F436897

General Info

Members Datasets Scaffolds Average Seq Length
409 289 391 124

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1000157|Ga0065165_100015771
Length 142
Sequence MIDHTGLVVSDFERSKDFYQKALSAIGYELLAILPANVTGRTDIAGFGEGGKPDFWIYQGEPNRPPVHVAFRVESQQLVRAFHEAALAAGGRDNGPPGPRSHYHAGYYGAFVLDPDGHNIEAVFHGGSLVHRDLSHPDTPPA

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
3 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
4 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
5 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
6 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
7 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
8 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
9 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
10 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
11 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
12 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
13 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
14 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
15 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
16 2941471342 Luteibacter sp. 621 Isolate Unclassified
17 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
18 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
190 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
191 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
272 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
273 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
274 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
275 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
285 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.6
Metatranscriptomes 0
Isolates 4.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 1.47
Rhizoplane 1.71
Rhizosphere 87.53
Stem 0
Stem Tuber 0
Unclassified 5.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10000314 3300002075 Bacteria 13351
2 rootH2_10044307 3300003320 Bacteria 2391
3 Ga0065165_1000157 3300005262 Bacteria 118005
4 Ga0070676_10033122 3300005328 Bacteria 2963
5 Ga0070676_10435882 3300005328 Bacteria 919
6 Ga0070690_100006991 3300005330 Bacteria 6431
7 Ga0070690_100960048 3300005330 Bacteria 671
8 Ga0070670_100009312 3300005331 Bacteria 8390
9 Ga0070670_100163148 3300005331 Bacteria 1932
10 Ga0070677_10039543 3300005333 Bacteria 1851
11 Ga0068869_100042104 3300005334 Bacteria 3273
12 Ga0068869_100075175 3300005334 Bacteria 2509
13 Ga0068869_100990512 3300005334 Bacteria 731
14 Ga0070666_10000883 3300005335 Bacteria 18203
15 Ga0070666_10033401 3300005335 Bacteria 3404
16 Ga0068868_100024734 3300005338 Bacteria 4559
17 Ga0070689_100000405 3300005340 Bacteria 25370
18 Ga0070689_101432075 3300005340 Bacteria 625
19 Ga0070668_101019315 3300005347 Bacteria 744
20 Ga0070669_100065999 3300005353 Bacteria 2667
21 Ga0070669_100207865 3300005353 Bacteria 1543
22 Ga0070669_100477932 3300005353 Bacteria 1031
23 Ga0070675_100094270 3300005354 Bacteria 2511
24 Ga0070675_100718868 3300005354 Unclassified 910
25 Ga0070671_100028890 3300005355 Bacteria 4569
26 Ga0070671_100380215 3300005355 Bacteria 1207
27 Ga0070671_100516512 3300005355 Bacteria 1028
28 Ga0070674_100000708 3300005356 Bacteria 16973
29 Ga0070674_100225337 3300005356 Bacteria 1460
30 Ga0070673_100002708 3300005364 Bacteria 10862
31 Ga0070688_100000683 3300005365 Bacteria 16890
32 Ga0070667_100007792 3300005367 Bacteria 8878
33 Ga0070667_100155755 3300005367 Bacteria 2009
34 Ga0070667_100182894 3300005367 Bacteria 1854
35 Ga0070709_10003881 3300005434 Bacteria 8057
36 Ga0070710_10005351 3300005437 Bacteria 6088
37 Ga0070711_100002923 3300005439 Bacteria 9845
38 Ga0070663_100115168 3300005455 Bacteria 2025
39 Ga0070663_100323627 3300005455 Bacteria 1241
40 Ga0070678_100035786 3300005456 Bacteria 3470
41 Ga0070662_100865224 3300005457 Bacteria 770
42 Ga0070681_10349020 3300005458 Bacteria 1390
43 Ga0070685_10000781 3300005466 Bacteria 17262
44 Ga0070685_10362515 3300005466 Bacteria 994
45 Ga0070685_11201633 3300005466 Bacteria 576
46 Ga0070706_100047656 3300005467 Bacteria 3955
47 Ga0070707_100180036 3300005468 Bacteria 2061
48 Ga0070707_101616133 3300005468 Bacteria 615
49 Ga0070698_100311454 3300005471 Unclassified 1505
50 Ga0070699_100030463 3300005518 Bacteria 4658
51 Ga0068853_101195173 3300005539 Bacteria 734
52 Ga0070672_100107727 3300005543 Bacteria 2268
53 Ga0070686_100009269 3300005544 Bacteria 5527
54 Ga0070696_100027759 3300005546 Bacteria 3860
55 Ga0070693_100004506 3300005547 Bacteria 6594
56 Ga0070665_100012399 3300005548 Bacteria 8591
57 Ga0070664_100397972 3300005564 Bacteria 1259
58 Ga0068854_100004788 3300005578 Bacteria 8535
59 Ga0068856_100016485 3300005614 Bacteria 7152
60 Ga0070702_100021363 3300005615 Bacteria 3404
61 Ga0068852_100489844 3300005616 Bacteria 1223
62 Ga0068859_100009913 3300005617 Bacteria 9622
63 Ga0068859_101735778 3300005617 Bacteria 689
64 Ga0068864_100017409 3300005618 Bacteria 5991
65 Ga0068866_10007029 3300005718 Bacteria 4705
66 Ga0068861_100415793 3300005719 Bacteria 1197
67 Ga0068861_100658813 3300005719 Bacteria 968
68 Ga0068861_102332056 3300005719 Bacteria 537
69 Ga0068851_10028129 3300005834 Bacteria 2775
70 Ga0068851_10190764 3300005834 Bacteria 1139
71 Ga0068870_10009728 3300005840 Bacteria 4384
72 Ga0068863_100026288 3300005841 Bacteria 5553
73 Ga0068858_100036483 3300005842 Bacteria 4559
74 Ga0068860_100030495 3300005843 Bacteria 5186
75 Ga0068860_100031074 3300005843 Bacteria 5135
76 Ga0081538_10127894 3300005981 Bacteria 1202
77 Ga0081538_10149045 3300005981 Bacteria 1063
78 Ga0070717_10275218 3300006028 Bacteria 1492
79 Ga0075365_10005640 3300006038 Bacteria 6777
80 Ga0070715_10054981 3300006163 Bacteria 1726
81 Ga0070716_100460019 3300006173 Bacteria 930
82 Ga0070712_100016494 3300006175 Bacteria 4774
