F436659

General Info

Members Datasets Scaffolds Average Seq Length
408 209 816 206

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100482803|Ga0070708_1004828032
Length 196
Sequence LNSDFGFTRAELRKLRTLKTPSGVQRFLDELPYNLSYTARSPRQVLHDRTASCLEGGIFAAAALRMLGFPPLIFDLEAEQDTDHVVAIFKVRGHWGAVAKSNFAGCRYREPVYRSLRELAMSYFNIERTLRRYSRPVNLARFDHQNWMTKEKPVWFIAEYLCEIPHIRLLTSTMEKNLTRVDPRTVRGEMIGHRKR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 5.64
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 37.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100482803 3300005445 Unclassified 1169
2 SwRhRL2b_contig_1094174 2162886007 Bacteria 1085
3 SwRhRL2b_contig_312667 2162886007 Unclassified 1775
4 JGI24035J26624_1007366 3300002126 Unclassified 1069
5 JGI25405J52794_10008723 3300003911 Bacteria 1901
6 Ga0065704_10005909 3300005289 Bacteria 4383
7 Ga0065704_10079738 3300005289 Bacteria 4091
8 Ga0065712_10015970 3300005290 Bacteria 1930
9 Ga0065712_10129162 3300005290 Unclassified 1569
10 Ga0065712_10196738 3300005290 Unclassified 1118
11 Ga0065715_10007908 3300005293 Bacteria 4317
12 Ga0065715_10013221 3300005293 Unclassified 2586
13 Ga0065715_10053648 3300005293 Unclassified 931
14 Ga0065715_10137109 3300005293 Bacteria 1900
15 Ga0065715_10327834 3300005293 Bacteria 989
16 Ga0065707_10008955 3300005295 Bacteria 3220
17 Ga0065707_10121794 3300005295 Bacteria 2102
18 Ga0070676_10003664 3300005328 Bacteria 8041
19 Ga0070676_10390536 3300005328 Bacteria 966
20 Ga0070683_100205482 3300005329 Bacteria 1871
21 Ga0070683_100808038 3300005329 Unclassified 899
22 Ga0070690_100016876 3300005330 Bacteria 4383
23 Ga0070670_100163998 3300005331 Bacteria 1926
24 Ga0070670_100190045 3300005331 Bacteria 1784
25 Ga0070666_10012946 3300005335 Bacteria 5279
26 Ga0070666_10033400 3300005335 Bacteria 3404
27 Ga0070680_100040599 3300005336 Unclassified 3768
28 Ga0068868_100060821 3300005338 Bacteria 2991
29 Ga0068868_100113684 3300005338 Bacteria 2202
30 Ga0070660_100274134 3300005339 Unclassified 1379
31 Ga0070660_100280730 3300005339 Bacteria 1363
32 Ga0070689_100029030 3300005340 Bacteria 4183
33 Ga0070689_100072445 3300005340 Bacteria 2693
34 Ga0070689_100100123 3300005340 Bacteria 2293
35 Ga0070689_100389124 3300005340 Unclassified 1176
36 Ga0070661_100137306 3300005344 Bacteria 1840
37 Ga0070668_100034224 3300005347 Bacteria 3871
38 Ga0070668_100147730 3300005347 Bacteria 1898
39 Ga0070668_100173835 3300005347 Bacteria 1755
40 Ga0070669_100102075 3300005353 Bacteria 2165
41 Ga0070669_100777726 3300005353 Unclassified 812
42 Ga0070675_100115096 3300005354 Bacteria 2279
43 Ga0070675_100137630 3300005354 Bacteria 2085
44 Ga0070675_100193895 3300005354 Unclassified 1761
45 Ga0070671_100010402 3300005355 Bacteria 7462
46 Ga0070671_100091372 3300005355 Bacteria 2550
47 Ga0070671_100155207 3300005355 Unclassified 1934
48 Ga0070671_100374810 3300005355 Unclassified 1216
49 Ga0070673_100061484 3300005364 Unclassified 2980
50 Ga0070673_100164020 3300005364 Unclassified 1892
51 Ga0070688_100007802 3300005365 Bacteria 5782
52 Ga0070688_100049841 3300005365 Unclassified 2607
53 Ga0070688_100139906 3300005365 Bacteria 1643
54 Ga0070688_100543072 3300005365 Unclassified 882
55 Ga0070659_100058099 3300005366 Bacteria 3052
56 Ga0070667_100032400 3300005367 Bacteria 4359
57 Ga0070667_100828225 3300005367 Unclassified 860
58 Ga0070709_10156878 3300005434 Unclassified 1578
59 Ga0070714_100105388 3300005435 Bacteria 2489
60 Ga0070714_100189661 3300005435 Bacteria 1875
61 Ga0070714_100790520 3300005435 Unclassified 918
62 Ga0070713_100150830 3300005436 Bacteria 2068
63 Ga0070705_100041508 3300005440 Bacteria 2623
64 Ga0070700_100088632 3300005441 Bacteria 2014
65 Ga0070708_100001091 3300005445 Bacteria 20733
66 Ga0070708_100054183 3300005445 Unclassified 3561
67 Ga0070708_100071071 3300005445 Bacteria 3132
68 Ga0070708_100113289 3300005445 Unclassified 2495
69 Ga0070708_100213396 3300005445 Bacteria 1809
70 Ga0070708_100587788 3300005445 Bacteria 1050
