870
284 Ga0466971_0375516 3300044719 Bacteria 690
285 Ga0466968_0165070 3300044735 Bacteria 1023
286 Ga0466970_0079461 3300044765 Bacteria 1771
287 Ga0466970_0118644 3300044765 Bacteria 1448
288 Ga0466957_0063226 3300044842 Bacteria 2274
289 Ga0466960_0224664 3300044901 Bacteria 1034
290 Ga0466959_0000395 3300045049 Bacteria 25570
291 Ga0466959_0005047 3300045049 Bacteria 8969
292 Ga0466967_0026999 3300045976 Bacteria 4767
293 Ga0495638_0442126 3300046460 Bacteria 666
294 Ga0495651_0476214 3300046462 Bacteria 803
295 Ga0495650_0005673 3300046471 Bacteria 8007
296 Ga0495605_0045195 3300046474 Bacteria 2172
297 Ga0495639_0001584 3300046475 Bacteria 10158
298 Ga0495585_0474667 3300046492 Bacteria 596
299 Ga0495583_0000062 3300046506 Bacteria 195151
300 Ga0495583_0113243 3300046506 Bacteria 1148
301 Ga0495606_0003769 3300046507 Bacteria 15761
302 Ga0495608_0489336 3300046511 Bacteria 746
303 Ga0495610_0080579 3300046512 Bacteria 1496
304 Ga0495610_0117614 3300046512 Bacteria 1169
305 Ga0495618_0177824 3300046514 Bacteria 1353
306 Ga0495618_0512330 3300046514 Bacteria 722
307 Ga0495620_0147193 3300046515 Bacteria 919
308 Ga0495620_0201551 3300046515 Bacteria 765
309 Ga0495620_0339108 3300046515 Bacteria 570
310 Ga0495630_0230323 3300046517 Bacteria 1415
311 Ga0495631_0099942 3300046518 Bacteria 1249
312 Ga0495632_0026696 3300046519 Bacteria 3036
313 Ga0495632_0034301 3300046519 Bacteria 2598
314 Ga0495632_0220473 3300046519 Bacteria 858
315 Ga0495666_0102638 3300046526 Bacteria 1347
316 Ga0495642_0069410 3300046528 Bacteria 1472
317 Ga0495652_0218708 3300046529 Bacteria 1433
318 Ga0495586_0521284 3300046535 Bacteria 686
319 Ga0495597_0211990 3300046542 Bacteria 772
320 Ga0495622_0063001 3300046557 Bacteria 1716
321 Ga0495633_0342618 3300046558 Bacteria 677
322 Ga0495668_0025874 3300046616 Bacteria 3333
323 Ga0495668_0074366 3300046616 Bacteria 1866
324 Ga0495625_0001586 3300046660 Bacteria 26961
325 Ga0495625_0005954 3300046660 Bacteria 10966
326 Ga0495625_0036529 3300046660 Bacteria 3611
327 Ga0495625_0374860 3300046660 Bacteria 894
328 Ga0495625_0487220 3300046660 Bacteria 756
329 Ga0495623_0417534 3300046679 Bacteria 719
330 Ga0495658_0207096 3300046683 Bacteria 1224
331 Ga0495658_0979804 3300046683 Bacteria 540
332 Ga0495613_0331751 3300046689 Bacteria 1048
333 Ga0495624_0042732 3300046690 Bacteria 2896
334 Ga0495671_0146209 3300046692 Bacteria 1151
335 Ga0495649_0000892 3300046694 Bacteria 23716
336 Ga0495649_0009156 3300046694 Bacteria 5904
337 Ga0495589_0024571 3300046794 Bacteria 3062
338 Ga0495581_0098442 3300047315 Bacteria 1699
339 Ga0495676_0051541 3300047321 Bacteria 3291
340 Ga0495683_0307442 3300047323 Bacteria 679
341 Ga0495687_023361 3300047443 Bacteria 2953
342 Ga0495687_023387 3300047443 Bacteria 2951
343 Ga0495686_0004901 3300047472 Bacteria 10786
344 Ga0495686_0161131 3300047472 Bacteria 1310
345 Ga0495593_0136354 3300047673 Bacteria 1244
346 Ga0495614_0112991 3300048089 Bacteria 1193
347 Ga0495626_0114256 3300048091 Bacteria 1166
348 Ga0496101_0487139 3300048904 Bacteria 974
349 Ga0496105_0267578 3300048908 Bacteria 1381
350 Ga0496114_0000806 3300048917 Bacteria 23479
351 Ga0496114_0324286 3300048917 Bacteria 1361
352 Ga0496121_0176547 3300048924 Bacteria 1546
353 Ga0496123_0092780 3300048926 Bacteria 1785
354 Ga0496124_0384200 3300048927 Bacteria 981
355 Ga0496125_0011749 3300048928 Bacteria 8728
356 Ga0496126_0041394 3300048929 Bacteria 4264
357 Ga0496126_0067784 3300048929 Bacteria 3188
358 Ga0501035_0063457 3300049822 Bacteria 3286
359 nmdc:mga03683_598527_c1 3300050489 Bacteria 540
360 nmdc:mga03683_7690_c1 3300050489 Bacteria 3754
361 nmdc:mga03683_92613_c1 3300050489 Bacteria 1319
362 nmdc:mga03n38_89547_c1 3300050490 Bacteria 1462
363 nmdc:mga00v17_83495_c1 3300050491 Bacteria 1100
364 nmdc:mga0yw44_1188742_c1 3300050492 Bacteria 514
365 nmdc:mga0yw44_72163_c1 3300050492 Bacteria 2145
366 nmdc:mga0k408_10168_c1 3300050493 Bacteria 5087
367 nmdc:mga0k408_114498_c1 3300050493 Bacteria 1595
368 nmdc:mga0k408_16128_c1 3300050493 Bacteria 4141