83 Ga0075362_10131729 3300006177 Bacteria 1190
84 Ga0075366_10227516 3300006195 Bacteria 1136
85 Ga0097621_100026284 3300006237 Bacteria 4564
86 Ga0097621_100037602 3300006237 Bacteria 3880
87 Ga0068871_100029400 3300006358 Bacteria 4316
88 Ga0068871_100064326 3300006358 Bacteria 3003
89 Ga0075433_10479072 3300006852 Bacteria 1096
90 Ga0068865_100048848 3300006881 Bacteria 2914
91 Ga0068865_100147208 3300006881 Bacteria 1783
92 Ga0097620_100009913 3300006931 Bacteria 9622
93 Ga0097620_101735713 3300006931 Bacteria 689
94 Ga0111539_12505800 3300009094 Bacteria 598
95 Ga0105245_10004524 3300009098 Bacteria 12279
96 Ga0114129_11558727 3300009147 Unclassified 810
97 Ga0105243_10269672 3300009148 Bacteria 1527
98 Ga0105241_11132335 3300009174 Bacteria 738
99 Ga0105241_12538601 3300009174 Bacteria 514
100 Ga0105242_10006602 3300009176 Bacteria 8936
101 Ga0105242_10277264 3300009176 Bacteria 1521
102 Ga0105248_10007310 3300009177 Bacteria 12118
103 Ga0105248_10197679 3300009177 Bacteria 2266
104 Ga0105248_10594287 3300009177 Bacteria 1249
105 Ga0105238_10022895 3300009551 Bacteria 6369
106 Ga0105238_10850526 3300009551 Bacteria 929
107 Ga0105238_11668518 3300009551 Bacteria 668
108 Ga0105238_11788209 3300009551 Bacteria 646
109 Ga0105239_10856942 3300010375 Bacteria 1042
110 Ga0105246_10763770 3300011119 Bacteria 854
111 Ga0157371_10062807 3300013102 Bacteria 2632
112 Ga0157369_10002359 3300013105 Bacteria 22710
113 Ga0157378_10072022 3300013297 Bacteria 3104
114 Ga0163162_10024462 3300013306 Bacteria 5962
115 Ga0163162_10326923 3300013306 Bacteria 1666
116 Ga0157372_11806443 3300013307 Bacteria 703
117 Ga0157375_10005247 3300013308 Bacteria 11248
118 Ga0157375_10435692 3300013308 Bacteria 1477
119 Ga0157375_11269555 3300013308 Bacteria 865
120 Ga0163163_10101133 3300014325 Bacteria 2905
121 Ga0163163_12487644 3300014325 Bacteria 576
122 Ga0157380_10159732 3300014326 Bacteria 1958
123 Ga0182008_10000201 3300014497 Bacteria 46905
124 Ga0157379_10705305 3300014968 Bacteria 947
125 Ga0157379_11087984 3300014968 Bacteria 765
126 Ga0157376_10063420 3300014969 Bacteria 3113
127 Ga0157376_11168398 3300014969 Bacteria 797
128 Ga0182006_1000222 3300015261 Bacteria 55421
129 Ga0182005_1000449 3300015265 Bacteria 21855
130 Ga0163161_10030598 3300017792 Bacteria 3833
131 Ga0213872_10049726 3300021361 Bacteria 1904
132 Ga0209674_100474 3300025226 Bacteria 17524
133 Ga0209437_102541 3300025233 Bacteria 3516
134 Ga0209148_1003168 3300025254 Bacteria 4738
135 Ga0207426_1004943 3300025302 Bacteria 6284
136 Ga0207426_1025932 3300025302 Bacteria 1969
137 Ga0207697_10133487 3300025315 Bacteria 1074
138 Ga0207656_10128049 3300025321 Unclassified 1187
139 Ga0207682_10002503 3300025893 Bacteria 8213
140 Ga0207682_10133354 3300025893 Bacteria 1110
141 Ga0207692_10800323 3300025898 Bacteria 616
142 Ga0207642_10025498 3300025899 Bacteria 2393
143 Ga0207710_10035397 3300025900 Bacteria 2197
144 Ga0207688_10178503 3300025901 Bacteria 1266
145 Ga0207680_10019916 3300025903 Bacteria 3599
146 Ga0207680_10154888 3300025903 Bacteria 1531
147 Ga0207647_10000009 3300025904 Bacteria 181324
148 Ga0207685_10009453 3300025905 Bacteria 2833
149 Ga0207699_10035520 3300025906 Bacteria 2836
150 Ga0207645_10342148 3300025907 Bacteria 1000
151 Ga0207643_10575591 3300025908 Bacteria 724
152 Ga0207643_10723219 3300025908 Bacteria 644
153 Ga0207684_10133772 3300025910 Bacteria 2128
154 Ga0207654_10029510 3300025911 Bacteria 3004
155 Ga0207693_10000325 3300025915 Bacteria 44161
156 Ga0207663_10001645 3300025916 Bacteria 10535
157 Ga0207650_10120469 3300025925 Bacteria 2042
158 Ga0207650_10229687 3300025925 Bacteria 1496
159 Ga0207659_10548789 3300025926 Bacteria 982
160 Ga0207687_10002556 3300025927 Bacteria 12360
161 Ga0207687_10103818 3300025927 Bacteria 2097
162 Ga0207700_10010506 3300025928 Bacteria 5846
163 Ga0207644_10003120 3300025931 Bacteria 10665
164 Ga0207644_10059832 3300025931 Bacteria 2756
165 Ga0207644_11207306 3300025931 Bacteria 636
166 Ga0207706_10008355 3300025933 Bacteria 9550
167 Ga0207686_10001142 3300025934 Bacteria 15331
168 Ga0207686_10017354 3300025934 Bacteria 4055
169 Ga0207686_10079987 3300025934 Bacteria 2130
170 Ga0207670_10004331 3300025936 Bacteria 7625
171 Ga0207669_10007901 3300025937 Bacteria 4959
172 Ga0207669_10756366 3300025937 Bacteria 803
173 Ga0207669_10809684 3300025937 Bacteria 777
174 Ga0207704_10140261 3300025938 Bacteria 1689
175 Ga0207704_10189073 3300025938 Bacteria 1496
176 Ga0207704_10393860 3300025938 Unclassified 1091
177 Ga0207665_10022106 3300025939 Bacteria 4181
178 Ga0207691_10047774 3300025940 Bacteria 3926
179 Ga0207691_10082098 3300025940 Bacteria 2896
180 Ga0207711_10000206 3300025941 Bacteria 62928
181 Ga0207711_10147875 3300025941 Bacteria 2118
182 Ga0207711_10568062 3300025941 Bacteria 1058
183 Ga0207689_10034225 3300025942 Bacteria 4219
184 Ga0207661_10798444 3300025944 Bacteria 869
185 Ga0207679_10253958 3300025945 Bacteria 1496
186 Ga0207651_10001984 3300025960 Bacteria 9623
187 Ga0207668_10292963 3300025972 Bacteria 1340
188 Ga0207640_10012908 3300025981 Bacteria 4772
189 Ga0207658_10017499 3300025986 Bacteria 4940
190 Ga0207658_11460189 3300025986 Bacteria 625
191 Ga0207677_10004097 3300026023 Bacteria 7795
192 Ga0207703_10001548 3300026035 Bacteria 20841
193 Ga0207678_10055102 3300026067 Bacteria 3425
194 Ga0207702_10099904 3300026078 Bacteria 2559
195 Ga0207641_10005413 3300026088 Bacteria 10900
196 Ga0207641_11681088 3300026088 Bacteria 637
197 Ga0207648_10029503 3300026089 Bacteria 4864
198 Ga0207676_10163635 3300026095 Bacteria 1930
199 Ga0207683_10000671 3300026121 Bacteria 31464
200 Ga0207683_10252198 3300026121 Bacteria 1611
201 Ga0207698_10217069 3300026142 Unclassified 1725
202 Ga0268266_10021020 3300028379 Bacteria 5563