71 Ga0070662_100040521 3300005457 Bacteria 3317
72 Ga0070662_100171221 3300005457 Bacteria 1705
73 Ga0070662_100237694 3300005457 Bacteria 1460
74 Ga0070662_100635468 3300005457 Unclassified 900
75 Ga0070681_10096385 3300005458 Bacteria 2906
76 Ga0068867_100062616 3300005459 Bacteria 2764
77 Ga0070685_10054764 3300005466 Bacteria 2316
78 Ga0070706_100000060 3300005467 Bacteria 131097
79 Ga0070706_100013247 3300005467 Bacteria 7628
80 Ga0070706_100019130 3300005467 Bacteria 6319
81 Ga0070706_100025455 3300005467 Bacteria 5446
82 Ga0070706_100047990 3300005467 Bacteria 3942
83 Ga0070706_100195255 3300005467 Bacteria 1891
84 Ga0070707_100023306 3300005468 Bacteria 5856
85 Ga0070707_100036794 3300005468 Bacteria 4672
86 Ga0070707_100061268 3300005468 Bacteria 3608
87 Ga0070707_100068859 3300005468 Bacteria 3406
88 Ga0070707_100224701 3300005468 Bacteria 1828
89 Ga0070707_100227373 3300005468 Bacteria 1817
90 Ga0070707_100358034 3300005468 Unclassified 1417
91 Ga0070707_100669610 3300005468 Unclassified 1000
92 Ga0070698_100002832 3300005471 Bacteria 19085
93 Ga0070698_100020733 3300005471 Bacteria 6890
94 Ga0070698_100040117 3300005471 Bacteria 4814
95 Ga0070699_100218620 3300005518 Unclassified 1697
96 Ga0070684_100010243 3300005535 Bacteria 7421
97 Ga0070684_100260324 3300005535 Bacteria 1587
98 Ga0070697_100017287 3300005536 Bacteria 5673
99 Ga0070697_100087771 3300005536 Unclassified 2568
100 Ga0070697_100185083 3300005536 Bacteria 1766
101 Ga0070697_100351426 3300005536 Unclassified 1273
102 Ga0070697_100382964 3300005536 Unclassified 1218
103 Ga0070697_100497651 3300005536 Unclassified 1065
104 Ga0068853_101461073 3300005539 Unclassified 662
105 Ga0070672_100026857 3300005543 Unclassified 4290
106 Ga0070672_100220087 3300005543 Bacteria 1592
107 Ga0070696_100028110 3300005546 Bacteria 3836
108 Ga0070665_100055867 3300005548 Bacteria 3959
109 Ga0070665_100413226 3300005548 Bacteria 1358
110 Ga0070665_100443504 3300005548 Bacteria 1307
111 Ga0070665_100512962 3300005548 Unclassified 1210
112 Ga0070704_100504046 3300005549 Bacteria 1051
113 Ga0070664_100349347 3300005564 Bacteria 1345
114 Ga0070664_100443080 3300005564 Bacteria 1192
115 Ga0068857_100551436 3300005577 Unclassified 1086
116 Ga0068859_100561315 3300005617 Bacteria 1236
117 Ga0068864_100652174 3300005618 Bacteria 1025
118 Ga0068863_100081353 3300005841 Bacteria 3068
119 Ga0068863_100138340 3300005841 Bacteria 2327
120 Ga0068858_100038213 3300005842 Bacteria 4452
121 Ga0068858_100977067 3300005842 Unclassified 829
122 Ga0068860_100084958 3300005843 Bacteria 3010
123 Ga0068860_100336454 3300005843 Bacteria 1484
124 Ga0068860_100385790 3300005843 Bacteria 1383
125 Ga0081455_10004607 3300005937 Bacteria 15398
126 Ga0081455_10005191 3300005937 Bacteria 14329
127 Ga0081455_10006370 3300005937 Bacteria 12671
128 Ga0081455_10011578 3300005937 Bacteria 8853
129 Ga0081455_10015926 3300005937 Bacteria 7279
130 Ga0081455_10063405 3300005937 Unclassified 3102
131 Ga0081455_10078818 3300005937 Bacteria 2706
132 Ga0081455_10088170 3300005937 Bacteria 2522
133 Ga0081540_1000968 3300005983 Bacteria 25881
134 Ga0081540_1028787 3300005983 Unclassified 3110
135 Ga0081540_1145036 3300005983 Bacteria 946
136 Ga0081539_10012065 3300005985 Bacteria 6719
137 Ga0081539_10030241 3300005985 Unclassified 3366
138 Ga0070717_10062877 3300006028 Unclassified 3079
139 Ga0070715_10006670 3300006163 Bacteria 3940
140 Ga0070715_10255585 3300006163 Unclassified 918
141 Ga0070716_100710249 3300006173 Unclassified 769
142 Ga0070712_100021271 3300006175 Bacteria 4258
143 Ga0070712_100044986 3300006175 Unclassified 3046
144 Ga0070712_100110961 3300006175 Bacteria 2047
145 Ga0070712_100261035 3300006175 Bacteria 1388
146 Ga0097621_100085689 3300006237 Bacteria 2628
147 Ga0097621_100498214 3300006237 Bacteria 1103
148 Ga0097621_100517840 3300006237 Unclassified 1082
149 Ga0068871_100050804 3300006358 Bacteria 3355
150 Ga0068871_100598012 3300006358 Unclassified 1003