369 nmdc:mga0k408_562584_c1 3300050493 Bacteria 674
370 nmdc:mga0k408_6750_c1 3300050493 Bacteria 6124
371 nmdc:mga0k408_84890_c1 3300050493 Bacteria 1858
372 nmdc:mga0k408_9226_c1 3300050493 Bacteria 5315
373 nmdc:mga06z11_4240_c1 3300050494 Bacteria 5622
374 nmdc:mga06z11_42751_c1 3300050494 Bacteria 2275
375 nmdc:mga06z11_90684_c1 3300050494 Bacteria 1658
376 nmdc:mga04h51_8972_c1 3300050495 Bacteria 2692
377 nmdc:mga07m45_1045_c1 3300050496 Bacteria 12330
378 nmdc:mga07m45_122786_c1 3300050496 Bacteria 1501
379 nmdc:mga07m45_12595_c1 3300050496 Bacteria 3544
380 nmdc:mga07m45_23647_c1 3300050496 Bacteria 3361
381 nmdc:mga07m45_37831_c1 3300050496 Bacteria 2692
382 nmdc:mga07m45_428003_c1 3300050496 Bacteria 768
383 nmdc:mga07m45_552950_c1 3300050496 Bacteria 666
384 nmdc:mga07m45_6735_c1 3300050496 Bacteria 5830
385 nmdc:mga07m45_789361_c1 3300050496 Bacteria 545
386 nmdc:mga0qj67_63362_c1 3300050509 Bacteria 2939
387 nmdc:mga06r32_1197734_c1 3300050510 Bacteria 706
388 nmdc:mga0sz30_10291_c1 3300050516 Bacteria 3583
389 nmdc:mga0sz30_23844_c1 3300050516 Bacteria 2493
390 Ga0500644_0003855 3300053088 Bacteria 3731
391 Ga0500646_0264958 3300053090 Bacteria 608
392 Ga0500651_0032746 3300053093 Bacteria 3277
393 Ga0500651_0167023 3300053093 Bacteria 1313
394 Ga0500594_0041319 3300053118 Bacteria 1262
395 Ga0500614_217761 3300053123 Bacteria 591
396 Ga0500652_196195 3300053131 Bacteria 821
397 Ga0500658_0037290 3300053134 Bacteria 1933
398 Ga0500559_0000022 3300053136 Bacteria 128071
399 Ga0500564_129142 3300053138 Bacteria 1095
400 Ga0500568_0016698 3300053139 Bacteria 3255
401 Ga0500568_0058902 3300053139 Bacteria 1491
402 Ga0500616_0165443 3300053153 Bacteria 1010
403 Ga0500622_0000498 3300053156 Bacteria 36624
404 Ga0500636_0010205 3300053177 Bacteria 5477
405 Ga0500570_133303 3300053724 Bacteria 936
406 Ga0500661_068002 3300055283 Bacteria 649
407 Ga0466962_0015457 3300061719 Bacteria 3679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0060431 Ga0436361_0060431_923_1273 111
2 3300041512 Ga0451853_0604540 Ga0451853_0604540_187_531 113
3 3300047472 Ga0495686_0004901 Ga0495686_0004901_3377_3718 113
4 3300005435 Ga0070714_100420961 Ga0070714_1004209612 114
5 3300025929 Ga0207664_10822873 Ga0207664_108228732 114
6 3300028794 Ga0307515_10190480 Ga0307515_101904802 114
7 3300031731 Ga0307405_10409537 Ga0307405_104095372 114
8 3300032005 Ga0307411_11636353 Ga0307411_116363532 114
9 3300048904 Ga0496101_0487139 Ga0496101_0487139_236_580 114
10 iso_pu_bacteria 2939631187 2939632309 114
11 3300002705 JGI25156J39149_1000038 JGI25156J39149_10000388 115
12 3300002705 JGI25156J39149_1000044 JGI25156J39149_100004437 115
13 3300002738 JGI25154J39366_1001342 JGI25154J39366_10013428 115
14 3300002741 JGI25157J39369_1000064 JGI25157J39369_100006494 115
15 3300003316 rootH1_10024327 rootH1_100243274 115
16 3300003320 rootH2_10026377 rootH2_100263779 115
17 3300003792 Ga0055540_1043880 Ga0055540_10438802 115
18 3300005327 Ga0070658_10942367 Ga0070658_109423671 115
19 3300005327 Ga0070658_10956766 Ga0070658_109567662 115
20 3300005330 Ga0070690_100090178 Ga0070690_1000901782 115
21 3300005334 Ga0068869_100014709 Ga0068869_1000147094 115
22 3300005334 Ga0068869_100408019 Ga0068869_1004080192 115
23 3300005339 Ga0070660_100022088 Ga0070660_1000220884 115
24 3300005339 Ga0070660_100484031 Ga0070660_1004840312 115
25 3300005340 Ga0070689_100354808 Ga0070689_1003548082 115
26 3300005344 Ga0070661_100085397 Ga0070661_1000853974 115
27 3300005347 Ga0070668_101513558 Ga0070668_1015135581 115
28 3300005353 Ga0070669_100035697 Ga0070669_1000356974 115
29 3300005355 Ga0070671_100123140 Ga0070671_1001231403 115
30 3300005364 Ga0070673_100049517 Ga0070673_1000495173 115
31 3300005366 Ga0070659_100110917 Ga0070659_1001109172 115
32 3300005366 Ga0070659_100273953 Ga0070659_1002739532 115
33 3300005366 Ga0070659_100679440 Ga0070659_1006794402 115
34 3300005367 Ga0070667_100510833 Ga0070667_1005108331 115
35 3300005367 Ga0070667_101147221 Ga0070667_1011472212 115