203 Ga0268266_10372677 3300028379 Bacteria 1345
204 Ga0268264_10000781 3300028381 Bacteria 34982
205 Ga0268264_10136761 3300028381 Bacteria 2179
206 Ga0307515_10766276 3300028794 Bacteria 585
207 Ga0307405_10247349 3300031731 Unclassified 1325
208 Ga0307405_10273824 3300031731 Bacteria 1267
209 Ga0307407_10769171 3300031903 Bacteria 730
210 Ga0307412_10000359 3300031911 Bacteria 28383
211 Ga0307412_11077382 3300031911 Bacteria 714
212 Ga0307412_11620353 3300031911 Bacteria 591
213 Ga0307409_100187989 3300031995 Unclassified 1835
214 Ga0307414_10852032 3300032004 Bacteria 833
215 Ga0307415_100496312 3300032126 Bacteria 1066
216 Ga0373926_0065426 3300035083 Bacteria 1330
217 Ga0373923_0001607 3300035111 Bacteria 6585
218 Ga0373936_0019087 3300035113 Bacteria 2655
219 Ga0373936_0087200 3300035113 Bacteria 1305
220 Ga0373936_0090721 3300035113 Bacteria 1281
221 Ga0373936_0123884 3300035113 Bacteria 1106
222 Ga0373945_0019264 3300035116 Bacteria 2329
223 Ga0373945_0029440 3300035116 Unclassified 1930
224 Ga0373953_0332103 3300035117 Bacteria 665
225 Ga0373954_0185188 3300035118 Bacteria 1021
226 Ga0373954_0463790 3300035118 Bacteria 627
227 Ga0373943_0039286 3300035170 Bacteria 2279
228 Ga0373943_0091266 3300035170 Unclassified 1578
229 Ga0373943_0433981 3300035170 Bacteria 761
230 Ga0373946_0101178 3300035171 Bacteria 1292
231 Ga0373955_0001122 3300035172 Bacteria 11355
232 Ga0373955_0168024 3300035172 Bacteria 1297
233 Ga0373924_0173853 3300035410 Bacteria 947
234 Ga0373935_0121339 3300035692 Unclassified 1747
235 Ga0373935_0135921 3300035692 Bacteria 1656
236 Ga0373927_0102258 3300035695 Bacteria 1864
237 Ga0373927_0209532 3300035695 Bacteria 1280
238 Ga0373927_1087171 3300035695 Unclassified 527
239 Ga0373947_0008671 3300035725 Bacteria 5850
240 Ga0373947_0077549 3300035725 Bacteria 2049
241 Ga0373937_0623958 3300036401 Bacteria 1023
242 Ga0373925_0011050 3300037068 Bacteria 6557
243 Ga0373925_0194488 3300037068 Bacteria 1610
244 Ga0373925_0526464 3300037068 Bacteria 971
245 Ga0395899_0017088 3300037312 Bacteria 5527
246 Ga0395899_0300640 3300037312 Bacteria 1086
247 Ga0395898_0053446 3300037466 Bacteria 3945
248 Ga0395898_0189539 3300037466 Bacteria 1965
249 Ga0395905_0000292 3300037471 Bacteria 73325
250 Ga0395905_0008150 3300037471 Bacteria 10348
251 Ga0395901_0013189 3300038443 Bacteria 8391
252 Ga0436365_1240230 3300039437 Bacteria 1018
253 Ga0436361_1026399 3300039447 Bacteria 3427
254 Ga0439436_0000011 3300041404 Bacteria 100668
255 Ga0439436_0225774 3300041404 Bacteria 539
256 Ga0451849_1527781 3300041505 Bacteria 737
257 Ga0439462_0022426 3300042015 Bacteria 1652
258 Ga0450906_024728 3300042145 Bacteria 1067
259 Ga0466965_0560165 3300044683 Bacteria 646
260 Ga0466961_0272250 3300044693 Bacteria 1037
261 Ga0466964_0637638 3300044706 Bacteria 588
262 Ga0466971_0323525 3300044719 Bacteria 743
263 Ga0466957_0169828 3300044842 Bacteria 1420
264 Ga0466960_0325742 3300044901 Bacteria 871
265 Ga0495592_0289072 3300046454 Bacteria 1069
266 Ga0495651_0011016 3300046462 Bacteria 6958
267 Ga0495651_0074188 3300046462 Bacteria 2582
268 Ga0495653_0086422 3300046463 Bacteria 2305
269 Ga0495650_0228932 3300046471 Bacteria 638
270 Ga0495580_0106700 3300046472 Bacteria 1945
271 Ga0495580_0158760 3300046472 Unclassified 1565
272 Ga0495582_0010846 3300046473 Bacteria 5014
273 Ga0495639_0008129 3300046475 Bacteria 4505
274 Ga0495639_0244234 3300046475 Bacteria 886
275 Ga0495662_0061257 3300046476 Bacteria 1818
276 Ga0495662_0063012 3300046476 Bacteria 1791
277 Ga0495662_0071103 3300046476 Unclassified 1686
278 Ga0495664_0027013 3300046477 Bacteria 3345
279 Ga0495664_0075089 3300046477 Bacteria 2022
280 Ga0495664_0156410 3300046477 Unclassified 1383
281 Ga0495664_0581143 3300046477 Bacteria 666
282 Ga0495594_0335295 3300046499 Bacteria 861
283 Ga0495583_0000005 3300046506 Bacteria 636894
284 Ga0495608_0085583 3300046511 Bacteria 2043
285 Ga0495608_0573688 3300046511 Bacteria 679
286 Ga0495610_0009354 3300046512 Bacteria 6204
287 Ga0495628_0023797 3300046516 Bacteria 5022
288 Ga0495628_0555725 3300046516 Bacteria 824
289 Ga0495630_0063847 3300046517 Bacteria 2766
290 Ga0495630_0254159 3300046517 Unclassified 1343
291 Ga0495632_0000209 3300046519 Bacteria 59281
292 Ga0495648_0054556 3300046524 Bacteria 2414
293 Ga0495648_0311305 3300046524 Bacteria 734
294 Ga0495652_0034008 3300046529 Bacteria 4445
295 Ga0495665_0017576 3300046531 Bacteria 3846
296 Ga0495665_0257137 3300046531 Bacteria 898
297 Ga0495665_0525368 3300046531 Bacteria 595
298 Ga0495640_0147006 3300046533 Bacteria 1516
299 Ga0495640_0305170 3300046533 Bacteria 988
300 Ga0495640_0377567 3300046533 Bacteria 872
301 Ga0495587_0011541 3300046536 Bacteria 5594
302 Ga0495587_0019503 3300046536 Bacteria 4195
303 Ga0495621_0014825 3300046539 Bacteria 2475
304 Ga0495645_0019130 3300046543 Bacteria 4930
305 Ga0495645_0096231 3300046543 Bacteria 2110
306 Ga0495645_0430373 3300046543 Bacteria 836
307 Ga0495667_0021063 3300046559 Bacteria 4398
308 Ga0495667_0050748 3300046559 Bacteria 2738
309 Ga0495668_0490884 3300046616 Bacteria 677
310 Ga0495634_0118966 3300046642 Bacteria 1693
311 Ga0495634_0491550 3300046642 Bacteria 720
312 Ga0495625_0000229 3300046660 Bacteria 88436
313 Ga0495625_0003104 3300046660 Bacteria 16977
314 Ga0495625_0606137 3300046660 Unclassified 657
315 Ga0495635_0085640 3300046663 Bacteria 2156
316 Ga0495635_0180346 3300046663 Bacteria 1435
317 Ga0495659_0048431 3300046664 Bacteria 1540
318 Ga0495588_0091826 3300046674 Bacteria 1591
319 Ga0495657_0005333 3300046675 Bacteria 10169
320 Ga0495599_0129369 3300046678 Bacteria 1568
321 Ga0495647_0410192 3300046681 Bacteria 623
322 Ga0495658_0019308 3300046683 Unclassified 3555
323 Ga0495613_0054417 3300046689 Bacteria 2942
324 Ga0495613_0163530 3300046689 Bacteria 1582
325 Ga0495624_0201550 3300046690 Bacteria 1209
