F436824

General Info

Members Datasets Scaffolds Average Seq Length
408 311 370 254

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0205760|Ga0496121_0205760_464_1306
Length 280
Sequence VQFNRRGADVAEATETRGAQSRQRVFLTGASSGIGMALARAYAAQGAVLGLVARRAAELEALRASLPDAAAHRVYALDVTDHAALQDAAHAFMAEFGGADVVIANAGISQGTLTEYQEDLAAFERIMAVNVTAAFATFTPFVARMKALPEHERRRXRLVGIGSVAGIRGLPGAEAYSASKAAVISYCESLRVELRASGIKVVTVAPGYIDTPMTRVNHYRMPFLMPVDVFAGRALRAIAEGDSYRVIPWQMGVVAKLLRLAPNWLYDMAFARAPHKKRNL

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2547132512 Azospira oryzae 6a3 Isolate Unclassified
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
11 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
12 2643221645 Massilia sp. Root351 Isolate Unclassified
13 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
14 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
15 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
16 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
17 2818991436 Collimonas arenae 515 Isolate Unclassified
18 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
19 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
20 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
21 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
22 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
23 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
24 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
25 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
26 2885198086 Variovorax sp. 679 Isolate Unclassified
27 2885211737 Variovorax sp. 553 Isolate Unclassified
28 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
29 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
30 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
31 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
32 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
33 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
34 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
35 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
36 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
37 2928070936 Variovorax gossypii 1167 Isolate Unclassified
38 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
39 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
40 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
41 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
42 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
43 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
44 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
45 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
52 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
53 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
54 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
55 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
56 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
67 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
70 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
85 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
86 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
93 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
138 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
164 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
210 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
211 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
212 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
216 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
282 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
305 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
308 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
309 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
310 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
311 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.69
Metatranscriptomes 0
Isolates 9.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.14
Nodule 0.74
Rhizoplane 2.94
Rhizosphere 63.73
Stem 0
Stem Tuber 0
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000245 3300002704 Bacteria 21149
2 JGI25155J39150_1000364 3300002704 Bacteria 13813
3 JGI25156J39149_1000564 3300002705 Bacteria 21151
4 JGI25156J39149_1001955 3300002705 Bacteria 7946
5 JGI25162J39368_1000023 3300002737 Bacteria 236658
6 JGI25154J39366_1000433 3300002738 Bacteria 22240
7 JGI25154J39366_1000467 3300002738 Bacteria 21148
8 JGI25157J39369_1001176 3300002741 Bacteria 11167
9 JGI25150J39212_1005457 3300002774 Bacteria 2711
10 JGI25159J45721_1008296 3300002987 Bacteria 2870
11 JGI25151J46595_10004152 3300003187 Bacteria 7734
12 JGI25165J46597_1000030 3300003214 Bacteria 305254
13 JGI25153J46596_10010937 3300003215 Bacteria 4054
14 rootH2_10034392 3300003320 Bacteria 2757
15 JGI25160J50197_1010241 3300003354 Bacteria 3404
16 JGI25161J50226_1004327 3300003374 Bacteria 2999
17 Ga0055538_1000017 3300003751 Bacteria 305254
18 Ga0055538_1000208 3300003751 Bacteria 34627
19 Ga0055539_1000022 3300003752 Bacteria 305254
20 Ga0055539_1000250 3300003752 Bacteria 34627
21 Ga0055533_1000030 3300003756 Bacteria 305254
22 Ga0055533_1000240 3300003756 Bacteria 34627
23 Ga0055532_1000130 3300003758 Bacteria 74140
24 Ga0055525_1000034 3300003759 Bacteria 305254
25 Ga0055525_1000337 3300003759 Bacteria 34627
26 Ga0055535_1000411 3300003761 Bacteria 40267
27 Ga0055529_1000150 3300003763 Bacteria 99993
28 Ga0055529_1000278 3300003763 Bacteria 61095
29 Ga0055526_1005048 3300003771 Bacteria 7709
30 Ga0055537_1006421 3300003773 Bacteria 2986
31 Ga0055524_1013891 3300003775 Bacteria 3011
32 Ga0055534_1006300 3300003784 Bacteria 3007
33 Ga0055528_1012391 3300003790 Bacteria 3312
34 Ga0055540_1028709 3300003792 Bacteria 1312
35 Ga0055531_10018724 3300003794 Bacteria 2843
36 Ga0055541_1000015 3300003841 Bacteria 305254
37 Ga0055541_1000147 3300003841 Bacteria 34627
38 Ga0055543_1004981 3300004625 Bacteria 3476