151 Ga0075434_100242071 3300006871 Unclassified 1824
152 Ga0075434_100404584 3300006871 Bacteria 1386
153 Ga0068865_100108249 3300006881 Bacteria 2045
154 Ga0097620_100561329 3300006931 Bacteria 1236
155 Ga0099794_10204673 3300007265 Bacteria 1011
156 Ga0099795_10027157 3300007788 Bacteria 1934
157 Ga0111539_10347626 3300009094 Bacteria 1726
158 Ga0111539_10760486 3300009094 Bacteria 1128
159 Ga0105245_10048427 3300009098 Unclassified 3802
160 Ga0105245_11438907 3300009098 Bacteria 740
161 Ga0114129_10295911 3300009147 Unclassified 2159
162 Ga0114129_10428248 3300009147 Unclassified 1739
163 Ga0114129_10450074 3300009147 Bacteria 1689
164 Ga0114129_10501125 3300009147 Bacteria 1586
165 Ga0105248_10114171 3300009177 Unclassified 3046
166 Ga0105237_10602550 3300009545 Bacteria 1106
167 Ga0105249_10084697 3300009553 Unclassified 2953
168 Ga0105249_10089378 3300009553 Bacteria 2879
169 Ga0105249_10366294 3300009553 Unclassified 1464
170 Ga0105239_10169089 3300010375 Unclassified 2444
171 Ga0105246_10805550 3300011119 Unclassified 834
172 Ga0157370_10116193 3300013104 Bacteria 2499
173 Ga0157374_10043510 3300013296 Bacteria 4149
174 Ga0157374_10082468 3300013296 Bacteria 3053
175 Ga0157374_10124538 3300013296 Bacteria 2490
176 Ga0157374_10337902 3300013296 Unclassified 1495
177 Ga0157374_10384921 3300013296 Bacteria 1397
178 Ga0157374_10428606 3300013296 Unclassified 1322
179 Ga0157378_10130404 3300013297 Bacteria 2327
180 Ga0157378_10180392 3300013297 Bacteria 1986
181 Ga0157378_10258876 3300013297 Bacteria 1669
182 Ga0163162_10115933 3300013306 Bacteria 2779
183 Ga0163162_10144973 3300013306 Bacteria 2490
184 Ga0163162_10189063 3300013306 Unclassified 2186
185 Ga0163162_10529751 3300013306 Unclassified 1307
186 Ga0157372_11231428 3300013307 Unclassified 864
187 Ga0157375_10012578 3300013308 Bacteria 7510
188 Ga0157375_10075585 3300013308 Bacteria 3394
189 Ga0157375_10133738 3300013308 Bacteria 2602
190 Ga0157379_10017790 3300014968 Bacteria 6260
191 Ga0157379_10352840 3300014968 Unclassified 1347
192 Ga0157376_10047885 3300014969 Bacteria 3532
193 Ga0207697_10000558 3300025315 Bacteria 21095
194 Ga0207697_10001296 3300025315 Bacteria 13733
195 Ga0207697_10002247 3300025315 Bacteria 10091
196 Ga0207697_10005154 3300025315 Bacteria 6105
197 Ga0207697_10011982 3300025315 Unclassified 3650
198 Ga0207697_10013221 3300025315 Bacteria 3445
199 Ga0207697_10015026 3300025315 Unclassified 3203
200 Ga0207697_10015137 3300025315 Bacteria 3190
201 Ga0207692_10235640 3300025898 Bacteria 1091
202 Ga0207680_10020468 3300025903 Bacteria 3562
203 Ga0207680_10086392 3300025903 Bacteria 1984
204 Ga0207647_10256412 3300025904 Bacteria 1002
205 Ga0207685_10029521 3300025905 Bacteria 1942
206 Ga0207645_10008326 3300025907 Bacteria 7242
207 Ga0207684_10000118 3300025910 Bacteria 145120
208 Ga0207684_10005283 3300025910 Bacteria 11972
209 Ga0207684_10070707 3300025910 Bacteria 2966
210 Ga0207684_10161420 3300025910 Bacteria 1930
211 Ga0207684_10296353 3300025910 Bacteria 1394
212 Ga0207707_10100021 3300025912 Bacteria 2534
213 Ga0207671_10533829 3300025914 Bacteria 935
214 Ga0207693_10006583 3300025915 Bacteria 9616
215 Ga0207693_10040915 3300025915 Bacteria 3650
216 Ga0207693_10043199 3300025915 Bacteria 3547
217 Ga0207693_10083108 3300025915 Unclassified 2508
218 Ga0207693_10170364 3300025915 Unclassified 1715
219 Ga0207663_10077435 3300025916 Unclassified 2164
220 Ga0207663_10193268 3300025916 Bacteria 1463
221 Ga0207657_10077394 3300025919 Bacteria 2803
222 Ga0207649_10044166 3300025920 Unclassified 2728
223 Ga0207652_10693319 3300025921 Unclassified 909
224 Ga0207646_10015946 3300025922 Bacteria 7064
225 Ga0207646_10077382 3300025922 Bacteria 2973
226 Ga0207646_10079200 3300025922 Bacteria 2937
227 Ga0207646_10107124 3300025922 Bacteria 2507
228 Ga0207646_10347716 3300025922 Unclassified 1340
229 Ga0207646_10512596 3300025922 Bacteria 1080
230 Ga0207646_10526430 3300025922 Bacteria 1064