326 Ga0495624_0527292 3300046690 Bacteria 706
327 Ga0495670_0221939 3300046691 Bacteria 1004
328 Ga0495670_0575088 3300046691 Bacteria 613
329 Ga0495649_0012545 3300046694 Bacteria 4922
330 Ga0495600_0009079 3300046809 Bacteria 6132
331 Ga0495600_0137775 3300046809 Bacteria 1584
332 Ga0495581_0000884 3300047315 Bacteria 16023
333 Ga0495581_0771669 3300047315 Bacteria 552
334 Ga0495604_0045562 3300047317 Bacteria 3422
335 Ga0495674_0152631 3300047319 Bacteria 1936
336 Ga0495674_0751886 3300047319 Bacteria 762
337 Ga0495680_0024087 3300047322 Bacteria 5053
338 Ga0495680_0025085 3300047322 Bacteria 4938
339 Ga0495675_0015291 3300047444 Bacteria 4853
340 Ga0495684_0444456 3300047471 Unclassified 902
341 Ga0495686_0039833 3300047472 Bacteria 2999
342 Ga0495602_0083052 3300048088 Bacteria 2685
343 Ga0495614_0186981 3300048089 Bacteria 933
344 Ga0496101_0226775 3300048904 Bacteria 1451
345 Ga0496103_0357405 3300048906 Bacteria 939
346 Ga0496110_0462156 3300048913 Bacteria 1156
347 Ga0496110_1480264 3300048913 Bacteria 589
348 Ga0496112_0003976 3300048915 Bacteria 12383
349 Ga0496114_0036130 3300048917 Bacteria 4084
350 Ga0496116_0313488 3300048919 Bacteria 739
351 Ga0496117_0041217 3300048920 Bacteria 3386
352 Ga0496118_0020024 3300048921 Bacteria 5953
353 Ga0496119_0061149 3300048922 Bacteria 2251
354 Ga0496121_0000448 3300048924 Bacteria 81254
355 Ga0496122_0027799 3300048925 Bacteria 4823
356 Ga0496122_0027897 3300048925 Bacteria 4812
357 Ga0496123_0009603 3300048926 Bacteria 8687
358 Ga0496123_0109470 3300048926 Bacteria 1583
359 Ga0496124_0104980 3300048927 Bacteria 2284
360 Ga0496125_0006544 3300048928 Bacteria 12558
361 Ga0501300_000859 3300049523 Bacteria 4640
362 Ga0501034_0159741 3300049571 Bacteria 2226
363 Ga0501034_0268074 3300049571 Bacteria 1649
364 Ga0501046_0184245 3300049580 Bacteria 1560
365 Ga0501047_1294335 3300049581 Bacteria 543
366 Ga0501067_0000400 3300049583 Bacteria 23694
367 Ga0501068_0000406 3300049584 Bacteria 21790
368 Ga0501069_0000074 3300049585 Bacteria 49633
369 Ga0501070_0534821 3300049586 Bacteria 939
370 Ga0501071_0013316 3300049587 Bacteria 5603
371 Ga0501073_0264810 3300049589 Bacteria 1186
372 Ga0501077_0436689 3300049593 Bacteria 838
373 Ga0501214_062929 3300049659 Bacteria 590
374 Ga0501259_021198 3300049688 Unclassified 1159
375 Ga0501221_173842 3300049704 Bacteria 585
376 Ga0501225_0329773 3300049705 Bacteria 523
377 Ga0501234_023274 3300049707 Bacteria 991
378 Ga0501080_0081908 3300049742 Bacteria 2998
379 Ga0501044_1680073 3300049823 Unclassified 500
380 nmdc:mga0yw44_22306_c1 3300050492 Bacteria 3549
381 nmdc:mga0k408_219265_c1 3300050493 Bacteria 1136
382 nmdc:mga0n895_53243_c1 3300050512 Bacteria 3976
383 Ga0495601_0986375 3300053077 Unclassified 530
384 Ga0495595_0377096 3300053084 Bacteria 717
385 Ga0495619_0001956 3300053085 Bacteria 13738
386 Ga0500583_0065828 3300053092 Bacteria 1723
387 Ga0500588_0000256 3300053146 Bacteria 7678
388 Ga0500616_0358965 3300053153 Bacteria 591
389 Ga0501084_0337107 3300054114 Bacteria 1274
390 Ga0501082_1996629 3300060353 Bacteria 506
391 Ga0530510_0009898 3300061734 Bacteria 6691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032126 Ga0307415_100496312 Ga0307415_1004963121 98
2 3300031731 Ga0307405_10247349 Ga0307405_102473492 105
3 3300031911 Ga0307412_11620353 Ga0307412_116203531 105
4 3300049707 Ga0501234_023274 Ga0501234_023274_570_947 105
5 3300006038 Ga0075365_10005640 Ga0075365_100056403 107
6 3300006177 Ga0075362_10131729 Ga0075362_101317292 107
7 3300049523 Ga0501300_000859 Ga0501300_000859_1470_1898 107
8 3300049589 Ga0501073_0264810 Ga0501073_0264810_713_1126 107
9 3300049742 Ga0501080_0081908 Ga0501080_0081908_773_1189 107
10 3300050492 nmdc:mga0yw44_22306_c1 nmdc:mga0yw44_22306_c1_742_1161 107
11 3300005328 Ga0070676_10435882 Ga0070676_104358821 109
12 3300005347 Ga0070668_101019315 Ga0070668_1010193151 109
13 3300005353 Ga0070669_100477932 Ga0070669_1004779322 109
14 3300005367 Ga0070667_100182894 Ga0070667_1001828943 109
15 3300005468 Ga0070707_100180036 Ga0070707_1001800362 109
16 3300005719 Ga0068861_100415793 Ga0068861_1004157931 109
17 3300009174 Ga0105241_11132335 Ga0105241_111323352 109
18 3300025907 Ga0207645_10342148 Ga0207645_103421482 109
19 3300028379 Ga0268266_10372677 Ga0268266_103726774 109
20 3300046616 Ga0495668_0490884 Ga0495668_0490884_123_494 109
21 3300048906 Ga0496103_0357405 Ga0496103_0357405_78_461 109
22 3300005981 Ga0081538_10149045 Ga0081538_101490452 111
23 3300025944 Ga0207661_10798444 Ga0207661_107984442 111
24 3300031903 Ga0307407_10769171 Ga0307407_107691711 111
25 3300031995 Ga0307409_100187989 Ga0307409_1001879892 111
26 3300032004 Ga0307414_10852032 Ga0307414_108520321 111
27 3300049659 Ga0501214_062929 Ga0501214_062929_156_551 111
28 3300049688 Ga0501259_021198 Ga0501259_021198_353_748 111
29 3300049704 Ga0501221_173842 Ga0501221_173842_22_420 111
30 3300049705 Ga0501225_0329773 Ga0501225_0329773_84_479 111
31 3300005458 Ga0070681_10349020 Ga0070681_103490202 115
32 3300005518 Ga0070699_100030463 Ga0070699_1000304632 115
33 3300044842 Ga0466957_0169828 Ga0466957_0169828_744_1178 115
34 3300031911 Ga0307412_11077382 Ga0307412_110773822 116
35 3300049580 Ga0501046_0184245 Ga0501046_0184245_330_695 117
36 3300054114 Ga0501084_0337107 Ga0501084_0337107_20_385 117
37 3300060353 Ga0501082_1996629 Ga0501082_1996629_35_466 117
38 iso_pu_bacteria 2847670302 2847671091 117
39 iso_pu_bacteria 2856314179 2856316606 117
40 iso_pu_bacteria 2878035449 2878036789 117
41 iso_pu_bacteria 2906414383 2906416743 117
42 iso_pu_bacteria 2909399089 2909400456 117
43 3300039437 Ga0436365_1240230 Ga0436365_1240230_49_405 118
44 3300005981 Ga0081538_10127894 Ga0081538_101278942 119
45 3300006852 Ga0075433_10479072 Ga0075433_104790722 119