39 Ga0065165_1013060 3300005262 Bacteria 3327
40 Ga0065712_10173337 3300005290 Bacteria 1231
41 Ga0065715_10235935 3300005293 Bacteria 1217
42 Ga0070658_10018216 3300005327 Bacteria 5619
43 Ga0070676_10018403 3300005328 Bacteria 3871
44 Ga0070690_100229121 3300005330 Bacteria 1305
45 Ga0070670_100106438 3300005331 Bacteria 2417
46 Ga0070670_100330181 3300005331 Bacteria 1337
47 Ga0068869_100118689 3300005334 Bacteria 2020
48 Ga0070666_10061219 3300005335 Bacteria 2548
49 Ga0068868_100048406 3300005338 Bacteria 3334
50 Ga0070660_100019711 3300005339 Bacteria 4945
51 Ga0070661_100093620 3300005344 Bacteria 2226
52 Ga0070669_100206342 3300005353 Bacteria 1548
53 Ga0070673_100278046 3300005364 Bacteria 1467
54 Ga0070688_100022078 3300005365 Bacteria 3724
55 Ga0070659_100007012 3300005366 Bacteria 8161
56 Ga0070714_100460321 3300005435 Unclassified 1209
57 Ga0070713_100000093 3300005436 Bacteria 57164
58 Ga0070701_10024723 3300005438 Bacteria 2909
59 Ga0070700_100109677 3300005441 Bacteria 1832
60 Ga0070678_100072475 3300005456 Bacteria 2582
61 Ga0070662_100029852 3300005457 Bacteria 3809
62 Ga0070681_10029602 3300005458 Bacteria 5498
63 Ga0068867_100252162 3300005459 Bacteria 1435
64 Ga0070706_100029770 3300005467 Bacteria 5030
65 Ga0070707_100085081 3300005468 Unclassified 3056
66 Ga0070679_100055045 3300005530 Bacteria 3962
67 Ga0068855_100002189 3300005563 Bacteria 24161
68 Ga0068855_100008580 3300005563 Bacteria 12356
69 Ga0068855_100077398 3300005563 Bacteria 3859
70 Ga0070664_100159909 3300005564 Bacteria 1992
71 Ga0068857_100130428 3300005577 Bacteria 2267
72 Ga0068857_100266056 3300005577 Bacteria 1575
73 Ga0068852_100042873 3300005616 Bacteria 3833
74 Ga0068852_100046687 3300005616 Bacteria 3691
75 Ga0068859_100175532 3300005617 Bacteria 2224
76 Ga0068864_100130553 3300005618 Bacteria 2256
77 Ga0068864_100271101 3300005618 Bacteria 1581
78 Ga0068851_10052926 3300005834 Bacteria 2065
79 Ga0068870_10054924 3300005840 Bacteria 2120
80 Ga0068870_10081548 3300005840 Bacteria 1789
81 Ga0068863_100116571 3300005841 Bacteria 2545
82 Ga0068858_100098003 3300005842 Bacteria 2733
83 Ga0068860_100020801 3300005843 Bacteria 6357
84 Ga0068862_100148146 3300005844 Bacteria 2087
85 Ga0075432_10008033 3300006058 Bacteria 3600
86 Ga0070712_100026853 3300006175 Bacteria 3840
87 Ga0075366_10001587 3300006195 Bacteria 11375
88 Ga0097621_100182554 3300006237 Bacteria 1813
89 Ga0068871_100131009 3300006358 Bacteria 2126
90 Ga0075429_100262428 3300006880 Bacteria 1512
91 Ga0068865_100022905 3300006881 Bacteria 4082
92 Ga0097620_100175549 3300006931 Bacteria 2224
93 Ga0079104_1001958 3300006946 Bacteria 12197
94 Ga0105251_10221052 3300009011 Bacteria 853
95 Ga0105244_10069321 3300009036 Bacteria 1761
96 Ga0105240_10014357 3300009093 Bacteria 10815
97 Ga0111539_10106283 3300009094 Bacteria 3292
98 Ga0105245_10089084 3300009098 Bacteria 2836
99 Ga0105243_10067052 3300009148 Bacteria 2888
100 Ga0105237_10103693 3300009545 Bacteria 2836
101 Ga0105238_10000038 3300009551 Bacteria 162920
102 Ga0105238_10059352 3300009551 Bacteria 3832
103 Ga0105239_10018875 3300010375 Bacteria 7619
104 Ga0157374_10451524 3300013296 Bacteria 1287
105 Ga0157378_10093495 3300013297 Bacteria 2737
106 Ga0157375_10497884 3300013308 Bacteria 1383
107 Ga0157380_10095505 3300014326 Bacteria 2463
108 Ga0182008_10018544 3300014497 Bacteria 3603
109 Ga0182008_10045959 3300014497 Bacteria 2171
110 Ga0182008_10097585 3300014497 Bacteria 1450
111 Ga0182008_10111411 3300014497 Bacteria 1356
112 Ga0157377_10218694 3300014745 Bacteria 1218
113 Ga0157376_10146219 3300014969 Bacteria 2126
114 Ga0182006_1000030 3300015261 Bacteria 242894
115 Ga0182006_1019123 3300015261 Bacteria 2888
116 Ga0182007_10000037 3300015262 Bacteria 123677
117 Ga0182007_10001694 3300015262 Bacteria 11639
118 Ga0182007_10008513 3300015262 Bacteria 4207
119 Ga0182007_10019769 3300015262 Bacteria 2416
120 Ga0182005_1000021 3300015265 Bacteria 272185
121 Ga0182005_1002621 3300015265 Bacteria 6353
122 Ga0163161_10004787 3300017792 Bacteria 9426
123 Ga0213872_10000227 3300021361 Bacteria 49306
124 Ga0213872_10019828 3300021361 Bacteria 3096
125 Ga0209435_100046 3300025206 Bacteria 95081
126 Ga0209435_100211 3300025206 Bacteria 16598
127 Ga0209784_100021 3300025224 Bacteria 408534
128 Ga0209784_100034 3300025224 Bacteria 305504
129 Ga0209566_100038 3300025225 Bacteria 305504
130 Ga0209566_100039 3300025225 Bacteria 303368
131 Ga0209674_100036 3300025226 Bacteria 408534
132 Ga0209674_100056 3300025226 Bacteria 305504
133 Ga0209672_109545 3300025228 Bacteria 1361
134 Ga0209147_100157 3300025229 Bacteria 92005
135 Ga0209563_100040 3300025230 Bacteria 408534
136 Ga0209563_100057 3300025230 Bacteria 305604
137 Ga0207427_102166 3300025231 Bacteria 5603
138 Ga0209437_100071 3300025233 Bacteria 305604
139 Ga0209437_100260 3300025233 Bacteria 82215
140 Ga0209258_100080 3300025242 Bacteria 255287
141 Ga0209258_100553 3300025242 Bacteria 33250
142 Ga0207425_1001700 3300025245 Bacteria 8742
143 Ga0209646_1000156 3300025246 Bacteria 95083
144 Ga0209646_1000288 3300025246 Bacteria 43358
145 Ga0209026_1000267 3300025250 Bacteria 63271
146 Ga0209026_1004841 3300025250 Bacteria 3830
147 Ga0209026_1007735 3300025250 Bacteria 2357
148 Ga0209677_100023 3300025253 Bacteria 408534
149 Ga0209677_100035 3300025253 Bacteria 305504
150 Ga0209677_103331 3300025253 Bacteria 5289
151 Ga0209759_1000348 3300025256 Bacteria 60134
152 Ga0209759_1000497 3300025256 Bacteria 43357
153 Ga0209759_1000949 3300025256 Bacteria 20802
154 Ga0209129_1000246 3300025258 Bacteria 56795
155 Ga0209233_1000094 3300025261 Bacteria 305604
156 Ga0209565_1007205 3300025263 Bacteria 3025
157 Ga0209455_1000030 3300025272 Bacteria 533479
158 Ga0209455_1002210 3300025272 Bacteria 7700
159 Ga0209130_1001270 3300025284 Bacteria 17510
160 Ga0209675_1003299 3300025291 Bacteria 7751
161 Ga0209676_1015494 3300025292 Bacteria 2804
162 Ga0209025_1001414 3300025294 Bacteria 31787