231 Ga0207646_10609618 3300025922 Unclassified 979
232 Ga0207650_10168685 3300025925 Bacteria 1738
233 Ga0207650_10185278 3300025925 Bacteria 1660
234 Ga0207659_10103878 3300025926 Bacteria 2148
235 Ga0207659_10274516 3300025926 Bacteria 1376
236 Ga0207659_10344441 3300025926 Unclassified 1235
237 Ga0207700_10414598 3300025928 Bacteria 1182
238 Ga0207644_10004285 3300025931 Bacteria 9258
239 Ga0207644_10077212 3300025931 Bacteria 2452
240 Ga0207644_10148110 3300025931 Bacteria 1814
241 Ga0207644_10204959 3300025931 Unclassified 1557
242 Ga0207690_10057864 3300025932 Bacteria 2620
243 Ga0207706_10072544 3300025933 Bacteria 3028
244 Ga0207706_10309745 3300025933 Bacteria 1375
245 Ga0207706_10315692 3300025933 Bacteria 1360
246 Ga0207670_10017114 3300025936 Unclassified 4375
247 Ga0207670_10158930 3300025936 Bacteria 1685
248 Ga0207670_10248680 3300025936 Bacteria 1373
249 Ga0207670_10248997 3300025936 Bacteria 1372
250 Ga0207669_10112924 3300025937 Bacteria 1825
251 Ga0207665_10724225 3300025939 Unclassified 783
252 Ga0207691_10001750 3300025940 Bacteria 21379
253 Ga0207691_10134388 3300025940 Unclassified 2183
254 Ga0207691_10225327 3300025940 Bacteria 1624
255 Ga0207691_10246882 3300025940 Unclassified 1542
256 Ga0207689_10142511 3300025942 Bacteria 1974
257 Ga0207661_10491819 3300025944 Bacteria 1120
258 Ga0207679_10286381 3300025945 Bacteria 1415
259 Ga0207651_10315909 3300025960 Unclassified 1304
260 Ga0207651_10389454 3300025960 Unclassified 1183
261 Ga0207651_10450228 3300025960 Unclassified 1104
262 Ga0207651_10709803 3300025960 Unclassified 886
263 Ga0207712_10210866 3300025961 Unclassified 1547
264 Ga0207668_10193682 3300025972 Unclassified 1613
265 Ga0207668_11134456 3300025972 Unclassified 701
266 Ga0207640_10313093 3300025981 Unclassified 1247
267 Ga0207658_10164831 3300025986 Bacteria 1819
268 Ga0207658_10179387 3300025986 Bacteria 1751
269 Ga0207703_10249017 3300026035 Bacteria 1600
270 Ga0207703_10867991 3300026035 Unclassified 863
271 Ga0207708_10014747 3300026075 Bacteria 5849
272 Ga0207702_10695770 3300026078 Unclassified 1002
273 Ga0207641_10284403 3300026088 Unclassified 1557
274 Ga0207641_10506986 3300026088 Unclassified 1172
275 Ga0207648_10005643 3300026089 Bacteria 12563
276 Ga0207674_10735003 3300026116 Unclassified 952
277 Ga0207683_10398313 3300026121 Unclassified 1266
278 Ga0207683_11092150 3300026121 Unclassified 740
279 Ga0209974_10011806 3300027876 Bacteria 2928
280 Ga0207428_10639292 3300027907 Bacteria 764
281 Ga0268266_10072520 3300028379 Bacteria 2986
282 Ga0268266_10270418 3300028379 Unclassified 1577
283 Ga0268266_10488329 3300028379 Bacteria 1175
284 Ga0268265_10138043 3300028380 Unclassified 2037
285 Ga0268265_10147584 3300028380 Bacteria 1979
286 Ga0268264_10173461 3300028381 Bacteria 1952
287 Ga0268264_10336481 3300028381 Bacteria 1432
288 Ga0268264_10641666 3300028381 Bacteria 1050
289 Ga0265760_10000637 3300031090 Bacteria 9936
290 Ga0307408_100274920 3300031548 Unclassified 1400
291 Ga0307405_10151066 3300031731 Unclassified 1633
292 Ga0307405_10949964 3300031731 Unclassified 730
293 Ga0307413_10079468 3300031824 Bacteria 2097
294 Ga0307410_10019403 3300031852 Unclassified 4136
295 Ga0307410_10067045 3300031852 Unclassified 2475
296 Ga0307410_10389623 3300031852 Unclassified 1123
297 Ga0307406_10973431 3300031901 Unclassified 726
298 Ga0307407_10032202 3300031903 Bacteria 2848
299 Ga0307412_10118948 3300031911 Unclassified 1899
300 Ga0307409_100004811 3300031995 Bacteria 7662
301 Ga0307409_100026546 3300031995 Unclassified 4086
302 Ga0307416_100208863 3300032002 Bacteria 1860
303 Ga0307411_10077942 3300032005 Unclassified 2270
304 Ga0307411_10172591 3300032005 Bacteria 1632
305 Ga0307415_100017477 3300032126 Bacteria 4303
306 Ga0373954_0396345 3300035118 Unclassified 682
307 Ga0373956_0092234 3300035119 Bacteria 1398
308 Ga0373943_0061366 3300035170 Unclassified 1879
309 Ga0373955_0105808 3300035172 Bacteria 1621
310 Ga0373955_0608058 3300035172 Unclassified 670