46 3300009147 Ga0114129_11558727 Ga0114129_115587271 119
47 3300011119 Ga0105246_10763770 Ga0105246_107637702 119
48 3300037312 Ga0395899_0017088 Ga0395899_0017088_838_1200 119
49 3300037312 Ga0395899_0300640 Ga0395899_0300640_327_689 119
50 3300037466 Ga0395898_0053446 Ga0395898_0053446_2587_2949 119
51 3300037466 Ga0395898_0189539 Ga0395898_0189539_246_608 119
52 3300037471 Ga0395905_0008150 Ga0395905_0008150_4444_4806 119
53 3300038443 Ga0395901_0013189 Ga0395901_0013189_4168_4530 119
54 3300049823 Ga0501044_1680073 Ga0501044_1680073_29_412 119
55 3300050512 nmdc:mga0n895_53243_c1 nmdc:mga0n895_53243_c1_739_1104 119
56 3300005328 Ga0070676_10033122 Ga0070676_100331223 120
57 3300005330 Ga0070690_100006991 Ga0070690_1000069914 120
58 3300005330 Ga0070690_100960048 Ga0070690_1009600481 120
59 3300005331 Ga0070670_100009312 Ga0070670_1000093123 120
60 3300005333 Ga0070677_10039543 Ga0070677_100395433 120
61 3300005334 Ga0068869_100042104 Ga0068869_1000421046 120
62 3300005334 Ga0068869_100075175 Ga0068869_1000751752 120
63 3300005334 Ga0068869_100990512 Ga0068869_1009905122 120
64 3300005335 Ga0070666_10000883 Ga0070666_100008836 120
65 3300005335 Ga0070666_10033401 Ga0070666_100334014 120
66 3300005338 Ga0068868_100024734 Ga0068868_1000247344 120
67 3300005340 Ga0070689_100000405 Ga0070689_10000040522 120
68 3300005340 Ga0070689_101432075 Ga0070689_1014320751 120
69 3300005353 Ga0070669_100065999 Ga0070669_1000659991 120
70 3300005353 Ga0070669_100207865 Ga0070669_1002078653 120
71 3300005354 Ga0070675_100094270 Ga0070675_1000942702 120
72 3300005354 Ga0070675_100718868 Ga0070675_1007188682 120
73 3300005355 Ga0070671_100028890 Ga0070671_1000288904 120
74 3300005355 Ga0070671_100380215 Ga0070671_1003802151 120
75 3300005355 Ga0070671_100516512 Ga0070671_1005165122 120
76 3300005356 Ga0070674_100000708 Ga0070674_1000007087 120
77 3300005356 Ga0070674_100225337 Ga0070674_1002253372 120
78 3300005364 Ga0070673_100002708 Ga0070673_10000270812 120
79 3300005365 Ga0070688_100000683 Ga0070688_10000068333 120
80 3300005367 Ga0070667_100007792 Ga0070667_10000779214 120
81 3300005367 Ga0070667_100155755 Ga0070667_1001557554 120
82 3300005434 Ga0070709_10003881 Ga0070709_1000388116 120
83 3300005437 Ga0070710_10005351 Ga0070710_100053511 120
84 3300005439 Ga0070711_100002923 Ga0070711_1000029234 120
85 3300005455 Ga0070663_100115168 Ga0070663_1001151683 120
86 3300005455 Ga0070663_100323627 Ga0070663_1003236273 120
87 3300005456 Ga0070678_100035786 Ga0070678_1000357864 120
88 3300005457 Ga0070662_100865224 Ga0070662_1008652241 120
89 3300005466 Ga0070685_10000781 Ga0070685_1000078119 120
90 3300005466 Ga0070685_11201633 Ga0070685_112016331 120
91 3300005539 Ga0068853_101195173 Ga0068853_1011951731 120
92 3300005543 Ga0070672_100107727 Ga0070672_1001077274 120
93 3300005544 Ga0070686_100009269 Ga0070686_1000092699 120
94 3300005546 Ga0070696_100027759 Ga0070696_1000277597 120
95 3300005547 Ga0070693_100004506 Ga0070693_1000045062 120
96 3300005548 Ga0070665_100012399 Ga0070665_10001239912 120
97 3300005564 Ga0070664_100397972 Ga0070664_1003979722 120
98 3300005578 Ga0068854_100004788 Ga0068854_1000047888 120
99 3300005614 Ga0068856_100016485 Ga0068856_1000164854 120
100 3300005615 Ga0070702_100021363 Ga0070702_1000213634 120
101 3300005616 Ga0068852_100489844 Ga0068852_1004898442 120
102 3300005617 Ga0068859_100009913 Ga0068859_1000099133 120
103 3300005617 Ga0068859_101735778 Ga0068859_1017357781 120
104 3300005618 Ga0068864_100017409 Ga0068864_1000174099 120
105 3300005718 Ga0068866_10007029 Ga0068866_100070297 120
106 3300005719 Ga0068861_100658813 Ga0068861_1006588132 120
107 3300005719 Ga0068861_102332056 Ga0068861_1023320562 120
108 3300005834 Ga0068851_10028129 Ga0068851_100281292 120
109 3300005834 Ga0068851_10190764 Ga0068851_101907642 120
110 3300005840 Ga0068870_10009728 Ga0068870_100097286 120
111 3300005841 Ga0068863_100026288 Ga0068863_10002628810 120
112 3300005842 Ga0068858_100036483 Ga0068858_1000364834 120
113 3300005843 Ga0068860_100030495 Ga0068860_1000304956 120
114 3300005843 Ga0068860_100031074 Ga0068860_1000310744 120
115 3300006163 Ga0070715_10054981 Ga0070715_100549812 120
116 3300006173 Ga0070716_100460019 Ga0070716_1004600192 120
117 3300006175 Ga0070712_100016494 Ga0070712_1000164944 120
118 3300006195 Ga0075366_10227516 Ga0075366_102275162 120
119 3300006237 Ga0097621_100026284 Ga0097621_1000262843 120
120 3300006237 Ga0097621_100037602 Ga0097621_1000376025 120
121 3300006358 Ga0068871_100029400 Ga0068871_1000294006 120
122 3300006358 Ga0068871_100064326 Ga0068871_1000643263 120
123 3300006881 Ga0068865_100048848 Ga0068865_1000488485 120
124 3300006881 Ga0068865_100147208 Ga0068865_1001472082 120
125 3300006931 Ga0097620_100009913 Ga0097620_1000099133 120
126 3300006931 Ga0097620_101735713 Ga0097620_1017357131 120
127 3300009098 Ga0105245_10004524 Ga0105245_1000452417 120
128 3300009148 Ga0105243_10269672 Ga0105243_102696723 120
129 3300009176 Ga0105242_10006602 Ga0105242_100066024 120
130 3300009176 Ga0105242_10277264 Ga0105242_102772642 120
131 3300009177 Ga0105248_10007310 Ga0105248_100073106 120
132 3300009177 Ga0105248_10197679 Ga0105248_101976795 120
133 3300009177 Ga0105248_10594287 Ga0105248_105942872 120
134 3300009551 Ga0105238_10022895 Ga0105238_100228953 120
135 3300009551 Ga0105238_10850526 Ga0105238_108505261 120
136 3300009551 Ga0105238_11668518 Ga0105238_116685181 120
137 3300010375 Ga0105239_10856942 Ga0105239_108569422 120
138 3300013102 Ga0157371_10062807 Ga0157371_100628072 120
139 3300013297 Ga0157378_10072022 Ga0157378_100720221 120
140 3300013306 Ga0163162_10024462 Ga0163162_100244626 120
141 3300013306 Ga0163162_10326923 Ga0163162_103269231 120
142 3300013308 Ga0157375_10005247 Ga0157375_1000524710 120
143 3300013308 Ga0157375_10435692 Ga0157375_104356923 120