163 Ga0209564_1000110 3300025295 Bacteria 212842
164 Ga0209758_1000039 3300025297 Bacteria 428951
165 Ga0209256_1000074 3300025299 Bacteria 236893
166 Ga0207426_1000121 3300025302 Bacteria 219007
167 Ga0209051_1021937 3300025303 Bacteria 2701
168 Ga0209257_1016659 3300025304 Bacteria 2956
169 Ga0207697_10002061 3300025315 Bacteria 10588
170 Ga0207682_10004495 3300025893 Bacteria 5811
171 Ga0207688_10001455 3300025901 Bacteria 12394
172 Ga0207645_10018107 3300025907 Bacteria 4642
173 Ga0207643_10023886 3300025908 Bacteria 3373
174 Ga0207643_10136077 3300025908 Bacteria 1465
175 Ga0207684_10064626 3300025910 Unclassified 3106
176 Ga0207707_10029425 3300025912 Bacteria 4802
177 Ga0207695_10002989 3300025913 Bacteria 24306
178 Ga0207693_10032895 3300025915 Bacteria 4093
179 Ga0207657_10052821 3300025919 Bacteria 3525
180 Ga0207657_10093401 3300025919 Bacteria 2506
181 Ga0207649_10015940 3300025920 Bacteria 4229
182 Ga0207646_10068742 3300025922 Unclassified 3164
183 Ga0207694_10074154 3300025924 Bacteria 2663
184 Ga0207650_10170944 3300025925 Bacteria 1727
185 Ga0207650_10302153 3300025925 Bacteria 1307
186 Ga0207659_10132270 3300025926 Bacteria 1927
187 Ga0207687_10146490 3300025927 Bacteria 1797
188 Ga0207700_10000214 3300025928 Bacteria 34620
189 Ga0207690_10006167 3300025932 Bacteria 7099
190 Ga0207706_10007702 3300025933 Bacteria 9943
191 Ga0207709_10017134 3300025935 Bacteria 4039
192 Ga0207670_10031437 3300025936 Bacteria 3402
193 Ga0207704_10123836 3300025938 Bacteria 1775
194 Ga0207691_10278163 3300025940 Bacteria 1440
195 Ga0207689_10014184 3300025942 Bacteria 6779
196 Ga0207679_10001618 3300025945 Bacteria 14030
197 Ga0207679_10040122 3300025945 Bacteria 3348
198 Ga0207679_10382482 3300025945 Bacteria 1234
199 Ga0207667_10001586 3300025949 Bacteria 28590
200 Ga0207667_10061971 3300025949 Bacteria 3912
201 Ga0207667_10331109 3300025949 Bacteria 1555
202 Ga0207651_10237830 3300025960 Bacteria 1482
203 Ga0207712_10139053 3300025961 Bacteria 1861
204 Ga0207668_10126031 3300025972 Bacteria 1947
205 Ga0207640_10097297 3300025981 Bacteria 2054
206 Ga0207640_10206968 3300025981 Bacteria 1491
207 Ga0207677_10170201 3300026023 Bacteria 1702
208 Ga0207703_10066120 3300026035 Bacteria 2973
209 Ga0207639_10051886 3300026041 Bacteria 3122
210 Ga0207708_10008597 3300026075 Bacteria 7556
211 Ga0207641_10069451 3300026088 Bacteria 3024
212 Ga0207648_10012938 3300026089 Bacteria 7793
213 Ga0207676_10107450 3300026095 Bacteria 2327
214 Ga0207676_10337225 3300026095 Bacteria 1389
215 Ga0207674_10027721 3300026116 Bacteria 5987
216 Ga0207674_10049105 3300026116 Bacteria 4317
217 Ga0207675_100004502 3300026118 Bacteria 13463
218 Ga0207683_10019591 3300026121 Bacteria 5780
219 Ga0207698_10029332 3300026142 Bacteria 3939
220 Ga0207428_10036104 3300027907 Bacteria 4034
221 Ga0207428_10346853 3300027907 Bacteria 1093
222 Ga0268266_10219738 3300028379 Bacteria 1746
223 Ga0265318_10001165 3300028577 Bacteria 16280
224 Ga0316177_1076590 3300030731 Bacteria 7354
225 Ga0316180_1034970 3300030736 Bacteria 3317
226 Ga0316182_1034538 3300030745 Bacteria 2465
227 Ga0316182_1194114 3300030745 Bacteria 6461
228 Ga0265330_10020422 3300031235 Bacteria 3026
229 Ga0265332_10002057 3300031238 Bacteria 10524
230 Ga0265328_10000198 3300031239 Bacteria 28091
231 Ga0265328_10001633 3300031239 Bacteria 10311
232 Ga0265328_10057632 3300031239 Unclassified 1426
233 Ga0265329_10002140 3300031242 Bacteria 9157
234 Ga0265339_10057874 3300031249 Bacteria 2095
235 Ga0265331_10000139 3300031250 Bacteria 95847
236 Ga0265331_10005762 3300031250 Bacteria 7420
237 Ga0265331_10008073 3300031250 Bacteria 6013
238 Ga0265327_10000301 3300031251 Bacteria 95857
239 Ga0265327_10006472 3300031251 Bacteria 9354
240 Ga0265327_10088429 3300031251 Unclassified 1515
241 Ga0307408_100000117 3300031548 Bacteria 87442
242 Ga0265314_10001718 3300031711 Bacteria 23760
243 Ga0265342_10005389 3300031712 Bacteria 9768
244 Ga0307516_10003971 3300031730 Bacteria 18571
245 Ga0307516_10375429 3300031730 Bacteria 1084
246 Ga0307406_10000564 3300031901 Bacteria 21342
247 Ga0307416_100657094 3300032002 Bacteria 1134
248 Ga0373931_0012768 3300035691 Bacteria 4077
249 Ga0395899_0010621 3300037312 Bacteria 7055
250 Ga0395900_0025052 3300037418 Bacteria 6107
251 Ga0395900_0073196 3300037418 Bacteria 3523
252 Ga0395905_0019918 3300037471 Bacteria 6358
253 Ga0395905_0034095 3300037471 Bacteria 4779
254 Ga0395905_0070726 3300037471 Bacteria 3270
255 Ga0395905_0098107 3300037471 Bacteria 2751
256 Ga0395901_0115443 3300038443 Bacteria 2820
257 Ga0436361_0108001 3300039447 Bacteria 112244
258 Ga0436361_0955164 3300039447 Bacteria 3829
259 Ga0450917_006493 3300042120 Bacteria 883
260 Ga0451577_0060780 3300042876 Bacteria 3369
261 Ga0451577_0298100 3300042876 Bacteria 1461
262 Ga0466972_0158523 3300044658 Bacteria 1063
263 Ga0466966_0039444 3300044684 Bacteria 3041
264 Ga0466960_0090633 3300044901 Bacteria 1558
265 Ga0466959_0206738 3300045049 Bacteria 1365
266 Ga0451576_0016862 3300045051 Bacteria 8048
267 Ga0451576_0783182 3300045051 Bacteria 1001
268 Ga0495592_0010492 3300046454 Bacteria 6986
269 Ga0495590_0046299 3300046457 Bacteria 1517
270 Ga0495638_0041725 3300046460 Bacteria 2901
271 Ga0495651_0003052 3300046462 Bacteria 12918
272 Ga0495651_0118320 3300046462 Bacteria 1949
273 Ga0495653_0021432 3300046463 Bacteria 5235
274 Ga0495650_0001404 3300046471 Bacteria 23556
275 Ga0495650_0055022 3300046471 Bacteria 1621
276 Ga0495639_0402605 3300046475 Bacteria 691
277 Ga0495584_0000013 3300046491 Bacteria 185735
278 Ga0495584_0003205 3300046491 Bacteria 9105
279 Ga0495584_0053625 3300046491 Bacteria 2029
280 Ga0495585_0002800 3300046492 Bacteria 12147
281 Ga0495585_0004743 3300046492 Bacteria 8747
282 Ga0495585_0010640 3300046492 Bacteria 5466
283 Ga0495596_0001970 3300046500 Bacteria 11330
284 Ga0495596_0006372 3300046500 Bacteria 5440
285 Ga0495583_0000161 3300046506 Bacteria 113144