311 Ga0373935_0022101 3300035692 Unclassified 3897
312 Ga0373933_0495024 3300035724 Unclassified 801
313 Ga0373947_0070346 3300035725 Unclassified 2144
314 Ga0373937_0121641 3300036401 Bacteria 2432
315 Ga0373925_0153590 3300037068 Bacteria 1809
316 Ga0373925_0298931 3300037068 Unclassified 1299
317 Ga0395899_0026246 3300037312 Unclassified 4396
318 Ga0395900_0022181 3300037418 Bacteria 6495
319 Ga0395900_0132888 3300037418 Bacteria 2550
320 Ga0395900_0279683 3300037418 Unclassified 1661
321 Ga0395900_0295119 3300037418 Bacteria 1609
322 Ga0395900_0421384 3300037418 Bacteria 1296
323 Ga0395900_0704648 3300037418 Unclassified 943
324 Ga0395898_0006638 3300037466 Bacteria 12338
325 Ga0395905_0256782 3300037471 Unclassified 1632
326 Ga0395905_0593018 3300037471 Unclassified 1010
327 Ga0395905_1185609 3300037471 Unclassified 667
328 Ga0395901_0003778 3300038443 Bacteria 15252
329 Ga0395901_0147893 3300038443 Unclassified 2469
330 Ga0395901_0525080 3300038443 Unclassified 1202
331 Ga0439448_0016964 3300042005 Bacteria 2220
332 Ga0439455_0009016 3300042012 Unclassified 2155
333 Ga0439455_0012712 3300042012 Unclassified 1895
334 Ga0439458_0057339 3300042157 Unclassified 968
335 Ga0439464_0056719 3300042439 Unclassified 1141
336 Ga0439440_0016726 3300042993 Unclassified 1609
337 Ga0495592_0003325 3300046454 Bacteria 11508
338 Ga0495603_0110369 3300046455 Bacteria 1605
339 Ga0495641_0135145 3300046461 Bacteria 1101
340 Ga0495651_0175350 3300046462 Bacteria 1523
341 Ga0495651_0242102 3300046462 Unclassified 1237
342 Ga0495653_0185604 3300046463 Bacteria 1423
343 Ga0495639_0186418 3300046475 Unclassified 1012
344 Ga0495664_0086910 3300046477 Bacteria 1878
345 Ga0495608_0103855 3300046511 Bacteria 1831
346 Ga0495618_0025958 3300046514 Bacteria 3639
347 Ga0495618_0090168 3300046514 Unclassified 1961
348 Ga0495630_0011697 3300046517 Bacteria 6360
349 Ga0495630_0178571 3300046517 Unclassified 1619
350 Ga0495640_0189141 3300046533 Bacteria 1309
351 Ga0495586_0061242 3300046535 Unclassified 2048
352 Ga0495587_0032197 3300046536 Bacteria 3170
353 Ga0495645_0004951 3300046543 Bacteria 9116
354 Ga0495667_0436943 3300046559 Unclassified 823
355 Ga0495667_0530200 3300046559 Unclassified 736
356 Ga0495634_0087863 3300046642 Bacteria 2022
357 Ga0495634_0193221 3300046642 Bacteria 1268
358 Ga0495635_0149080 3300046663 Unclassified 1592
359 Ga0495635_0409974 3300046663 Bacteria 899
360 Ga0495657_0057534 3300046675 Unclassified 2585
361 Ga0495623_0008955 3300046679 Bacteria 6499
362 Ga0495646_0304634 3300046680 Unclassified 842
363 Ga0495658_0034473 3300046683 Unclassified 2778
364 Ga0495613_0407006 3300046689 Unclassified 927
365 Ga0495604_0010465 3300047317 Bacteria 7352
366 Ga0495674_0123372 3300047319 Bacteria 2187
367 Ga0495674_0192536 3300047319 Bacteria 1694
368 Ga0495680_0690385 3300047322 Unclassified 675
369 Ga0495684_0006776 3300047471 Bacteria 8893
370 Ga0495684_0247180 3300047471 Unclassified 1299
371 Ga0495602_0014581 3300048088 Bacteria 7973
372 Ga0496101_0443375 3300048904 Unclassified 1024
373 Ga0496102_0110383 3300048905 Unclassified 2564
374 Ga0496102_0122143 3300048905 Bacteria 2433
375 Ga0496103_0306762 3300048906 Unclassified 1021
376 Ga0496104_0232137 3300048907 Bacteria 1757
377 Ga0496105_0111240 3300048908 Unclassified 2261
378 Ga0496105_0292505 3300048908 Bacteria 1311
379 Ga0496106_0306120 3300048909 Unclassified 1275
380 Ga0496106_0862012 3300048909 Bacteria 716
381 Ga0496108_0156818 3300048911 Bacteria 1966
382 Ga0496108_0488292 3300048911 Bacteria 1076
383 Ga0496109_0061315 3300048912 Bacteria 3438
384 Ga0496109_0109479 3300048912 Unclassified 2568
385 Ga0496109_0390352 3300048912 Bacteria 1315
386 Ga0496110_0762347 3300048913 Unclassified 871
387 Ga0496110_1256791 3300048913 Unclassified 649
388 Ga0496111_0639061 3300048914 Unclassified 777
389 Ga0496112_0382531 3300048915 Unclassified 1348
390 Ga0496112_0508931 3300048915 Bacteria 1139
391 Ga0496112_0570089 3300048915 Bacteria 1065