36 3300005441 Ga0070700_100129915 Ga0070700_1001299154 115
37 3300005445 Ga0070708_100554580 Ga0070708_1005545802 115
38 3300005455 Ga0070663_100039271 Ga0070663_1000392714 115
39 3300005457 Ga0070662_100093551 Ga0070662_1000935513 115
40 3300005459 Ga0068867_100109122 Ga0068867_1001091222 115
41 3300005459 Ga0068867_100182660 Ga0068867_1001826604 115
42 3300005543 Ga0070672_100031528 Ga0070672_1000315284 115
43 3300005563 Ga0068855_100201203 Ga0068855_1002012035 115
44 3300005563 Ga0068855_100420075 Ga0068855_1004200752 115
45 3300005577 Ga0068857_100074835 Ga0068857_1000748352 115
46 3300005577 Ga0068857_100187459 Ga0068857_1001874592 115
47 3300005578 Ga0068854_100216390 Ga0068854_1002163902 115
48 3300005617 Ga0068859_100353556 Ga0068859_1003535563 115
49 3300005719 Ga0068861_100019290 Ga0068861_1000192902 115
50 3300005719 Ga0068861_100033036 Ga0068861_1000330365 115
51 3300005719 Ga0068861_100383918 Ga0068861_1003839183 115
52 3300005843 Ga0068860_100501654 Ga0068860_1005016542 115
53 3300005843 Ga0068860_101039449 Ga0068860_1010394492 115
54 3300005844 Ga0068862_100022507 Ga0068862_1000225074 115
55 3300005844 Ga0068862_102403568 Ga0068862_1024035681 115
56 3300006038 Ga0075365_10424969 Ga0075365_104249692 115
57 3300006042 Ga0075368_10006619 Ga0075368_100066193 115
58 3300006042 Ga0075368_10008245 Ga0075368_100082455 115
59 3300006048 Ga0075363_100023457 Ga0075363_1000234573 115
60 3300006048 Ga0075363_100075670 Ga0075363_1000756703 115
61 3300006048 Ga0075363_100935647 Ga0075363_1009356471 115
62 3300006051 Ga0075364_10084712 Ga0075364_100847122 115
63 3300006177 Ga0075362_10002180 Ga0075362_100021807 115
64 3300006177 Ga0075362_10010740 Ga0075362_100107402 115
65 3300006178 Ga0075367_10009220 Ga0075367_100092204 115
66 3300006178 Ga0075367_10026340 Ga0075367_100263403 115
67 3300006186 Ga0075369_10008910 Ga0075369_100089105 115
68 3300006186 Ga0075369_10012965 Ga0075369_100129653 115
69 3300006195 Ga0075366_10000574 Ga0075366_100005743 115
70 3300006195 Ga0075366_10034108 Ga0075366_100341084 115
71 3300006195 Ga0075366_10097268 Ga0075366_100972682 115
72 3300006195 Ga0075366_10202501 Ga0075366_102025013 115
73 3300006195 Ga0075366_10481485 Ga0075366_104814851 115
74 3300006353 Ga0075370_10000101 Ga0075370_100001013 115
75 3300006353 Ga0075370_10003590 Ga0075370_100035903 115
76 3300006353 Ga0075370_10006011 Ga0075370_100060114 115
77 3300006353 Ga0075370_10008892 Ga0075370_100088923 115
78 3300006353 Ga0075370_10058755 Ga0075370_100587553 115
79 3300006353 Ga0075370_10258991 Ga0075370_102589912 115
80 3300006353 Ga0075370_10626327 Ga0075370_106263272 115
81 3300006353 Ga0075370_10626328 Ga0075370_106263282 115
82 3300006881 Ga0068865_100102582 Ga0068865_1001025824 115
83 3300006881 Ga0068865_101151777 Ga0068865_1011517772 115
84 3300006931 Ga0097620_100353604 Ga0097620_1003536043 115
85 3300006944 Ga0099823_1000023 Ga0099823_100002313 115
86 3300009093 Ga0105240_10144070 Ga0105240_101440702 115
87 3300009098 Ga0105245_10099315 Ga0105245_100993154 115
88 3300009147 Ga0114129_12599759 Ga0114129_125997591 115
89 3300009148 Ga0105243_10095691 Ga0105243_100956913 115
90 3300009174 Ga0105241_10245723 Ga0105241_102457232 115
91 3300009174 Ga0105241_10611733 Ga0105241_106117332 115
92 3300009176 Ga0105242_10140350 Ga0105242_101403504 115
93 3300009545 Ga0105237_10018505 Ga0105237_100185052 115
94 3300010375 Ga0105239_10237400 Ga0105239_102374003 115
95 3300010375 Ga0105239_11181522 Ga0105239_111815222 115
96 3300011119 Ga0105246_10286546 Ga0105246_102865463 115
97 3300011119 Ga0105246_10327574 Ga0105246_103275743 115
98 3300013306 Ga0163162_11298237 Ga0163162_112982372 115
99 3300013307 Ga0157372_11630295 Ga0157372_116302952 115
100 3300013308 Ga0157375_11054512 Ga0157375_110545121 115
101 3300014326 Ga0157380_10162352 Ga0157380_101623524 115
102 3300025230 Ga0209563_105371 Ga0209563_1053713 115
103 3300025246 Ga0209646_1000094 Ga0209646_1000094163 115
104 3300025250 Ga0209026_1000009 Ga0209026_100000938 115
105 3300025253 Ga0209677_100097 Ga0209677_10009738 115