286 Ga0495583_0074935 3300046506 Bacteria 1480
287 Ga0495606_0004324 3300046507 Bacteria 14290
288 Ga0495606_0014790 3300046507 Bacteria 6062
289 Ga0495606_0181781 3300046507 Bacteria 1212
290 Ga0495608_0016068 3300046511 Bacteria 5179
291 Ga0495608_0050799 3300046511 Bacteria 2750
292 Ga0495616_0007806 3300046513 Bacteria 6384
293 Ga0495620_0151783 3300046515 Bacteria 903
294 Ga0495628_0004405 3300046516 Bacteria 12493
295 Ga0495628_0005063 3300046516 Bacteria 11581
296 Ga0495644_0022994 3300046523 Bacteria 2374
297 Ga0495648_0053593 3300046524 Bacteria 2443
298 Ga0495648_0078704 3300046524 Bacteria 1884
299 Ga0495663_0002068 3300046525 Bacteria 6146
300 Ga0495642_0085620 3300046528 Bacteria 1330
301 Ga0495642_0151638 3300046528 Bacteria 1003
302 Ga0495652_0091932 3300046529 Bacteria 2479
303 Ga0495652_0145358 3300046529 Bacteria 1859
304 Ga0495654_0119061 3300046530 Bacteria 1197
305 Ga0495609_0040220 3300046538 Bacteria 2104
306 Ga0495621_0040616 3300046539 Bacteria 1631
307 Ga0495645_0027943 3300046543 Bacteria 4098
308 Ga0495633_0015127 3300046558 Bacteria 4008
309 Ga0495633_0090612 3300046558 Bacteria 1421
310 Ga0495656_0012526 3300046615 Bacteria 3132
311 Ga0495634_0139862 3300046642 Bacteria 1538
312 Ga0495625_0000821 3300046660 Bacteria 42765
313 Ga0495625_0002654 3300046660 Bacteria 19048
314 Ga0495588_0056085 3300046674 Bacteria 2034
315 Ga0495657_0046951 3300046675 Bacteria 2922
316 Ga0495599_0007300 3300046678 Bacteria 6694
317 Ga0495623_0024834 3300046679 Bacteria 3860
318 Ga0495646_0000554 3300046680 Bacteria 20234
319 Ga0495658_0031027 3300046683 Bacteria 2907
320 Ga0495658_0286927 3300046683 Bacteria 1039
321 Ga0495669_0081859 3300046684 Bacteria 1482
322 Ga0495624_0014585 3300046690 Bacteria 5326
323 Ga0495624_0047592 3300046690 Bacteria 2725
324 Ga0495649_0073705 3300046694 Bacteria 1829
325 Ga0495600_0026267 3300046809 Bacteria 3757
326 Ga0495660_0021160 3300046810 Bacteria 3726
327 Ga0495604_0031007 3300047317 Bacteria 4242
328 Ga0495636_0028761 3300047318 Bacteria 2267
329 Ga0495683_0000221 3300047323 Bacteria 53874
330 Ga0495687_069080 3300047443 Bacteria 1424
331 Ga0495602_0030371 3300048088 Bacteria 5126
332 Ga0495626_0125815 3300048091 Bacteria 1098
333 Ga0496102_0000097 3300048905 Bacteria 124414
334 Ga0496102_0009233 3300048905 Bacteria 8462
335 Ga0496105_0030216 3300048908 Bacteria 4440
336 Ga0496108_0023748 3300048911 Bacteria 5046
337 Ga0496109_0036397 3300048912 Bacteria 4442
338 Ga0496110_0007833 3300048913 Bacteria 8558
339 Ga0496111_0049339 3300048914 Bacteria 3035
340 Ga0496115_0036178 3300048918 Bacteria 3908
341 Ga0496116_0130547 3300048919 Bacteria 1433
342 Ga0496116_0136329 3300048919 Bacteria 1389
343 Ga0496117_0000056 3300048920 Bacteria 271417
344 Ga0496118_0000047 3300048921 Bacteria 271417
345 Ga0496118_0121747 3300048921 Bacteria 1699
346 Ga0496121_0010423 3300048924 Bacteria 10486
347 Ga0496121_0036315 3300048924 Bacteria 4393
348 Ga0496121_0042515 3300048924 Bacteria 3950
349 Ga0496121_0205760 3300048924 Bacteria 1398
350 Ga0496122_0002132 3300048925 Bacteria 29082
351 Ga0496122_0002742 3300048925 Bacteria 24333
352 Ga0496123_0001115 3300048926 Bacteria 40127
353 Ga0496123_0011057 3300048926 Bacteria 7879
354 Ga0496124_0279857 3300048927 Bacteria 1217
355 Ga0496125_0000487 3300048928 Bacteria 69494
356 Ga0496125_0006293 3300048928 Bacteria 12889
357 Ga0496125_0117633 3300048928 Bacteria 1905
358 Ga0496126_0115911 3300048929 Bacteria 2329
359 Ga0501037_0079569 3300049573 Bacteria 2379
360 Ga0501035_0024354 3300049822 Bacteria 5551
361 Ga0501044_0003761 3300049823 Bacteria 17052
362 nmdc:mga0k408_8048_c1 3300050493 Bacteria 5650
363 nmdc:mga09592_371251_c1 3300050508 Bacteria 1237
364 nmdc:mga08y16_506700_c1 3300050511 Bacteria 1226
365 Ga0500635_0000303 3300053080 Bacteria 17222
366 Ga0500595_004254 3300053119 Bacteria 6459
367 Ga0500618_000838 3300053125 Bacteria 16664
368 Ga0500618_001750 3300053125 Bacteria 9207
369 Ga0500619_002541 3300053154 Bacteria 3542
370 Ga0500634_0157507 3300053161 Bacteria 1053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0009233 Ga0496102_0009233_18_701 193
2 3300046529 Ga0495652_0091932 Ga0495652_0091932_22_807 211
3 3300046462 Ga0495651_0118320 Ga0495651_0118320_277_1062 214
4 3300046463 Ga0495653_0021432 Ga0495653_0021432_1374_2159 214
5 3300046642 Ga0495634_0139862 Ga0495634_0139862_142_927 214
6 3300046675 Ga0495657_0046951 Ga0495657_0046951_37_822 214
7 3300046679 Ga0495623_0024834 Ga0495623_0024834_571_1356 214
8 3300046690 Ga0495624_0014585 Ga0495624_0014585_1189_1974 214
9 3300047317 Ga0495604_0031007 Ga0495604_0031007_881_1666 214
10 3300046475 Ga0495639_0402605 Ga0495639_0402605_15_674 216
11 3300053119 Ga0500595_004254 Ga0500595_004254_3193_3978 216
12 3300006946 Ga0079104_1001958 Ga0079104_10019589 220
13 3300046506 Ga0495583_0074935 Ga0495583_0074935_616_1410 221
14 3300046515 Ga0495620_0151783 Ga0495620_0151783_218_892 221
15 3300002737 JGI25162J39368_1000023 JGI25162J39368_10000239 223
16 3300003214 JGI25165J46597_1000030 JGI25165J46597_1000030292 223
17 3300003751 Ga0055538_1000017 Ga0055538_10000179 223
18 3300003752 Ga0055539_1000022 Ga0055539_10000229 223
19 3300003756 Ga0055533_1000030 Ga0055533_10000309 223
20 3300003759 Ga0055525_1000034 Ga0055525_10000349 223
21 3300003841 Ga0055541_1000015 Ga0055541_10000159 223
22 3300025224 Ga0209784_100034 Ga0209784_100034290 223
23 3300025225 Ga0209566_100038 Ga0209566_1000389 223
24 3300025226 Ga0209674_100056 Ga0209674_100056290 223
25 3300025230 Ga0209563_100057 Ga0209563_1000579 223
26 3300025231 Ga0207427_102166 Ga0207427_1021663 223
27 3300025233 Ga0209437_100071 Ga0209437_1000719 223
28 3300025253 Ga0209677_100035 Ga0209677_100035290 223
29 3300025261 Ga0209233_1000094 Ga0209233_10000949 223
30 3300046507 Ga0495606_0014790 Ga0495606_0014790_2402_3187 223
31 3300037312 Ga0395899_0010621 Ga0395899_0010621_4655_5455 228