392 Ga0496113_0134479 3300048916 Unclassified 1942
393 Ga0496113_0767018 3300048916 Bacteria 767
394 Ga0496114_0121542 3300048917 Bacteria 2246
395 Ga0501292_015010 3300049515 Unclassified 1207
396 Ga0501069_0707417 3300049585 Unclassified 608
397 nmdc:mga05p37_1136332_c1 3300050507 Unclassified 814
398 nmdc:mga05p37_121882_c1 3300050507 Unclassified 3202
399 nmdc:mga05p37_240680_c1 3300050507 Unclassified 2176
400 nmdc:mga0n895_304609_c1 3300050512 Unclassified 1615
401 nmdc:mga0n895_433335_c1 3300050512 Bacteria 1328
402 nmdc:mga08x19_209993_c1 3300050514 Bacteria 1336
403 nmdc:mga0a205_188581_c1 3300050515 Bacteria 1954
404 Ga0495601_0000516 3300053077 Bacteria 20381
405 Ga0495612_0003636 3300053078 Bacteria 6392
406 Ga0495619_0108751 3300053085 Bacteria 1892
407 Ga0495619_0223041 3300053085 Bacteria 1306
408 Ga0500566_0254066 3300053094 Bacteria 853
409 Ga0070708_100482803
410 SwRhRL2b_contig_1094174
411 SwRhRL2b_contig_312667
412 JGI24035J26624_1007366
413 JGI25405J52794_10008723
414 Ga0065704_10005909
415 Ga0065704_10079738
416 Ga0065712_10015970
417 Ga0065712_10129162
418 Ga0065712_10196738
419 Ga0065715_10007908
420 Ga0065715_10013221
421 Ga0065715_10053648
422 Ga0065715_10137109
423 Ga0065715_10327834
424 Ga0065707_10008955
425 Ga0065707_10121794
426 Ga0070676_10003664
427 Ga0070676_10390536
428 Ga0070683_100205482
429 Ga0070683_100808038
430 Ga0070690_100016876
431 Ga0070670_100163998
432 Ga0070670_100190045
433 Ga0070666_10012946
434 Ga0070666_10033400
435 Ga0070680_100040599
436 Ga0068868_100060821
437 Ga0068868_100113684
438 Ga0070660_100274134
439 Ga0070660_100280730
440 Ga0070689_100029030
441 Ga0070689_100072445
442 Ga0070689_100100123
443 Ga0070689_100389124
444 Ga0070661_100137306
445 Ga0070668_100034224
446 Ga0070668_100147730
447 Ga0070668_100173835
448 Ga0070669_100102075
449 Ga0070669_100777726
450 Ga0070675_100115096
451 Ga0070675_100137630
452 Ga0070675_100193895
453 Ga0070671_100010402
454 Ga0070671_100091372
455 Ga0070671_100155207
456 Ga0070671_100374810
457 Ga0070673_100061484
458 Ga0070673_100164020
459 Ga0070688_100007802
460 Ga0070688_100049841
461 Ga0070688_100139906
462 Ga0070688_100543072
463 Ga0070659_100058099
464 Ga0070667_100032400
465 Ga0070667_100828225
466 Ga0070709_10156878
467 Ga0070714_100105388
468 Ga0070714_100189661
469 Ga0070714_100790520
470 Ga0070713_100150830
471 Ga0070705_100041508
472 Ga0070700_100088632
473 Ga0070708_100001091
474 Ga0070708_100054183
475 Ga0070708_100071071
476 Ga0070708_100113289
477 Ga0070708_100213396
478 Ga0070708_100587788
479 Ga0070662_100040521
480 Ga0070662_100171221
481 Ga0070662_100237694
482 Ga0070662_100635468
483 Ga0070681_10096385
484 Ga0068867_100062616
485 Ga0070685_10054764
486 Ga0070706_100000060
487 Ga0070706_100013247
488 Ga0070706_100019130
489 Ga0070706_100025455
490 Ga0070706_100047990
491 Ga0070706_100195255
492 Ga0070707_100023306
493 Ga0070707_100036794
494 Ga0070707_100061268
495 Ga0070707_100068859
496 Ga0070707_100224701
497 Ga0070707_100227373
498 Ga0070707_100358034
499 Ga0070707_100669610
500 Ga0070698_100002832
501 Ga0070698_100020733
502 Ga0070698_100040117
503 Ga0070699_100218620
504 Ga0070684_100010243
505 Ga0070684_100260324
506 Ga0070697_100017287
507 Ga0070697_100087771
508 Ga0070697_100185083
509 Ga0070697_100351426
510 Ga0070697_100382964
511 Ga0070697_100497651
512 Ga0068853_101461073
513 Ga0070672_100026857
514 Ga0070672_100220087
515 Ga0070696_100028110
516 Ga0070665_100055867
517 Ga0070665_100413226
518 Ga0070665_100443504
519 Ga0070665_100512962
520 Ga0070704_100504046
521 Ga0070664_100349347
522 Ga0070664_100443080
523 Ga0068857_100551436
524 Ga0068859_100561315
525 Ga0068864_100652174
526 Ga0068863_100081353
527 Ga0068863_100138340
528 Ga0068858_100038213
529 Ga0068858_100977067
530 Ga0068860_100084958
531 Ga0068860_100336454
532 Ga0068860_100385790
533 Ga0081455_10004607
534 Ga0081455_10005191
535 Ga0081455_10006370
536 Ga0081455_10011578
537 Ga0081455_10015926
538 Ga0081455_10063405