106 3300025256 Ga0209759_1000065 Ga0209759_100006538 115
107 3300025256 Ga0209759_1002423 Ga0209759_10024235 115
108 3300025256 Ga0209759_1004832 Ga0209759_10048324 115
109 3300025273 Ga0209673_1006737 Ga0209673_10067376 115
110 3300025299 Ga0209256_1000742 Ga0209256_10007426 115
111 3300025303 Ga0209051_1008508 Ga0209051_10085084 115
112 3300025304 Ga0209257_1005027 Ga0209257_10050275 115
113 3300025907 Ga0207645_10159249 Ga0207645_101592492 115
114 3300025909 Ga0207705_10478141 Ga0207705_104781412 115
115 3300025911 Ga0207654_10591044 Ga0207654_105910442 115
116 3300025913 Ga0207695_10110717 Ga0207695_101107172 115
117 3300025914 Ga0207671_10180787 Ga0207671_101807871 115
118 3300025919 Ga0207657_10156029 Ga0207657_101560292 115
119 3300025919 Ga0207657_10161587 Ga0207657_101615873 115
120 3300025923 Ga0207681_10166980 Ga0207681_101669804 115
121 3300025925 Ga0207650_11065160 Ga0207650_110651602 115
122 3300025927 Ga0207687_10187945 Ga0207687_101879452 115
123 3300025931 Ga0207644_10244352 Ga0207644_102443522 115
124 3300025932 Ga0207690_10040792 Ga0207690_100407922 115
125 3300025932 Ga0207690_11002770 Ga0207690_110027701 115
126 3300025933 Ga0207706_10130562 Ga0207706_101305623 115
127 3300025935 Ga0207709_10070833 Ga0207709_100708332 115
128 3300025936 Ga0207670_10298399 Ga0207670_102983992 115
129 3300025938 Ga0207704_10065322 Ga0207704_100653224 115
130 3300025940 Ga0207691_10086850 Ga0207691_100868502 115
131 3300025942 Ga0207689_10011578 Ga0207689_100115785 115
132 3300025942 Ga0207689_10015594 Ga0207689_100155943 115
133 3300025949 Ga0207667_10217753 Ga0207667_102177532 115
134 3300025949 Ga0207667_11213259 Ga0207667_112132592 115
135 3300025960 Ga0207651_10036025 Ga0207651_100360253 115
136 3300025960 Ga0207651_11055878 Ga0207651_110558782 115
137 3300025961 Ga0207712_10029215 Ga0207712_100292154 115
138 3300025961 Ga0207712_10262173 Ga0207712_102621732 115
139 3300025972 Ga0207668_10181520 Ga0207668_101815204 115
140 3300025981 Ga0207640_10091653 Ga0207640_100916533 115
141 3300025986 Ga0207658_10083463 Ga0207658_100834633 115
142 3300026067 Ga0207678_10041662 Ga0207678_100416623 115
143 3300026067 Ga0207678_10874547 Ga0207678_108745472 115
144 3300026089 Ga0207648_10071794 Ga0207648_100717945 115
145 3300026089 Ga0207648_10105149 Ga0207648_101051493 115
146 3300026116 Ga0207674_10088561 Ga0207674_100885612 115
147 3300026116 Ga0207674_10195510 Ga0207674_101955102 115
148 3300026116 Ga0207674_10684077 Ga0207674_106840771 115
149 3300026118 Ga0207675_100063671 Ga0207675_1000636712 115
150 3300026142 Ga0207698_10067836 Ga0207698_100678363 115
151 3300027296 Ga0209389_1004479 Ga0209389_10044796 115
152 3300027866 Ga0209813_10006668 Ga0209813_100066682 115
153 3300027866 Ga0209813_10160973 Ga0209813_101609732 115
154 3300028380 Ga0268265_10027962 Ga0268265_100279624 115
155 3300028381 Ga0268264_11160701 Ga0268264_111607012 115
156 3300028786 Ga0307517_10204529 Ga0307517_102045292 115
157 3300028786 Ga0307517_10317613 Ga0307517_103176132 115
158 3300028786 Ga0307517_10596243 Ga0307517_105962431 115
159 3300028794 Ga0307515_10011118 Ga0307515_100111188 115
160 3300028794 Ga0307515_10166850 Ga0307515_101668505 115
161 3300028794 Ga0307515_10200353 Ga0307515_102003532 115
162 3300028794 Ga0307515_10723626 Ga0307515_107236261 115
163 3300030521 Ga0307511_10164269 Ga0307511_101642692 115
164 3300031239 Ga0265328_10008350 Ga0265328_100083502 115
165 3300031250 Ga0265331_10010000 Ga0265331_100100004 115
166 3300031251 Ga0265327_10000078 Ga0265327_10000078165 115
167 3300031456 Ga0307513_10053140 Ga0307513_100531406 115
168 3300031507 Ga0307509_10016656 Ga0307509_1001665611 115
169 3300031507 Ga0307509_10036552 Ga0307509_100365523 115
170 3300031507 Ga0307509_10142003 Ga0307509_101420034 115
171 3300031507 Ga0307509_10772253 Ga0307509_107722531 115
172 3300031616 Ga0307508_10051273 Ga0307508_100512731 115
173 3300031616 Ga0307508_10130418 Ga0307508_101304182 115
174 3300031730 Ga0307516_10003115 Ga0307516_1000311519 115
175 3300031730 Ga0307516_10153822 Ga0307516_101538222 115