32 3300037418 Ga0395900_0025052 Ga0395900_0025052_2242_3042 228
33 3300037471 Ga0395905_0070726 Ga0395905_0070726_160_960 228
34 3300038443 Ga0395901_0115443 Ga0395901_0115443_1826_2626 228
35 3300042876 Ga0451577_0298100 Ga0451577_0298100_447_1271 228
36 3300046683 Ga0495658_0031027 Ga0495658_0031027_1460_2245 228
37 3300046694 Ga0495649_0073705 Ga0495649_0073705_758_1552 228
38 3300053154 Ga0500619_002541 Ga0500619_002541_465_1250 228
39 3300005331 Ga0070670_100106438 Ga0070670_1001064382 229
40 3300021361 Ga0213872_10000227 Ga0213872_1000022733 229
41 3300039447 Ga0436361_0108001 Ga0436361_0108001_63287_64063 229
42 3300048908 Ga0496105_0030216 Ga0496105_0030216_3478_4269 229
43 3300048911 Ga0496108_0023748 Ga0496108_0023748_2852_3643 229
44 3300048912 Ga0496109_0036397 Ga0496109_0036397_2777_3568 229
45 3300048913 Ga0496110_0007833 Ga0496110_0007833_5728_6519 229
46 3300046454 Ga0495592_0010492 Ga0495592_0010492_786_1568 230
47 3300046511 Ga0495608_0016068 Ga0495608_0016068_3014_3796 230
48 3300046516 Ga0495628_0004405 Ga0495628_0004405_2474_3256 230
49 3300046678 Ga0495599_0007300 Ga0495599_0007300_1538_2320 230
50 3300046809 Ga0495600_0026267 Ga0495600_0026267_1303_2085 230
51 3300005616 Ga0068852_100046687 Ga0068852_1000466874 232
52 3300025919 Ga0207657_10093401 Ga0207657_100934012 232
53 3300025981 Ga0207640_10206968 Ga0207640_102069682 232
54 3300031239 Ga0265328_10000198 Ga0265328_1000019818 233
55 3300031250 Ga0265331_10000139 Ga0265331_1000013910 233
56 3300031251 Ga0265327_10000301 Ga0265327_1000030189 233
57 3300031239 Ga0265328_10057632 Ga0265328_100576322 236
58 3300031250 Ga0265331_10005762 Ga0265331_100057626 236
59 3300015262 Ga0182007_10001694 Ga0182007_100016944 237
60 3300031251 Ga0265327_10006472 Ga0265327_100064726 237
61 3300046525 Ga0495663_0002068 Ga0495663_0002068_4032_4814 237
62 3300047318 Ga0495636_0028761 Ga0495636_0028761_866_1648 237
63 3300048905 Ga0496102_0000097 Ga0496102_0000097_38682_39473 238
64 3300006175 Ga0070712_100026853 Ga0070712_1000268532 240
65 3300025915 Ga0207693_10032895 Ga0207693_100328953 240
66 3300014497 Ga0182008_10018544 Ga0182008_100185444 242
67 3300015262 Ga0182007_10000037 Ga0182007_1000003776 242
68 3300017792 Ga0163161_10004787 Ga0163161_100047879 242
69 3300048914 Ga0496111_0049339 Ga0496111_0049339_236_997 242
70 3300048920 Ga0496117_0000056 Ga0496117_0000056_232240_233001 242
71 3300048921 Ga0496118_0000047 Ga0496118_0000047_38417_39178 242
72 3300048924 Ga0496121_0010423 Ga0496121_0010423_5569_6330 242
73 3300046674 Ga0495588_0056085 Ga0495588_0056085_817_1590 245
74 3300044658 Ga0466972_0158523 Ga0466972_0158523_171_956 246
75 3300044684 Ga0466966_0039444 Ga0466966_0039444_1539_2324 246
76 3300045049 Ga0466959_0206738 Ga0466959_0206738_86_871 246
77 3300046507 Ga0495606_0004324 Ga0495606_0004324_11156_11965 246
78 iso_pu_bacteria 2600255292 2601671902 248
79 iso_pu_bacteria 2857547612 2857552264 248
80 3300046491 Ga0495584_0000013 Ga0495584_0000013_10543_11337 249
81 3300046492 Ga0495585_0010640 Ga0495585_0010640_2134_2928 249
82 3300049573 Ga0501037_0079569 Ga0501037_0079569_228_986 249
83 3300049822 Ga0501035_0024354 Ga0501035_0024354_3345_4103 249
84 3300049823 Ga0501044_0003761 Ga0501044_0003761_6728_7486 249
85 3300005435 Ga0070714_100460321 Ga0070714_1004603212 250
86 3300005436 Ga0070713_100000093 Ga0070713_10000009324 250
87 3300025928 Ga0207700_10000214 Ga0207700_1000021430 250
88 iso_pu_bacteria 2547132512 2548848348 250
89 3300005290 Ga0065712_10173337 Ga0065712_101733372 251
90 3300005293 Ga0065715_10235935 Ga0065715_102359351 251
91 3300005328 Ga0070676_10018403 Ga0070676_100184033 251
92 3300005330 Ga0070690_100229121 Ga0070690_1002291212 251
93 3300005331 Ga0070670_100330181 Ga0070670_1003301811 251
94 3300005334 Ga0068869_100118689 Ga0068869_1001186892 251
95 3300005335 Ga0070666_10061219 Ga0070666_100612193 251
96 3300005338 Ga0068868_100048406 Ga0068868_1000484062 251
97 3300005353 Ga0070669_100206342 Ga0070669_1002063422 251
98 3300005364 Ga0070673_100278046 Ga0070673_1002780462 251
99 3300005365 Ga0070688_100022078 Ga0070688_1000220783 251
100 3300005438 Ga0070701_10024723 Ga0070701_100247234 251
101 3300005441 Ga0070700_100109677 Ga0070700_1001096772 251
102 3300005456 Ga0070678_100072475 Ga0070678_1000724753 251
103 3300005457 Ga0070662_100029852 Ga0070662_1000298524 251
104 3300005458 Ga0070681_10029602 Ga0070681_100296026 251
105 3300005459 Ga0068867_100252162 Ga0068867_1002521621 251
106 3300005467 Ga0070706_100029770 Ga0070706_1000297705 251
107 3300005468 Ga0070707_100085081 Ga0070707_1000850812 251
108 3300005530 Ga0070679_100055045 Ga0070679_1000550454 251
109 3300005564 Ga0070664_100159909 Ga0070664_1001599092 251
110 3300005577 Ga0068857_100266056 Ga0068857_1002660562 251
111 3300005617 Ga0068859_100175532 Ga0068859_1001755322 251
112 3300005618 Ga0068864_100130553 Ga0068864_1001305533 251
113 3300005618 Ga0068864_100271101 Ga0068864_1002711013 251
114 3300005840 Ga0068870_10054924 Ga0068870_100549243 251
115 3300005840 Ga0068870_10081548 Ga0068870_100815482 251
116 3300005841 Ga0068863_100116571 Ga0068863_1001165713 251
117 3300005842 Ga0068858_100098003 Ga0068858_1000980033 251
118 3300005843 Ga0068860_100020801 Ga0068860_1000208012 251
119 3300005844 Ga0068862_100148146 Ga0068862_1001481463 251
120 3300006237 Ga0097621_100182554 Ga0097621_1001825542 251
121 3300006358 Ga0068871_100131009 Ga0068871_1001310093 251
122 3300006880 Ga0075429_100262428 Ga0075429_1002624282 251
123 3300006881 Ga0068865_100022905 Ga0068865_1000229053 251
124 3300006931 Ga0097620_100175549 Ga0097620_1001755492 251
125 3300009011 Ga0105251_10221052 Ga0105251_102210521 251
126 3300009094 Ga0111539_10106283 Ga0111539_101062834 251
127 3300009098 Ga0105245_10089084 Ga0105245_100890842 251
128 3300009148 Ga0105243_10067052 Ga0105243_100670522 251
129 3300013296 Ga0157374_10451524 Ga0157374_104515242 251
130 3300013297 Ga0157378_10093495 Ga0157378_100934952 251