539 Ga0081455_10078818
540 Ga0081455_10088170
541 Ga0081540_1000968
542 Ga0081540_1028787
543 Ga0081540_1145036
544 Ga0081539_10012065
545 Ga0081539_10030241
546 Ga0070717_10062877
547 Ga0070715_10006670
548 Ga0070715_10255585
549 Ga0070716_100710249
550 Ga0070712_100021271
551 Ga0070712_100044986
552 Ga0070712_100110961
553 Ga0070712_100261035
554 Ga0097621_100085689
555 Ga0097621_100498214
556 Ga0097621_100517840
557 Ga0068871_100050804
558 Ga0068871_100598012
559 Ga0075434_100242071
560 Ga0075434_100404584
561 Ga0068865_100108249
562 Ga0097620_100561329
563 Ga0099794_10204673
564 Ga0099795_10027157
565 Ga0111539_10347626
566 Ga0111539_10760486
567 Ga0105245_10048427
568 Ga0105245_11438907
569 Ga0114129_10295911
570 Ga0114129_10428248
571 Ga0114129_10450074
572 Ga0114129_10501125
573 Ga0105248_10114171
574 Ga0105237_10602550
575 Ga0105249_10084697
576 Ga0105249_10089378
577 Ga0105249_10366294
578 Ga0105239_10169089
579 Ga0105246_10805550
580 Ga0157370_10116193
581 Ga0157374_10043510
582 Ga0157374_10082468
583 Ga0157374_10124538
584 Ga0157374_10337902
585 Ga0157374_10384921
586 Ga0157374_10428606
587 Ga0157378_10130404
588 Ga0157378_10180392
589 Ga0157378_10258876
590 Ga0163162_10115933
591 Ga0163162_10144973
592 Ga0163162_10189063
593 Ga0163162_10529751
594 Ga0157372_11231428
595 Ga0157375_10012578
596 Ga0157375_10075585
597 Ga0157375_10133738
598 Ga0157379_10017790
599 Ga0157379_10352840
600 Ga0157376_10047885
601 Ga0207697_10000558
602 Ga0207697_10001296
603 Ga0207697_10002247
604 Ga0207697_10005154
605 Ga0207697_10011982
606 Ga0207697_10013221
607 Ga0207697_10015026
608 Ga0207697_10015137
609 Ga0207692_10235640
610 Ga0207680_10020468
611 Ga0207680_10086392
612 Ga0207647_10256412
613 Ga0207685_10029521
614 Ga0207645_10008326
615 Ga0207684_10000118
616 Ga0207684_10005283
617 Ga0207684_10070707
618 Ga0207684_10161420
619 Ga0207684_10296353
620 Ga0207707_10100021
621 Ga0207671_10533829
622 Ga0207693_10006583
623 Ga0207693_10040915
624 Ga0207693_10043199
625 Ga0207693_10083108
626 Ga0207693_10170364
627 Ga0207663_10077435
628 Ga0207663_10193268
629 Ga0207657_10077394
630 Ga0207649_10044166
631 Ga0207652_10693319
632 Ga0207646_10015946
633 Ga0207646_10077382
634 Ga0207646_10079200
635 Ga0207646_10107124
636 Ga0207646_10347716
637 Ga0207646_10512596
638 Ga0207646_10526430
639 Ga0207646_10609618
640 Ga0207650_10168685
641 Ga0207650_10185278
642 Ga0207659_10103878
643 Ga0207659_10274516
644 Ga0207659_10344441
645 Ga0207700_10414598
646 Ga0207644_10004285
647 Ga0207644_10077212
648 Ga0207644_10148110
649 Ga0207644_10204959
650 Ga0207690_10057864
651 Ga0207706_10072544
652 Ga0207706_10309745
653 Ga0207706_10315692
654 Ga0207670_10017114
655 Ga0207670_10158930
656 Ga0207670_10248680
657 Ga0207670_10248997
658 Ga0207669_10112924
659 Ga0207665_10724225
660 Ga0207691_10001750
661 Ga0207691_10134388
662 Ga0207691_10225327
663 Ga0207691_10246882
664 Ga0207689_10142511
665 Ga0207661_10491819
666 Ga0207679_10286381
667 Ga0207651_10315909
668 Ga0207651_10389454
669 Ga0207651_10450228
670 Ga0207651_10709803
671 Ga0207712_10210866
672 Ga0207668_10193682
673 Ga0207668_11134456
674 Ga0207640_10313093
675 Ga0207658_10164831
676 Ga0207658_10179387
677 Ga0207703_10249017
678 Ga0207703_10867991
679 Ga0207708_10014747
680 Ga0207702_10695770
681 Ga0207641_10284403
682 Ga0207641_10506986
683 Ga0207648_10005643
684 Ga0207674_10735003
685 Ga0207683_10398313
686 Ga0207683_11092150
687 Ga0209974_10011806
688 Ga0207428_10639292
689 Ga0268266_10072520
690 Ga0268266_10270418
691 Ga0268266_10488329
692 Ga0268265_10138043
693 Ga0268265_10147584
694 Ga0268264_10173461
695 Ga0268264_10336481
696 Ga0268264_10641666
697 Ga0265760_10000637
698 Ga0307408_100274920
699 Ga0307405_10151066
700 Ga0307405_10949964
701 Ga0307413_10079468
702 Ga0307410_10019403
703 Ga0307410_10067045
704 Ga0307410_10389623
705 Ga0307406_10973431
706 Ga0307407_10032202
707 Ga0307412_10118948
708 Ga0307409_100004811
709 Ga0307409_100026546
710 Ga0307416_100208863