176 3300031730 Ga0307516_10479827 Ga0307516_104798272 115
177 3300031730 Ga0307516_10844445 Ga0307516_108444452 115
178 3300033179 Ga0307507_10017782 Ga0307507_100177827 115
179 3300033179 Ga0307507_10189462 Ga0307507_101894621 115
180 3300033180 Ga0307510_10005587 Ga0307510_100055877 115
181 3300033180 Ga0307510_10134394 Ga0307510_101343944 115
182 3300035088 Ga0373940_0034398 Ga0373940_0034398_375_722 115
183 3300035171 Ga0373946_0572047 Ga0373946_0572047_199_549 115
184 3300035692 Ga0373935_0608815 Ga0373935_0608815_369_716 115
185 3300037068 Ga0373925_0911444 Ga0373925_0911444_345_692 115
186 3300037466 Ga0395898_0539343 Ga0395898_0539343_376_723 115
187 3300037471 Ga0395905_0727217 Ga0395905_0727217_391_738 115
188 3300038443 Ga0395901_0353025 Ga0395901_0353025_1020_1367 115
189 3300044658 Ga0466972_0015163 Ga0466972_0015163_453_803 115
190 3300046462 Ga0495651_0476214 Ga0495651_0476214_316_663 115
191 3300046471 Ga0495650_0005673 Ga0495650_0005673_7187_7534 115
192 3300046474 Ga0495605_0045195 Ga0495605_0045195_1218_1571 115
193 3300046475 Ga0495639_0001584 Ga0495639_0001584_6174_6521 115
194 3300046492 Ga0495585_0474667 Ga0495585_0474667_187_534 115
195 3300046506 Ga0495583_0000062 Ga0495583_0000062_65875_66222 115
196 3300046506 Ga0495583_0113243 Ga0495583_0113243_646_999 115
197 3300046507 Ga0495606_0003769 Ga0495606_0003769_12789_13136 115
198 3300046511 Ga0495608_0489336 Ga0495608_0489336_387_734 115
199 3300046512 Ga0495610_0080579 Ga0495610_0080579_184_531 115
200 3300046514 Ga0495618_0177824 Ga0495618_0177824_179_529 115
201 3300046514 Ga0495618_0512330 Ga0495618_0512330_338_685 115
202 3300046515 Ga0495620_0201551 Ga0495620_0201551_242_589 115
203 3300046515 Ga0495620_0339108 Ga0495620_0339108_126_476 115
204 3300046517 Ga0495630_0230323 Ga0495630_0230323_1047_1397 115
205 3300046518 Ga0495631_0099942 Ga0495631_0099942_281_634 115
206 3300046519 Ga0495632_0034301 Ga0495632_0034301_1440_1793 115
207 3300046519 Ga0495632_0220473 Ga0495632_0220473_385_732 115
208 3300046526 Ga0495666_0102638 Ga0495666_0102638_764_1114 115
209 3300046528 Ga0495642_0069410 Ga0495642_0069410_847_1200 115
210 3300046529 Ga0495652_0218708 Ga0495652_0218708_636_983 115
211 3300046535 Ga0495586_0521284 Ga0495586_0521284_53_403 115
212 3300046557 Ga0495622_0063001 Ga0495622_0063001_1026_1376 115
213 3300046558 Ga0495633_0342618 Ga0495633_0342618_18_371 115
214 3300046616 Ga0495668_0025874 Ga0495668_0025874_1216_1563 115
215 3300046616 Ga0495668_0074366 Ga0495668_0074366_1452_1805 115
216 3300046660 Ga0495625_0005954 Ga0495625_0005954_8940_9287 115
217 3300046660 Ga0495625_0036529 Ga0495625_0036529_1575_1928 115
218 3300046660 Ga0495625_0487220 Ga0495625_0487220_252_605 115
219 3300046679 Ga0495623_0417534 Ga0495623_0417534_10_357 115
220 3300046683 Ga0495658_0207096 Ga0495658_0207096_301_651 115
221 3300046683 Ga0495658_0979804 Ga0495658_0979804_91_441 115
222 3300046689 Ga0495613_0331751 Ga0495613_0331751_413_763 115
223 3300046690 Ga0495624_0042732 Ga0495624_0042732_1035_1385 115
224 3300046694 Ga0495649_0000892 Ga0495649_0000892_10456_10803 115
225 3300046694 Ga0495649_0009156 Ga0495649_0009156_4800_5153 115
226 3300046794 Ga0495589_0024571 Ga0495589_0024571_1223_1570 115
227 3300047315 Ga0495581_0098442 Ga0495581_0098442_400_750 115
228 3300047321 Ga0495676_0051541 Ga0495676_0051541_1074_1424 115
229 3300047323 Ga0495683_0307442 Ga0495683_0307442_60_407 115
230 3300047443 Ga0495687_023361 Ga0495687_023361_1639_1992 115
231 3300047443 Ga0495687_023387 Ga0495687_023387_1639_1992 115
232 3300047472 Ga0495686_0161131 Ga0495686_0161131_534_941 115
233 3300047673 Ga0495593_0136354 Ga0495593_0136354_876_1226 115
234 3300048089 Ga0495614_0112991 Ga0495614_0112991_28_378 115
235 3300048091 Ga0495626_0114256 Ga0495626_0114256_261_611 115
236 3300048908 Ga0496105_0267578 Ga0496105_0267578_432_779 115
237 3300048917 Ga0496114_0324286 Ga0496114_0324286_478_825 115
238 3300048929 Ga0496126_0067784 Ga0496126_0067784_42_389 115
239 3300050489 nmdc:mga03683_598527_c1 nmdc:mga03683_598527_c1_167_514 115