131 3300013308 Ga0157375_10497884 Ga0157375_104978842 251
132 3300014326 Ga0157380_10095505 Ga0157380_100955052 251
133 3300014745 Ga0157377_10218694 Ga0157377_102186942 251
134 3300014969 Ga0157376_10146219 Ga0157376_101462192 251
135 3300025315 Ga0207697_10002061 Ga0207697_100020616 251
136 3300025893 Ga0207682_10004495 Ga0207682_100044953 251
137 3300025901 Ga0207688_10001455 Ga0207688_100014556 251
138 3300025907 Ga0207645_10018107 Ga0207645_100181073 251
139 3300025908 Ga0207643_10023886 Ga0207643_100238863 251
140 3300025908 Ga0207643_10136077 Ga0207643_101360772 251
141 3300025910 Ga0207684_10064626 Ga0207684_100646264 251
142 3300025912 Ga0207707_10029425 Ga0207707_100294255 251
143 3300025922 Ga0207646_10068742 Ga0207646_100687424 251
144 3300025925 Ga0207650_10170944 Ga0207650_101709442 251
145 3300025925 Ga0207650_10302153 Ga0207650_103021531 251
146 3300025926 Ga0207659_10132270 Ga0207659_101322702 251
147 3300025927 Ga0207687_10146490 Ga0207687_101464903 251
148 3300025933 Ga0207706_10007702 Ga0207706_100077025 251
149 3300025935 Ga0207709_10017134 Ga0207709_100171343 251
150 3300025936 Ga0207670_10031437 Ga0207670_100314373 251
151 3300025938 Ga0207704_10123836 Ga0207704_101238362 251
152 3300025940 Ga0207691_10278163 Ga0207691_102781632 251
153 3300025942 Ga0207689_10014184 Ga0207689_100141846 251
154 3300025945 Ga0207679_10040122 Ga0207679_100401225 251
155 3300025960 Ga0207651_10237830 Ga0207651_102378301 251
156 3300025961 Ga0207712_10139053 Ga0207712_101390532 251
157 3300025972 Ga0207668_10126031 Ga0207668_101260312 251
158 3300026023 Ga0207677_10170201 Ga0207677_101702012 251
159 3300026035 Ga0207703_10066120 Ga0207703_100661203 251
160 3300026041 Ga0207639_10051886 Ga0207639_100518862 251
161 3300026075 Ga0207708_10008597 Ga0207708_100085972 251
162 3300026088 Ga0207641_10069451 Ga0207641_100694513 251
163 3300026089 Ga0207648_10012938 Ga0207648_100129383 251
164 3300026095 Ga0207676_10107450 Ga0207676_101074502 251
165 3300026095 Ga0207676_10337225 Ga0207676_103372252 251
166 3300026116 Ga0207674_10049105 Ga0207674_100491052 251
167 3300026118 Ga0207675_100004502 Ga0207675_1000045022 251
168 3300026121 Ga0207683_10019591 Ga0207683_100195912 251
169 3300027907 Ga0207428_10036104 Ga0207428_100361043 251
170 3300028379 Ga0268266_10219738 Ga0268266_102197382 251
171 3300028577 Ga0265318_10001165 Ga0265318_100011655 251
172 3300031235 Ga0265330_10020422 Ga0265330_100204222 251
173 3300031238 Ga0265332_10002057 Ga0265332_100020572 251
174 3300031239 Ga0265328_10001633 Ga0265328_100016335 251
175 3300031242 Ga0265329_10002140 Ga0265329_100021406 251
176 3300031249 Ga0265339_10057874 Ga0265339_100578743 251
177 3300031250 Ga0265331_10008073 Ga0265331_100080735 251
178 3300031251 Ga0265327_10088429 Ga0265327_100884292 251
179 3300031711 Ga0265314_10001718 Ga0265314_1000171820 251
180 3300031712 Ga0265342_10005389 Ga0265342_100053895 251
181 3300046528 Ga0495642_0151638 Ga0495642_0151638_50_814 251
182 3300046539 Ga0495621_0040616 Ga0495621_0040616_44_808 251
183 3300046683 Ga0495658_0286927 Ga0495658_0286927_260_1024 251
184 3300050508 nmdc:mga09592_371251_c1 nmdc:mga09592_371251_c1_189_953 251
185 3300050511 nmdc:mga08y16_506700_c1 nmdc:mga08y16_506700_c1_446_1210 251
186 iso_pu_bacteria 2643221645 2644250795 251
187 3300015261 Ga0182006_1000030 Ga0182006_100003010 252
188 3300015265 Ga0182005_1000021 Ga0182005_1000021222 252
189 3300025250 Ga0209026_1004841 Ga0209026_10048412 252
190 3300048925 Ga0496122_0002132 Ga0496122_0002132_19615_20376 252
191 3300048926 Ga0496123_0011057 Ga0496123_0011057_1622_2383 252
192 iso_pu_bacteria 2885198086 2885204119 252
193 iso_pu_bacteria 2885211737 2885217547 252
194 3300002774 JGI25150J39212_1005457 JGI25150J39212_10054574 253
195 3300002987 JGI25159J45721_1008296 JGI25159J45721_10082962 253
196 3300003187 JGI25151J46595_10004152 JGI25151J46595_100041522 253
197 3300003215 JGI25153J46596_10010937 JGI25153J46596_100109375 253
198 3300003320 rootH2_10034392 rootH2_100343921 253
199 3300003354 JGI25160J50197_1010241 JGI25160J50197_10102412 253
200 3300003374 JGI25161J50226_1004327 JGI25161J50226_10043274 253
201 3300003761 Ga0055535_1000411 Ga0055535_100041126 253
202 3300003763 Ga0055529_1000150 Ga0055529_100015015 253
203 3300003763 Ga0055529_1000278 Ga0055529_10002782 253
204 3300003771 Ga0055526_1005048 Ga0055526_10050488 253
205 3300003773 Ga0055537_1006421 Ga0055537_10064214 253
206 3300003775 Ga0055524_1013891 Ga0055524_10138912 253
207 3300003784 Ga0055534_1006300 Ga0055534_10063004 253
208 3300003790 Ga0055528_1012391 Ga0055528_10123914 253
209 3300003792 Ga0055540_1028709 Ga0055540_10287092 253
210 3300003794 Ga0055531_10018724 Ga0055531_100187244 253
211 3300004625 Ga0055543_1004981 Ga0055543_10049812 253
212 3300005262 Ga0065165_1013060 Ga0065165_10130602 253
213 3300005327 Ga0070658_10018216 Ga0070658_100182161 253
214 3300006058 Ga0075432_10008033 Ga0075432_100080332 253
215 3300006195 Ga0075366_10001587 Ga0075366_1000158711 253
216 3300014497 Ga0182008_10111411 Ga0182008_101114112 253
217 3300025242 Ga0209258_100080 Ga0209258_10008085 253
218 3300025245 Ga0207425_1001700 Ga0207425_10017001 253
219 3300025253 Ga0209677_103331 Ga0209677_1033313 253
220 3300025256 Ga0209759_1000949 Ga0209759_100094917 253
221 3300025258 Ga0209129_1000246 Ga0209129_100024640 253
222 3300025263 Ga0209565_1007205 Ga0209565_10072052 253
223 3300025272 Ga0209455_1000030 Ga0209455_1000030414 253
224 3300025284 Ga0209130_1001270 Ga0209130_10012709 253
225 3300025291 Ga0209675_1003299 Ga0209675_10032998 253
226 3300025292 Ga0209676_1015494 Ga0209676_10154941 253
227 3300025294 Ga0209025_1001414 Ga0209025_100141423 253
228 3300025295 Ga0209564_1000110 Ga0209564_1000110216 253
229 3300025297 Ga0209758_1000039 Ga0209758_1000039216 253
230 3300025299 Ga0209256_1000074 Ga0209256_1000074216 253
231 3300025302 Ga0207426_1000121 Ga0207426_1000121215 253
232 3300025303 Ga0209051_1021937 Ga0209051_10219373 253