711 Ga0307411_10077942
712 Ga0307411_10172591
713 Ga0307415_100017477
714 Ga0373954_0396345
715 Ga0373956_0092234
716 Ga0373943_0061366
717 Ga0373955_0105808
718 Ga0373955_0608058
719 Ga0373935_0022101
720 Ga0373933_0495024
721 Ga0373947_0070346
722 Ga0373937_0121641
723 Ga0373925_0153590
724 Ga0373925_0298931
725 Ga0395899_0026246
726 Ga0395900_0022181
727 Ga0395900_0132888
728 Ga0395900_0279683
729 Ga0395900_0295119
730 Ga0395900_0421384
731 Ga0395900_0704648
732 Ga0395898_0006638
733 Ga0395905_0256782
734 Ga0395905_0593018
735 Ga0395905_1185609
736 Ga0395901_0003778
737 Ga0395901_0147893
738 Ga0395901_0525080
739 Ga0439448_0016964
740 Ga0439455_0009016
741 Ga0439455_0012712
742 Ga0439458_0057339
743 Ga0439464_0056719
744 Ga0439440_0016726
745 Ga0495592_0003325
746 Ga0495603_0110369
747 Ga0495641_0135145
748 Ga0495651_0175350
749 Ga0495651_0242102
750 Ga0495653_0185604
751 Ga0495639_0186418
752 Ga0495664_0086910
753 Ga0495608_0103855
754 Ga0495618_0025958
755 Ga0495618_0090168
756 Ga0495630_0011697
757 Ga0495630_0178571
758 Ga0495640_0189141
759 Ga0495586_0061242
760 Ga0495587_0032197
761 Ga0495645_0004951
762 Ga0495667_0436943
763 Ga0495667_0530200
764 Ga0495634_0087863
765 Ga0495634_0193221
766 Ga0495635_0149080
767 Ga0495635_0409974
768 Ga0495657_0057534
769 Ga0495623_0008955
770 Ga0495646_0304634
771 Ga0495658_0034473
772 Ga0495613_0407006
773 Ga0495604_0010465
774 Ga0495674_0123372
775 Ga0495674_0192536
776 Ga0495680_0690385
777 Ga0495684_0006776
778 Ga0495684_0247180
779 Ga0495602_0014581
780 Ga0496101_0443375
781 Ga0496102_0110383
782 Ga0496102_0122143
783 Ga0496103_0306762
784 Ga0496104_0232137
785 Ga0496105_0111240
786 Ga0496105_0292505
787 Ga0496106_0306120
788 Ga0496106_0862012
789 Ga0496108_0156818
790 Ga0496108_0488292
791 Ga0496109_0061315
792 Ga0496109_0109479
793 Ga0496109_0390352
794 Ga0496110_0762347
795 Ga0496110_1256791
796 Ga0496111_0639061
797 Ga0496112_0382531
798 Ga0496112_0508931
799 Ga0496112_0570089
800 Ga0496113_0134479
801 Ga0496113_0767018
802 Ga0496114_0121542
803 Ga0501292_015010
804 Ga0501069_0707417
805 nmdc:mga05p37_1136332_c1
806 nmdc:mga05p37_121882_c1
807 nmdc:mga05p37_240680_c1
808 nmdc:mga0n895_304609_c1
809 nmdc:mga0n895_433335_c1
810 nmdc:mga08x19_209993_c1
811 nmdc:mga0a205_188581_c1
812 Ga0495601_0000516
813 Ga0495612_0003636
814 Ga0495619_0108751
815 Ga0495619_0223041
816 Ga0500566_0254066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ob6-assembly1.cif.gz_B cpr-c4 - a conserved novel protease from the candidate phyla radiation 0.9246 7 200
7pjo-assembly1.cif.gz_BBB crystal form 3 of cpr-c4: a cysteine protease from the candidate phyla radiation 0.9213 7 202
7pjo-assembly1.cif.gz_AAA crystal form 3 of cpr-c4: a cysteine protease from the candidate phyla radiation 0.92 7 200
7ob6-assembly1.cif.gz_A cpr-c4 - a conserved novel protease from the candidate phyla radiation 0.9137 7 200
7ob7-assembly1.cif.gz_A-2 cpr-c4 - novel protease from the candidate phyla radiation (cpr) 0.9125 7 200
ID Description Score Start End Superfamily
af_A7E2V1_331_437_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7988 25 103 3.10.620.30
af_A4HRJ6_1964_2102_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7773 23 103 3.10.620.30
af_Q8TAP6_302_445_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7703 25 103 3.10.620.30
af_A0A286YDU8_996_1405_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.6797 12 103 3.10.620.30
af_Q86AX0_679_844_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.6788 1 103 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A2V5NQT1-F1-model_v4 Transglutaminase-like domain-containing protein 0.9917 9 160
AF-A0A1Q7FH78-F1-model_v4 Transglutaminase-like domain-containing protein 0.9849 2 169
AF-A0A7X9F7U4-F1-model_v4 Transglutaminase-like domain-containing protein 0.9823 12 178
AF-A0A2V8I9U0-F1-model_v4 Uncharacterized protein 0.9817 66 149
AF-A0A1V6BJK0-F1-model_v4 Transglutaminase-like domain-containing protein 0.9794 12 203

Map