240 3300050489 nmdc:mga03683_7690_c1 nmdc:mga03683_7690_c1_1572_1919 115
241 3300050489 nmdc:mga03683_92613_c1 nmdc:mga03683_92613_c1_374_727 115
242 3300050490 nmdc:mga03n38_89547_c1 nmdc:mga03n38_89547_c1_796_1143 115
243 3300050491 nmdc:mga00v17_83495_c1 nmdc:mga00v17_83495_c1_468_815 115
244 3300050492 nmdc:mga0yw44_1188742_c1 nmdc:mga0yw44_1188742_c1_77_424 115
245 3300050493 nmdc:mga0k408_10168_c1 nmdc:mga0k408_10168_c1_1757_2104 115
246 3300050493 nmdc:mga0k408_114498_c1 nmdc:mga0k408_114498_c1_293_646 115
247 3300050493 nmdc:mga0k408_562584_c1 nmdc:mga0k408_562584_c1_205_552 115
248 3300050493 nmdc:mga0k408_6750_c1 nmdc:mga0k408_6750_c1_2950_3297 115
249 3300050493 nmdc:mga0k408_84890_c1 nmdc:mga0k408_84890_c1_1151_1498 115
250 3300050494 nmdc:mga06z11_4240_c1 nmdc:mga06z11_4240_c1_2140_2487 115
251 3300050494 nmdc:mga06z11_42751_c1 nmdc:mga06z11_42751_c1_1533_1880 115
252 3300050495 nmdc:mga04h51_8972_c1 nmdc:mga04h51_8972_c1_821_1168 115
253 3300050496 nmdc:mga07m45_1045_c1 nmdc:mga07m45_1045_c1_5519_5884 115
254 3300050496 nmdc:mga07m45_12595_c1 nmdc:mga07m45_12595_c1_2069_2416 115
255 3300050496 nmdc:mga07m45_23647_c1 nmdc:mga07m45_23647_c1_802_1155 115
256 3300050496 nmdc:mga07m45_552950_c1 nmdc:mga07m45_552950_c1_107_454 115
257 3300050496 nmdc:mga07m45_6735_c1 nmdc:mga07m45_6735_c1_2122_2469 115
258 3300050496 nmdc:mga07m45_789361_c1 nmdc:mga07m45_789361_c1_52_399 115
259 3300050516 nmdc:mga0sz30_10291_c1 nmdc:mga0sz30_10291_c1_1634_1981 115
260 3300050516 nmdc:mga0sz30_23844_c1 nmdc:mga0sz30_23844_c1_1821_2168 115
261 3300053088 Ga0500644_0003855 Ga0500644_0003855_599_946 115
262 3300053090 Ga0500646_0264958 Ga0500646_0264958_70_417 115
263 3300053093 Ga0500651_0032746 Ga0500651_0032746_2069_2416 115
264 3300053093 Ga0500651_0167023 Ga0500651_0167023_164_511 115
265 3300053118 Ga0500594_0041319 Ga0500594_0041319_171_518 115
266 3300053123 Ga0500614_217761 Ga0500614_217761_233_580 115
267 3300053131 Ga0500652_196195 Ga0500652_196195_92_439 115
268 3300053134 Ga0500658_0037290 Ga0500658_0037290_122_475 115
269 3300053136 Ga0500559_0000022 Ga0500559_0000022_14786_15133 115
270 3300053138 Ga0500564_129142 Ga0500564_129142_95_442 115
271 3300053139 Ga0500568_0016698 Ga0500568_0016698_1756_2109 115
272 3300053139 Ga0500568_0058902 Ga0500568_0058902_746_1093 115
273 3300053153 Ga0500616_0165443 Ga0500616_0165443_233_580 115
274 3300053156 Ga0500622_0000498 Ga0500622_0000498_10469_10816 115
275 3300053177 Ga0500636_0010205 Ga0500636_0010205_2650_2997 115
276 3300055283 Ga0500661_068002 Ga0500661_068002_220_567 115
277 iso_pu_bacteria 2585428062 2587756462 115
278 3300003323 rootH1_10011368 rootH1_100113683 116
279 3300003759 Ga0055525_1000011 Ga0055525_1000011456 116
280 3300003759 Ga0055525_1000046 Ga0055525_100004644 116
281 3300003775 Ga0055524_1002614 Ga0055524_10026146 116
282 3300003791 Ga0055530_10003256 Ga0055530_100032566 116
283 3300003792 Ga0055540_1000004 Ga0055540_1000004101 116
284 3300003792 Ga0055540_1000035 Ga0055540_100003534 116
285 3300005353 Ga0070669_100455415 Ga0070669_1004554152 116
286 3300005367 Ga0070667_101929851 Ga0070667_1019298511 116
287 3300006177 Ga0075362_10474263 Ga0075362_104742632 116
288 3300006178 Ga0075367_10420495 Ga0075367_104204952 116
289 3300006195 Ga0075366_10013431 Ga0075366_100134315 116
290 3300006195 Ga0075366_10229893 Ga0075366_102298932 116
291 3300006353 Ga0075370_10043381 Ga0075370_100433812 116
292 3300006353 Ga0075370_10285034 Ga0075370_102850342 116
293 3300006353 Ga0075370_10480760 Ga0075370_104807602 116
294 3300006353 Ga0075370_10556947 Ga0075370_105569472 116
295 3300006353 Ga0075370_10806146 Ga0075370_108061461 116
296 3300006358 Ga0068871_101634213 Ga0068871_1016342131 116
297 3300006846 Ga0075430_100022789 Ga0075430_1000227894 116
298 3300006847 Ga0075431_101072901 Ga0075431_1010729012 116
299 3300006946 Ga0079104_1000024 Ga0079104_100002412 116
300 3300009093 Ga0105240_12050781 Ga0105240_120507812 116
301 3300010375 Ga0105239_13080887 Ga0105239_130808872 116