233 3300025304 Ga0209257_1016659 Ga0209257_10166592 253
234 3300025949 Ga0207667_10331109 Ga0207667_103311092 253
235 3300027907 Ga0207428_10346853 Ga0207428_103468531 253
236 3300031548 Ga0307408_100000117 Ga0307408_10000011715 253
237 3300031730 Ga0307516_10003971 Ga0307516_1000397116 253
238 3300031730 Ga0307516_10375429 Ga0307516_103754291 253
239 3300031901 Ga0307406_10000564 Ga0307406_1000056411 253
240 3300032002 Ga0307416_100657094 Ga0307416_1006570941 253
241 3300035691 Ga0373931_0012768 Ga0373931_0012768_1636_2430 253
242 3300037471 Ga0395905_0019918 Ga0395905_0019918_2387_3160 253
243 3300037471 Ga0395905_0034095 Ga0395905_0034095_3480_4253 253
244 3300042120 Ga0450917_006493 Ga0450917_006493_67_846 253
245 3300042876 Ga0451577_0060780 Ga0451577_0060780_2048_2824 253
246 3300045051 Ga0451576_0016862 Ga0451576_0016862_4440_5219 253
247 3300045051 Ga0451576_0783182 Ga0451576_0783182_176_952 253
248 3300046471 Ga0495650_0055022 Ga0495650_0055022_794_1570 253
249 3300050493 nmdc:mga0k408_8048_c1 nmdc:mga0k408_8048_c1_4646_5440 253
250 3300053080 Ga0500635_0000303 Ga0500635_0000303_232_1008 253
251 iso_pu_bacteria 2511231003 2511251526 253
252 iso_pu_bacteria 2599185214 2599621539 253
253 iso_pu_bacteria 2599185226 2599670777 253
254 iso_pu_bacteria 2599185227 2599679267 253
255 iso_pu_bacteria 2599185229 2599691050 253
256 iso_pu_bacteria 2643221603 2644026010 253
257 iso_pu_bacteria 2818991436 2819542075 253
258 iso_pu_bacteria 2884811622 2884816409 253
259 iso_pu_bacteria 2884836552 2884838441 253
260 iso_pu_bacteria 2884852848 2884854733 253
261 iso_pu_bacteria 2896154374 2896156599 253
262 iso_pu_bacteria 2928070936 2928072200 253
263 3300046524 Ga0495648_0053593 Ga0495648_0053593_639_1430 254
264 3300046528 Ga0495642_0085620 Ga0495642_0085620_200_991 254
265 3300046810 Ga0495660_0021160 Ga0495660_0021160_2043_2834 254
266 3300048918 Ga0496115_0036178 Ga0496115_0036178_1133_1921 254
267 3300030731 Ga0316177_1076590 Ga0316177_10765908 255
268 3300030736 Ga0316180_1034970 Ga0316180_10349702 255
269 3300030745 Ga0316182_1034538 Ga0316182_10345384 255
270 3300030745 Ga0316182_1194114 Ga0316182_11941146 255
271 3300046457 Ga0495590_0046299 Ga0495590_0046299_109_903 255
272 3300046460 Ga0495638_0041725 Ga0495638_0041725_1690_2469 255
273 3300046471 Ga0495650_0001404 Ga0495650_0001404_12844_13623 255
274 3300046491 Ga0495584_0003205 Ga0495584_0003205_2241_3035 255
275 3300046491 Ga0495584_0053625 Ga0495584_0053625_151_945 255
276 3300046492 Ga0495585_0002800 Ga0495585_0002800_9327_10103 255
277 3300046492 Ga0495585_0004743 Ga0495585_0004743_2848_3642 255
278 3300046500 Ga0495596_0001970 Ga0495596_0001970_8364_9158 255
279 3300046500 Ga0495596_0006372 Ga0495596_0006372_2624_3418 255
280 3300046506 Ga0495583_0000161 Ga0495583_0000161_65439_66233 255
281 3300046507 Ga0495606_0181781 Ga0495606_0181781_241_1035 255
282 3300046513 Ga0495616_0007806 Ga0495616_0007806_800_1594 255
283 3300046523 Ga0495644_0022994 Ga0495644_0022994_1110_1904 255
284 3300046524 Ga0495648_0078704 Ga0495648_0078704_97_870 255
285 3300046538 Ga0495609_0040220 Ga0495609_0040220_18_791 255
286 3300046558 Ga0495633_0015127 Ga0495633_0015127_2250_3044 255
287 3300046558 Ga0495633_0090612 Ga0495633_0090612_325_1119 255
288 3300046615 Ga0495656_0012526 Ga0495656_0012526_199_993 255
289 3300046660 Ga0495625_0000821 Ga0495625_0000821_39984_40763 255
290 3300046684 Ga0495669_0081859 Ga0495669_0081859_644_1438 255
291 3300047323 Ga0495683_0000221 Ga0495683_0000221_10183_10977 255
292 3300047443 Ga0495687_069080 Ga0495687_069080_468_1262 255
293 3300048091 Ga0495626_0125815 Ga0495626_0125815_281_1075 255
294 iso_pu_bacteria 2818991445 2819593041 255
295 3300015262 Ga0182007_10008513 Ga0182007_100085134 256
296 3300046511 Ga0495608_0050799 Ga0495608_0050799_265_1041 256
297 3300046543 Ga0495645_0027943 Ga0495645_0027943_675_1451 256
298 3300046680 Ga0495646_0000554 Ga0495646_0000554_7728_8504 256
299 3300002704 JGI25155J39150_1000364 JGI25155J39150_10003644 257
300 3300002705 JGI25156J39149_1001955 JGI25156J39149_10019553 257
301 3300002738 JGI25154J39366_1000433 JGI25154J39366_100043310 257
302 3300003751 Ga0055538_1000208 Ga0055538_100020810 257
303 3300003752 Ga0055539_1000250 Ga0055539_100025010 257
304 3300003756 Ga0055533_1000240 Ga0055533_100024010 257
305 3300003759 Ga0055525_1000337 Ga0055525_100033710 257
306 3300003841 Ga0055541_1000147 Ga0055541_100014710 257
307 3300005339 Ga0070660_100019711 Ga0070660_1000197114 257
308 3300005344 Ga0070661_100093620 Ga0070661_1000936201 257
309 3300005366 Ga0070659_100007012 Ga0070659_1000070124 257
310 3300005563 Ga0068855_100002189 Ga0068855_10000218912 257
311 3300005563 Ga0068855_100008580 Ga0068855_1000085806 257
312 3300005563 Ga0068855_100077398 Ga0068855_1000773983 257
313 3300005577 Ga0068857_100130428 Ga0068857_1001304282 257
314 3300005616 Ga0068852_100042873 Ga0068852_1000428734 257
315 3300005834 Ga0068851_10052926 Ga0068851_100529262 257
316 3300009036 Ga0105244_10069321 Ga0105244_100693212 257
317 3300009093 Ga0105240_10014357 Ga0105240_100143576 257
318 3300009545 Ga0105237_10103693 Ga0105237_101036932 257
319 3300009551 Ga0105238_10000038 Ga0105238_10000038107 257
320 3300009551 Ga0105238_10059352 Ga0105238_100593522 257
321 3300010375 Ga0105239_10018875 Ga0105239_100188754 257
322 3300014497 Ga0182008_10045959 Ga0182008_100459592 257
323 3300015261 Ga0182006_1019123 Ga0182006_10191234 257
324 3300015262 Ga0182007_10019769 Ga0182007_100197692 257
325 3300015265 Ga0182005_1002621 Ga0182005_10026216 257
326 3300021361 Ga0213872_10019828 Ga0213872_100198282 257
327 3300025206 Ga0209435_100211 Ga0209435_10021112 257
328 3300025224 Ga0209784_100021 Ga0209784_10002111 257
329 3300025225 Ga0209566_100039 Ga0209566_10003912 257
330 3300025226 Ga0209674_100036 Ga0209674_10003611 257
331 3300025228 Ga0209672_109545 Ga0209672_1095452 257
332 3300025230 Ga0209563_100040 Ga0209563_10004011 257