144 3300013308 Ga0157375_11269555 Ga0157375_112695552 120
145 3300014325 Ga0163163_12487644 Ga0163163_124876441 120
146 3300014326 Ga0157380_10159732 Ga0157380_101597323 120
147 3300014968 Ga0157379_10705305 Ga0157379_107053052 120
148 3300014968 Ga0157379_11087984 Ga0157379_110879842 120
149 3300014969 Ga0157376_10063420 Ga0157376_100634204 120
150 3300014969 Ga0157376_11168398 Ga0157376_111683981 120
151 3300017792 Ga0163161_10030598 Ga0163161_100305983 120
152 3300025315 Ga0207697_10133487 Ga0207697_101334871 120
153 3300025321 Ga0207656_10128049 Ga0207656_101280492 120
154 3300025893 Ga0207682_10002503 Ga0207682_100025036 120
155 3300025893 Ga0207682_10133354 Ga0207682_101333542 120
156 3300025899 Ga0207642_10025498 Ga0207642_100254984 120
157 3300025900 Ga0207710_10035397 Ga0207710_100353974 120
158 3300025901 Ga0207688_10178503 Ga0207688_101785032 120
159 3300025903 Ga0207680_10019916 Ga0207680_100199165 120
160 3300025903 Ga0207680_10154888 Ga0207680_101548883 120
161 3300025905 Ga0207685_10009453 Ga0207685_100094534 120
162 3300025906 Ga0207699_10035520 Ga0207699_100355202 120
163 3300025908 Ga0207643_10723219 Ga0207643_107232191 120
164 3300025911 Ga0207654_10029510 Ga0207654_100295106 120
165 3300025915 Ga0207693_10000325 Ga0207693_100003258 120
166 3300025916 Ga0207663_10001645 Ga0207663_1000164512 120
167 3300025925 Ga0207650_10229687 Ga0207650_102296874 120
168 3300025926 Ga0207659_10548789 Ga0207659_105487892 120
169 3300025927 Ga0207687_10002556 Ga0207687_1000255619 120
170 3300025927 Ga0207687_10103818 Ga0207687_101038184 120
171 3300025928 Ga0207700_10010506 Ga0207700_100105069 120
172 3300025931 Ga0207644_10003120 Ga0207644_1000312015 120
173 3300025931 Ga0207644_10059832 Ga0207644_100598323 120
174 3300025931 Ga0207644_11207306 Ga0207644_112073061 120
175 3300025933 Ga0207706_10008355 Ga0207706_1000835520 120
176 3300025934 Ga0207686_10001142 Ga0207686_1000114228 120
177 3300025934 Ga0207686_10017354 Ga0207686_100173543 120
178 3300025934 Ga0207686_10079987 Ga0207686_100799873 120
179 3300025936 Ga0207670_10004331 Ga0207670_100043317 120
180 3300025937 Ga0207669_10007901 Ga0207669_100079018 120
181 3300025937 Ga0207669_10756366 Ga0207669_107563662 120
182 3300025937 Ga0207669_10809684 Ga0207669_108096842 120
183 3300025938 Ga0207704_10140261 Ga0207704_101402614 120
184 3300025938 Ga0207704_10189073 Ga0207704_101890732 120
185 3300025938 Ga0207704_10393860 Ga0207704_103938602 120
186 3300025939 Ga0207665_10022106 Ga0207665_100221069 120
187 3300025940 Ga0207691_10047774 Ga0207691_100477744 120
188 3300025940 Ga0207691_10082098 Ga0207691_100820985 120
189 3300025941 Ga0207711_10000206 Ga0207711_1000020661 120
190 3300025941 Ga0207711_10147875 Ga0207711_101478753 120
191 3300025941 Ga0207711_10568062 Ga0207711_105680622 120
192 3300025942 Ga0207689_10034225 Ga0207689_100342254 120
193 3300025945 Ga0207679_10253958 Ga0207679_102539582 120
194 3300025960 Ga0207651_10001984 Ga0207651_100019842 120
195 3300025972 Ga0207668_10292963 Ga0207668_102929633 120
196 3300025981 Ga0207640_10012908 Ga0207640_100129084 120
197 3300025986 Ga0207658_10017499 Ga0207658_100174995 120
198 3300025986 Ga0207658_11460189 Ga0207658_114601892 120
199 3300026023 Ga0207677_10004097 Ga0207677_1000409712 120
200 3300026035 Ga0207703_10001548 Ga0207703_100015489 120
201 3300026067 Ga0207678_10055102 Ga0207678_100551025 120
202 3300026078 Ga0207702_10099904 Ga0207702_100999042 120
203 3300026088 Ga0207641_10005413 Ga0207641_100054136 120
204 3300026088 Ga0207641_11681088 Ga0207641_116810881 120
205 3300026089 Ga0207648_10029503 Ga0207648_100295035 120
206 3300026095 Ga0207676_10163635 Ga0207676_101636352 120
207 3300026121 Ga0207683_10000671 Ga0207683_1000067143 120
208 3300026121 Ga0207683_10252198 Ga0207683_102521981 120
209 3300026142 Ga0207698_10217069 Ga0207698_102170692 120
210 3300028379 Ga0268266_10021020 Ga0268266_100210206 120
211 3300028381 Ga0268264_10000781 Ga0268264_1000078139 120
212 3300028381 Ga0268264_10136761 Ga0268264_101367612 120
213 3300035083 Ga0373926_0065426 Ga0373926_0065426_400_768 120
214 3300035111 Ga0373923_0001607 Ga0373923_0001607_3984_4352 120
215 3300035113 Ga0373936_0019087 Ga0373936_0019087_1861_2229 120
216 3300035113 Ga0373936_0087200 Ga0373936_0087200_473_841 120
217 3300035113 Ga0373936_0090721 Ga0373936_0090721_138_506 120
218 3300035113 Ga0373936_0123884 Ga0373936_0123884_660_1028 120
219 3300035116 Ga0373945_0019264 Ga0373945_0019264_1142_1510 120
220 3300035116 Ga0373945_0029440 Ga0373945_0029440_123_491 120
221 3300035117 Ga0373953_0332103 Ga0373953_0332103_122_490 120
222 3300035118 Ga0373954_0185188 Ga0373954_0185188_372_740 120
223 3300035170 Ga0373943_0039286 Ga0373943_0039286_633_1001 120
224 3300035170 Ga0373943_0091266 Ga0373943_0091266_58_426 120
225 3300035170 Ga0373943_0433981 Ga0373943_0433981_258_626 120
226 3300035171 Ga0373946_0101178 Ga0373946_0101178_287_655 120
227 3300035172 Ga0373955_0001122 Ga0373955_0001122_4362_4730 120
228 3300035172 Ga0373955_0168024 Ga0373955_0168024_737_1105 120
229 3300035410 Ga0373924_0173853 Ga0373924_0173853_297_665 120
230 3300035692 Ga0373935_0121339 Ga0373935_0121339_1134_1502 120
231 3300035692 Ga0373935_0135921 Ga0373935_0135921_62_430 120
232 3300035695 Ga0373927_0102258 Ga0373927_0102258_96_464 120
233 3300035695 Ga0373927_0209532 Ga0373927_0209532_229_597 120
234 3300035695 Ga0373927_1087171 Ga0373927_1087171_79_447 120
235 3300035725 Ga0373947_0008671 Ga0373947_0008671_4345_4713 120
236 3300035725 Ga0373947_0077549 Ga0373947_0077549_365_733 120
237 3300036401 Ga0373937_0623958 Ga0373937_0623958_371_736 120
238 3300037068 Ga0373925_0011050 Ga0373925_0011050_2841_3209 120
239 3300037068 Ga0373925_0194488 Ga0373925_0194488_572_940 120
240 3300037068 Ga0373925_0526464 Ga0373925_0526464_189_557 120