302 3300021361 Ga0213872_10000074 Ga0213872_1000007419 116
303 3300021361 Ga0213872_10000129 Ga0213872_1000012963 116
304 3300021361 Ga0213872_10000710 Ga0213872_1000071011 116
305 3300025230 Ga0209563_100005 Ga0209563_100005782 116
306 3300025263 Ga0209565_1027091 Ga0209565_10270912 116
307 3300025273 Ga0209673_1055090 Ga0209673_10550902 116
308 3300025297 Ga0209758_1057959 Ga0209758_10579592 116
309 3300025298 Ga0209050_1000488 Ga0209050_100048815 116
310 3300025298 Ga0209050_1002883 Ga0209050_10028837 116
311 3300025299 Ga0209256_1000011 Ga0209256_1000011138 116
312 3300025303 Ga0209051_1000016 Ga0209051_1000016193 116
313 3300025304 Ga0209257_1000102 Ga0209257_1000102100 116
314 3300025304 Ga0209257_1013125 Ga0209257_10131253 116
315 3300025923 Ga0207681_10386799 Ga0207681_103867992 116
316 3300027111 Ga0209281_1000104 Ga0209281_1000104190 116
317 3300028379 Ga0268266_10926573 Ga0268266_109265733 116
318 3300028786 Ga0307517_10000810 Ga0307517_1000081021 116
319 3300028786 Ga0307517_10320301 Ga0307517_103203012 116
320 3300028786 Ga0307517_10353413 Ga0307517_103534131 116
321 3300028794 Ga0307515_10000842 Ga0307515_1000084221 116
322 3300028794 Ga0307515_10002513 Ga0307515_1000251319 116
323 3300028794 Ga0307515_10012271 Ga0307515_1001227114 116
324 3300028794 Ga0307515_10379597 Ga0307515_103795971 116
325 3300031456 Ga0307513_10095772 Ga0307513_100957723 116
326 3300031456 Ga0307513_10197003 Ga0307513_101970032 116
327 3300031456 Ga0307513_10643703 Ga0307513_106437032 116
328 3300031456 Ga0307513_10982960 Ga0307513_109829602 116
329 3300031507 Ga0307509_10122415 Ga0307509_101224153 116
330 3300031616 Ga0307508_10000333 Ga0307508_1000033329 116
331 3300031616 Ga0307508_10002132 Ga0307508_100021322 116
332 3300031616 Ga0307508_10326615 Ga0307508_103266152 116
333 3300031649 Ga0307514_10020610 Ga0307514_100206103 116
334 3300031730 Ga0307516_10009389 Ga0307516_100093893 116
335 3300031730 Ga0307516_10166305 Ga0307516_101663052 116
336 3300031730 Ga0307516_10244838 Ga0307516_102448383 116
337 3300031730 Ga0307516_10354666 Ga0307516_103546662 116
338 3300031903 Ga0307407_10731648 Ga0307407_107316482 116
339 3300033179 Ga0307507_10624945 Ga0307507_106249451 116
340 3300037418 Ga0395900_0039544 Ga0395900_0039544_653_1009 116
341 3300037466 Ga0395898_0018447 Ga0395898_0018447_5142_5498 116
342 3300037471 Ga0395905_0152747 Ga0395905_0152747_1417_1773 116
343 3300039447 Ga0436361_0146317 Ga0436361_0146317_6033_6383 116
344 3300039447 Ga0436361_0650099 Ga0436361_0650099_12509_12865 116
345 3300039447 Ga0436361_0731225 Ga0436361_0731225_2975_3325 116
346 3300039447 Ga0436361_0768142 Ga0436361_0768142_2161_2511 116
347 3300041463 Ga0451804_0161830 Ga0451804_0161830_346_699 116
348 3300041486 Ga0451807_0159790 Ga0451807_0159790_198_551 116
349 3300041486 Ga0451807_2332763 Ga0451807_2332763_535_888 116
350 3300041498 Ga0451841_0910340 Ga0451841_0910340_189_545 116
351 3300041503 Ga0451847_0116265 Ga0451847_0116265_82_432 116
352 3300041509 Ga0451843_1396408 Ga0451843_1396408_847_1200 116
353 3300041512 Ga0451853_0700982 Ga0451853_0700982_181_531 116
354 3300041997 Ga0439431_0028768 Ga0439431_0028768_534_884 116
355 3300042000 Ga0439437_033057 Ga0439437_033057_82_432 116
356 3300042012 Ga0439455_0169533 Ga0439455_0169533_80_436 116
357 3300042015 Ga0439462_0004347 Ga0439462_0004347_1172_1528 116
358 3300042156 Ga0439446_0188609 Ga0439446_0188609_166_516 116
359 3300042157 Ga0439458_0011207 Ga0439458_0011207_1598_1954 116
360 3300044656 Ga0466969_0000116 Ga0466969_0000116_26491_26853 116
361 3300044656 Ga0466969_0008267 Ga0466969_0008267_482_838 116
362 3300044656 Ga0466969_0020677 Ga0466969_0020677_2842_3201 116
363 3300044658 Ga0466972_0100029 Ga0466972_0100029_586_942 116
364 3300044683 Ga0466965_0074245 Ga0466965_0074245_163_522 116
365 3300044683 Ga0466965_0141246 Ga0466965_0141246_101_463 116
366 3300044684 Ga0466966_0011764 Ga0466966_0011764_5298_5660 116
367 3300044684 Ga0466966_0017980 Ga0466966_0017980_152_511 116
368 3300044693 Ga0466961_0027291 Ga0466961_0027291_314_673 116