333 3300025233 Ga0209437_100260 Ga0209437_10026054 257
334 3300025246 Ga0209646_1000288 Ga0209646_100028814 257
335 3300025250 Ga0209026_1007735 Ga0209026_10077352 257
336 3300025253 Ga0209677_100023 Ga0209677_10002311 257
337 3300025256 Ga0209759_1000497 Ga0209759_100049714 257
338 3300025913 Ga0207695_10002989 Ga0207695_1000298919 257
339 3300025919 Ga0207657_10052821 Ga0207657_100528213 257
340 3300025920 Ga0207649_10015940 Ga0207649_100159403 257
341 3300025924 Ga0207694_10074154 Ga0207694_100741543 257
342 3300025932 Ga0207690_10006167 Ga0207690_100061678 257
343 3300025945 Ga0207679_10001618 Ga0207679_100016183 257
344 3300025945 Ga0207679_10382482 Ga0207679_103824822 257
345 3300025949 Ga0207667_10001586 Ga0207667_1000158612 257
346 3300025949 Ga0207667_10061971 Ga0207667_100619713 257
347 3300025981 Ga0207640_10097297 Ga0207640_100972972 257
348 3300026116 Ga0207674_10027721 Ga0207674_100277214 257
349 3300026142 Ga0207698_10029332 Ga0207698_100293322 257
350 3300037418 Ga0395900_0073196 Ga0395900_0073196_1564_2358 257
351 3300037471 Ga0395905_0098107 Ga0395905_0098107_874_1668 257
352 3300039447 Ga0436361_0955164 Ga0436361_0955164_1120_1926 257
353 3300044901 Ga0466960_0090633 Ga0466960_0090633_351_1130 257
354 3300046462 Ga0495651_0003052 Ga0495651_0003052_2342_3130 257
355 3300046516 Ga0495628_0005063 Ga0495628_0005063_7972_8760 257
356 3300046529 Ga0495652_0145358 Ga0495652_0145358_970_1758 257
357 3300046530 Ga0495654_0119061 Ga0495654_0119061_413_1186 257
358 3300046660 Ga0495625_0002654 Ga0495625_0002654_5855_6628 257
359 3300046690 Ga0495624_0047592 Ga0495624_0047592_738_1523 257
360 3300048088 Ga0495602_0030371 Ga0495602_0030371_1036_1824 257
361 3300048919 Ga0496116_0130547 Ga0496116_0130547_499_1272 257
362 3300048919 Ga0496116_0136329 Ga0496116_0136329_127_942 257
363 3300048921 Ga0496118_0121747 Ga0496118_0121747_439_1254 257
364 3300048924 Ga0496121_0036315 Ga0496121_0036315_1826_2599 257
365 3300048924 Ga0496121_0042515 Ga0496121_0042515_1569_2378 257
366 3300048924 Ga0496121_0205760 Ga0496121_0205760_464_1306 257
367 3300048925 Ga0496122_0002742 Ga0496122_0002742_11361_12170 257
368 3300048926 Ga0496123_0001115 Ga0496123_0001115_27065_27874 257
369 3300048927 Ga0496124_0279857 Ga0496124_0279857_322_1131 257
370 3300048928 Ga0496125_0000487 Ga0496125_0000487_62921_63712 257
371 3300048928 Ga0496125_0117633 Ga0496125_0117633_386_1195 257
372 3300048929 Ga0496126_0115911 Ga0496126_0115911_306_1106 257
373 3300053125 Ga0500618_000838 Ga0500618_000838_12278_13078 257
374 3300053125 Ga0500618_001750 Ga0500618_001750_7949_8728 257
375 3300053161 Ga0500634_0157507 Ga0500634_0157507_142_915 257
376 iso_pu_bacteria 2511231026 2511383531 257
377 iso_pu_bacteria 2521172590 2521560298 257
378 iso_pu_bacteria 2551306416 2553005117 257
379 iso_pu_bacteria 2765235838 2765571471 257
380 iso_pu_bacteria 2808606386 2808982370 257
381 iso_pu_bacteria 2808606415 2809129830 257
382 iso_pu_bacteria 2808606419 2809149115 257
383 iso_pu_bacteria 2818991449 2819616658 257
384 iso_pu_bacteria 2839094727 2839098761 257
385 iso_pu_bacteria 2852618963 2852619255 257
386 iso_pu_bacteria 2904439833 2904442534 257
387 iso_pu_bacteria 2904530477 2904535259 257
388 iso_pu_bacteria 2904584206 2904589603 257
389 iso_pu_bacteria 2904589729 2904594510 257
390 iso_pu_bacteria 2904601388 2904606232 257
391 iso_pu_bacteria 2919046199 2919048833 257
392 iso_pu_bacteria 2919079590 2919084181 257
393 iso_pu_bacteria 2923510766 2923514072 257
394 iso_pu_bacteria 2928130867 2928134679 257
395 3300002704 JGI25155J39150_1000245 JGI25155J39150_100024512 259
396 3300002705 JGI25156J39149_1000564 JGI25156J39149_100056412 259
397 3300002738 JGI25154J39366_1000467 JGI25154J39366_100046712 259
398 3300002741 JGI25157J39369_1001176 JGI25157J39369_10011763 259
399 3300003758 Ga0055532_1000130 Ga0055532_100013027 259
400 3300014497 Ga0182008_10097585 Ga0182008_100975852 259
401 3300025206 Ga0209435_100046 Ga0209435_10004648 259
402 3300025229 Ga0209147_100157 Ga0209147_10015743 259
403 3300025242 Ga0209258_100553 Ga0209258_1005537 259
404 3300025246 Ga0209646_1000156 Ga0209646_100015645 259
405 3300025250 Ga0209026_1000267 Ga0209026_100026745 259
406 3300025256 Ga0209759_1000348 Ga0209759_100034813 259
407 3300025272 Ga0209455_1002210 Ga0209455_10022105 259
408 3300048928 Ga0496125_0006293 Ga0496125_0006293_6638_7423 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

23

220

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

29

223

0.86

PF08659

KR

KR domain

24

211

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9215 1 226
7e6o-assembly1.cif.gz_C crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9195 2 194
8g93-assembly1.cif.gz_B crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9089 2 241
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9059 2 226
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.905 2 225
ID Description Score Start End Superfamily
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9273 3 185 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9218 2 87 3.40.50.720
3p19C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9193 1 226 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9182 2 226 3.40.50.720
af_A0A1D6Q3A1_14_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9158 2 113 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A345D8R5-F1-model_v4 Putative oxidoreductase (EC 1.-.-.-) 0.9908 2 257 GO:0016020
GO:0016491
AF-G0AFK5-F1-model_v4 Putative Glucose/ribitol dehydrogenase (EC 1.-.-.-) 0.9882 1 259 GO:0016020
GO:0016491
AF-R5EEW4-F1-model_v4 deleted 0.9853 2 258
AF-G0AFK5-F1-model_v4 Putative Glucose/ribitol dehydrogenase (EC 1.-.-.-) 0.9845 1 259 GO:0016020
GO:0016491
AF-A0A4P6KX40-F1-model_v4 SDR family oxidoreductase 0.9842 2 258 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.34 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map