241 3300046462 Ga0495651_0074188 Ga0495651_0074188_893_1261 120
242 3300046463 Ga0495653_0086422 Ga0495653_0086422_1158_1526 120
243 3300046472 Ga0495580_0106700 Ga0495580_0106700_303_671 120
244 3300046472 Ga0495580_0158760 Ga0495580_0158760_21_389 120
245 3300046473 Ga0495582_0010846 Ga0495582_0010846_2236_2604 120
246 3300046475 Ga0495639_0008129 Ga0495639_0008129_1914_2282 120
247 3300046475 Ga0495639_0244234 Ga0495639_0244234_341_709 120
248 3300046476 Ga0495662_0063012 Ga0495662_0063012_753_1121 120
249 3300046476 Ga0495662_0071103 Ga0495662_0071103_188_556 120
250 3300046477 Ga0495664_0027013 Ga0495664_0027013_1325_1693 120
251 3300046477 Ga0495664_0156410 Ga0495664_0156410_963_1331 120
252 3300046477 Ga0495664_0581143 Ga0495664_0581143_192_560 120
253 3300046499 Ga0495594_0335295 Ga0495594_0335295_228_596 120
254 3300046511 Ga0495608_0573688 Ga0495608_0573688_201_569 120
255 3300046516 Ga0495628_0555725 Ga0495628_0555725_426_794 120
256 3300046517 Ga0495630_0063847 Ga0495630_0063847_389_757 120
257 3300046517 Ga0495630_0254159 Ga0495630_0254159_61_429 120
258 3300046531 Ga0495665_0017576 Ga0495665_0017576_2916_3284 120
259 3300046533 Ga0495640_0305170 Ga0495640_0305170_33_401 120
260 3300046536 Ga0495587_0011541 Ga0495587_0011541_641_1009 120
261 3300046539 Ga0495621_0014825 Ga0495621_0014825_1364_1732 120
262 3300046543 Ga0495645_0019130 Ga0495645_0019130_821_1189 120
263 3300046543 Ga0495645_0430373 Ga0495645_0430373_376_744 120
264 3300046559 Ga0495667_0050748 Ga0495667_0050748_270_638 120
265 3300046642 Ga0495634_0118966 Ga0495634_0118966_690_1058 120
266 3300046660 Ga0495625_0606137 Ga0495625_0606137_194_565 120
267 3300046663 Ga0495635_0180346 Ga0495635_0180346_677_1045 120
268 3300046664 Ga0495659_0048431 Ga0495659_0048431_310_678 120
269 3300046674 Ga0495588_0091826 Ga0495588_0091826_681_1049 120
270 3300046681 Ga0495647_0410192 Ga0495647_0410192_50_418 120
271 3300046683 Ga0495658_0019308 Ga0495658_0019308_154_522 120
272 3300046689 Ga0495613_0054417 Ga0495613_0054417_2285_2653 120
273 3300046690 Ga0495624_0201550 Ga0495624_0201550_737_1105 120
274 3300046809 Ga0495600_0009079 Ga0495600_0009079_4074_4442 120
275 3300047315 Ga0495581_0000884 Ga0495581_0000884_6024_6392 120
276 3300047315 Ga0495581_0771669 Ga0495581_0771669_88_456 120
277 3300047319 Ga0495674_0751886 Ga0495674_0751886_161_529 120
278 3300047322 Ga0495680_0024087 Ga0495680_0024087_115_483 120
279 3300047471 Ga0495684_0444456 Ga0495684_0444456_202_570 120
280 3300048089 Ga0495614_0186981 Ga0495614_0186981_276_644 120
281 3300048913 Ga0496110_0462156 Ga0496110_0462156_610_978 120
282 3300048913 Ga0496110_1480264 Ga0496110_1480264_79_444 120
283 3300048915 Ga0496112_0003976 Ga0496112_0003976_5108_5476 120
284 3300048917 Ga0496114_0036130 Ga0496114_0036130_310_678 120
285 3300049583 Ga0501067_0000400 Ga0501067_0000400_3045_3416 120
286 3300049584 Ga0501068_0000406 Ga0501068_0000406_20452_20823 120
287 3300049585 Ga0501069_0000074 Ga0501069_0000074_32291_32662 120
288 3300049586 Ga0501070_0534821 Ga0501070_0534821_320_691 120
289 3300049587 Ga0501071_0013316 Ga0501071_0013316_2172_2543 120
290 3300050493 nmdc:mga0k408_219265_c1 nmdc:mga0k408_219265_c1_195_557 120
291 3300053077 Ga0495601_0986375 Ga0495601_0986375_143_511 120
292 3300053084 Ga0495595_0377096 Ga0495595_0377096_304_672 120
293 3300053085 Ga0495619_0001956 Ga0495619_0001956_5189_5557 120
294 3300053092 Ga0500583_0065828 Ga0500583_0065828_383_751 120
295 3300053146 Ga0500588_0000256 Ga0500588_0000256_5862_6227 120
296 3300061734 Ga0530510_0009898 Ga0530510_0009898_3367_3738 120
297 3300048927 Ga0496124_0104980 Ga0496124_0104980_94_474 121
298 3300003320 rootH2_10044307 rootH2_100443073 123
299 3300009551 Ga0105238_11788209 Ga0105238_117882091 123
300 3300013307 Ga0157372_11806443 Ga0157372_118064432 123
301 3300046531 Ga0495665_0257137 Ga0495665_0257137_334_723 123
302 3300046533 Ga0495640_0147006 Ga0495640_0147006_36_425 123
303 3300049571 Ga0501034_0159741 Ga0501034_0159741_909_1283 123
304 3300049571 Ga0501034_0268074 Ga0501034_0268074_724_1098 123
305 iso_pu_bacteria 2593339238 2595446917 123
306 iso_pu_bacteria 2767802442 2770196675 123
307 iso_pu_bacteria 2775506902 2776272705 123
308 iso_pu_bacteria 2775506904 2776284648 123
309 iso_pu_bacteria 2839993093 2839994105 123
310 iso_pu_bacteria 2840764183 2840769489 123
311 iso_pu_bacteria 2842918807 2842919990 123
312 iso_pu_bacteria 2904578770 2904579230 123
313 iso_pu_bacteria 2919119836 2919121944 123
314 iso_pu_bacteria 2935959822 2935966789 123
315 iso_pu_bacteria 2941471342 2941473647 123
316 iso_pu_bacteria 2953994433 2953995282 123
317 iso_pu_bacteria 3005718088 3005718410 123
318 3300005467 Ga0070706_100047656 Ga0070706_1000476564 124
319 3300005471 Ga0070698_100311454 Ga0070698_1003114543 124
320 3300025910 Ga0207684_10133772 Ga0207684_101337723 124
321 3300049593 Ga0501077_0436689 Ga0501077_0436689_410_805 124
322 3300021361 Ga0213872_10049726 Ga0213872_100497263 125
323 3300039447 Ga0436361_1026399 Ga0436361_1026399_173_562 125
324 3300006028 Ga0070717_10275218 Ga0070717_102752183 126
325 3300025898 Ga0207692_10800323 Ga0207692_108003231 126
326 3300046471 Ga0495650_0228932 Ga0495650_0228932_199_582 126
327 3300046506 Ga0495583_0000005 Ga0495583_0000005_160808_161191 126
328 3300046524 Ga0495648_0054556 Ga0495648_0054556_1904_2287 126
329 3300046660 Ga0495625_0000229 Ga0495625_0000229_54542_54925 126
330 3300046660 Ga0495625_0003104 Ga0495625_0003104_1103_1486 126
331 3300046691 Ga0495670_0575088 Ga0495670_0575088_137_520 126
332 3300002075 JGI24738J21930_10000314 JGI24738J21930_100003147 127
333 3300005262 Ga0065165_1000157 Ga0065165_100015771 127
334 3300005331 Ga0070670_100163148 Ga0070670_1001631482 127
335 3300005466 Ga0070685_10362515 Ga0070685_103625152 127