369 3300044712 Ga0453684_0945877 Ga0453684_0945877_443_802 116
370 3300044719 Ga0466971_0235633 Ga0466971_0235633_281_643 116
371 3300044719 Ga0466971_0375516 Ga0466971_0375516_52_411 116
372 3300044735 Ga0466968_0165070 Ga0466968_0165070_495_863 116
373 3300044765 Ga0466970_0079461 Ga0466970_0079461_703_1059 116
374 3300044765 Ga0466970_0118644 Ga0466970_0118644_279_638 116
375 3300044842 Ga0466957_0063226 Ga0466957_0063226_1796_2155 116
376 3300044901 Ga0466960_0224664 Ga0466960_0224664_17_373 116
377 3300045049 Ga0466959_0000395 Ga0466959_0000395_11216_11575 116
378 3300045049 Ga0466959_0005047 Ga0466959_0005047_2162_2524 116
379 3300045976 Ga0466967_0026999 Ga0466967_0026999_3811_4170 116
380 3300046460 Ga0495638_0442126 Ga0495638_0442126_105_461 116
381 3300046512 Ga0495610_0117614 Ga0495610_0117614_113_466 116
382 3300046515 Ga0495620_0147193 Ga0495620_0147193_53_406 116
383 3300046519 Ga0495632_0026696 Ga0495632_0026696_632_985 116
384 3300046542 Ga0495597_0211990 Ga0495597_0211990_164_517 116
385 3300046660 Ga0495625_0374860 Ga0495625_0374860_523_879 116
386 3300046692 Ga0495671_0146209 Ga0495671_0146209_93_446 116
387 3300048917 Ga0496114_0000806 Ga0496114_0000806_19924_20283 116
388 3300048924 Ga0496121_0176547 Ga0496121_0176547_125_475 116
389 3300048926 Ga0496123_0092780 Ga0496123_0092780_817_1191 116
390 3300048927 Ga0496124_0384200 Ga0496124_0384200_119_493 116
391 3300048928 Ga0496125_0011749 Ga0496125_0011749_4472_4846 116
392 3300048929 Ga0496126_0041394 Ga0496126_0041394_775_1149 116
393 3300049822 Ga0501035_0063457 Ga0501035_0063457_505_879 116
394 3300050492 nmdc:mga0yw44_72163_c1 nmdc:mga0yw44_72163_c1_211_567 116
395 3300050493 nmdc:mga0k408_16128_c1 nmdc:mga0k408_16128_c1_2387_2740 116
396 3300050493 nmdc:mga0k408_9226_c1 nmdc:mga0k408_9226_c1_2030_2380 116
397 3300050494 nmdc:mga06z11_90684_c1 nmdc:mga06z11_90684_c1_1238_1594 116
398 3300050496 nmdc:mga07m45_122786_c1 nmdc:mga07m45_122786_c1_1015_1368 116
399 3300050496 nmdc:mga07m45_37831_c1 nmdc:mga07m45_37831_c1_14_367 116
400 3300050496 nmdc:mga07m45_428003_c1 nmdc:mga07m45_428003_c1_61_414 116
401 3300050509 nmdc:mga0qj67_63362_c1 nmdc:mga0qj67_63362_c1_1546_1932 116
402 3300050510 nmdc:mga06r32_1197734_c1 nmdc:mga06r32_1197734_c1_301_687 116
403 3300053724 Ga0500570_133303 Ga0500570_133303_177_530 116
404 3300061719 Ga0466962_0015457 Ga0466962_0015457_3169_3528 116
405 3300009176 Ga0105242_10043053 Ga0105242_100430532 117
406 3300025934 Ga0207686_10007360 Ga0207686_100073601 117
407 3300037471 Ga0395905_0513119 Ga0395905_0513119_38_397 117
408 3300046660 Ga0495625_0001586 Ga0495625_0001586_16742_17101 117
409 3300002077 JGI24744J21845_10033667 JGI24744J21845_100336672 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

25

134

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9446 3 116
7y55-assembly2.cif.gz_D-3 crystal structure of a glutathione s-transferase tau1 from pinus densata in complex with gsh 0.922 3 33
7za4-assembly1.cif.gz_B gstf sh155 mutant 0.9205 3 33
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9132 3 116
6tjs-assembly1.cif.gz_AAA-2 gstf1 from alopecurus myosuroides 0.9079 3 33
ID Description Score Start End Superfamily
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9645 3 116 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9489 3 32 3.40.30.10
af_P0ACA1_1_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9458 5 33 3.40.30.10
1rw1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9425 3 116 3.40.30.10
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9248 3 116 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1A9HMA1-F1-model_v4 ArsC family transcriptional regulator 0.9915 3 116
AF-A0A1Y0N9P8-F1-model_v4 Regulatory protein Spx 0.9889 3 117
AF-Q21V00-F1-model_v4 Arsenate reductase 0.988 3 118
AF-A0A536VJL2-F1-model_v4 ArsC family reductase 0.9867 1 117
AF-A0A3P1XFI7-F1-model_v4 deleted 0.985 2 117

Feature Viewer

pLDDT pTM Quality
93.65 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map