336 3300005468 Ga0070707_101616133 Ga0070707_1016161332 127
337 3300009094 Ga0111539_12505800 Ga0111539_125058001 127
338 3300009174 Ga0105241_12538601 Ga0105241_125386011 127
339 3300013105 Ga0157369_10002359 Ga0157369_100023599 127
340 3300014325 Ga0163163_10101133 Ga0163163_101011332 127
341 3300014497 Ga0182008_10000201 Ga0182008_1000020114 127
342 3300015261 Ga0182006_1000222 Ga0182006_10002227 127
343 3300015265 Ga0182005_1000449 Ga0182005_10004493 127
344 3300025226 Ga0209674_100474 Ga0209674_10047418 127
345 3300025233 Ga0209437_102541 Ga0209437_1025411 127
346 3300025254 Ga0209148_1003168 Ga0209148_10031682 127
347 3300025302 Ga0207426_1004943 Ga0207426_10049433 127
348 3300025302 Ga0207426_1025932 Ga0207426_10259322 127
349 3300025904 Ga0207647_10000009 Ga0207647_100000093 127
350 3300025908 Ga0207643_10575591 Ga0207643_105755911 127
351 3300025925 Ga0207650_10120469 Ga0207650_101204691 127
352 3300028794 Ga0307515_10766276 Ga0307515_107662761 127
353 3300031731 Ga0307405_10273824 Ga0307405_102738241 127
354 3300031911 Ga0307412_10000359 Ga0307412_100003597 127
355 3300035118 Ga0373954_0463790 Ga0373954_0463790_87_473 127
356 3300037471 Ga0395905_0000292 Ga0395905_0000292_30266_30652 127
357 3300041404 Ga0439436_0000011 Ga0439436_0000011_95557_95940 127
358 3300041404 Ga0439436_0225774 Ga0439436_0225774_62_445 127
359 3300041505 Ga0451849_1527781 Ga0451849_1527781_130_516 127
360 3300042015 Ga0439462_0022426 Ga0439462_0022426_220_618 127
361 3300042145 Ga0450906_024728 Ga0450906_024728_528_929 127
362 3300044683 Ga0466965_0560165 Ga0466965_0560165_116_502 127
363 3300044693 Ga0466961_0272250 Ga0466961_0272250_233_619 127
364 3300044706 Ga0466964_0637638 Ga0466964_0637638_67_453 127
365 3300044719 Ga0466971_0323525 Ga0466971_0323525_23_409 127
366 3300044901 Ga0466960_0325742 Ga0466960_0325742_57_443 127
367 3300046454 Ga0495592_0289072 Ga0495592_0289072_594_980 127
368 3300046462 Ga0495651_0011016 Ga0495651_0011016_5034_5420 127
369 3300046476 Ga0495662_0061257 Ga0495662_0061257_986_1372 127
370 3300046477 Ga0495664_0075089 Ga0495664_0075089_1551_1937 127
371 3300046511 Ga0495608_0085583 Ga0495608_0085583_1592_1978 127
372 3300046512 Ga0495610_0009354 Ga0495610_0009354_2290_2673 127
373 3300046516 Ga0495628_0023797 Ga0495628_0023797_2571_2957 127
374 3300046519 Ga0495632_0000209 Ga0495632_0000209_16029_16415 127
375 3300046524 Ga0495648_0311305 Ga0495648_0311305_88_498 127
376 3300046529 Ga0495652_0034008 Ga0495652_0034008_1185_1571 127
377 3300046531 Ga0495665_0525368 Ga0495665_0525368_152_538 127
378 3300046533 Ga0495640_0377567 Ga0495640_0377567_277_663 127
379 3300046536 Ga0495587_0019503 Ga0495587_0019503_3556_3942 127
380 3300046543 Ga0495645_0096231 Ga0495645_0096231_1457_1843 127
381 3300046559 Ga0495667_0021063 Ga0495667_0021063_3581_3967 127
382 3300046642 Ga0495634_0491550 Ga0495634_0491550_207_593 127
383 3300046663 Ga0495635_0085640 Ga0495635_0085640_925_1311 127
384 3300046675 Ga0495657_0005333 Ga0495657_0005333_6209_6595 127
385 3300046678 Ga0495599_0129369 Ga0495599_0129369_432_818 127
386 3300046689 Ga0495613_0163530 Ga0495613_0163530_19_405 127
387 3300046690 Ga0495624_0527292 Ga0495624_0527292_221_607 127
388 3300046691 Ga0495670_0221939 Ga0495670_0221939_285_668 127
389 3300046694 Ga0495649_0012545 Ga0495649_0012545_1237_1620 127
390 3300046809 Ga0495600_0137775 Ga0495600_0137775_458_844 127
391 3300047317 Ga0495604_0045562 Ga0495604_0045562_326_712 127
392 3300047319 Ga0495674_0152631 Ga0495674_0152631_1481_1867 127
393 3300047322 Ga0495680_0025085 Ga0495680_0025085_2715_3101 127
394 3300047444 Ga0495675_0015291 Ga0495675_0015291_2767_3153 127
395 3300047472 Ga0495686_0039833 Ga0495686_0039833_1510_1896 127
396 3300048088 Ga0495602_0083052 Ga0495602_0083052_2111_2497 127
397 3300048904 Ga0496101_0226775 Ga0496101_0226775_76_459 127
398 3300048919 Ga0496116_0313488 Ga0496116_0313488_60_458 127
399 3300048920 Ga0496117_0041217 Ga0496117_0041217_1650_2048 127
400 3300048921 Ga0496118_0020024 Ga0496118_0020024_1526_1924 127
401 3300048922 Ga0496119_0061149 Ga0496119_0061149_491_874 127
402 3300048924 Ga0496121_0000448 Ga0496121_0000448_76817_77215 127
403 3300048925 Ga0496122_0027799 Ga0496122_0027799_156_554 127
404 3300048925 Ga0496122_0027897 Ga0496122_0027897_1592_1990 127
405 3300048926 Ga0496123_0009603 Ga0496123_0009603_1826_2224 127
406 3300048926 Ga0496123_0109470 Ga0496123_0109470_756_1154 127
407 3300048928 Ga0496125_0006544 Ga0496125_0006544_8138_8536 127
408 3300049581 Ga0501047_1294335 Ga0501047_1294335_52_444 127
409 3300053153 Ga0500616_0358965 Ga0500616_0358965_187_570 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

1

122

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9357 1 127
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.9139 1 127
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8491 3 126
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8447 3 125
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8434 3 126
ID Description Score Start End Superfamily
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9357 1 127 3.10.180.10
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9139 1 127 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9026 68 127 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8745 68 127 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8414 66 127 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7Y2FQG5-F1-model_v4 VOC family protein 1.003 67 126
AF-A0A5N7YDH3-F1-model_v4 deleted 0.9979 75 126
AF-A0A2H0UCP5-F1-model_v4 Glyoxalase 0.9971 66 126
AF-A0A436RGB7-F1-model_v4 VOC family protein 0.9968 67 127
AF-A0A849VRQ6-F1-model_v4 VOC family protein 0.9964 1 127

Feature Viewer

pLDDT pTM Quality
97.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map