F436550

General Info

Members Datasets Scaffolds Average Seq Length
407 238 814 233

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0205996|Ga0496101_0205996_43_816
Length 257
Sequence VTLTKYGAIRASSKLISAKQRGLPMLEIREVHVYYGAIHALKGVSLTVERGELVTLIGANGAGKTTTLKTLSGLLRPKRGAVLLEGQTLQRTEAHEIVRRGVAHVPEGRKVFPRFTVLENLMIGGYARRKAALAPELEFVFQMFPRLKERQKQYAGTLSGGEQQMLAIGRALMAKPKLLLLDEPSMGLAPKIVEQILETIRTINQAGVTVLLVEQNAAMALAISHRGYVLETGHVTLQGTASELAGNDLVRQAYLGG

Samples

Sample ID Description Type Environment
1 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2643221607 Rhizobium sp. Root73 Isolate Unclassified
237 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
238 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0.25
Rhizoplane 4.91
Rhizosphere 93.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496101_0205996 3300048904 Bacteria 1522
2 JGI25153J46596_10015662 3300003215 Bacteria 3076
3 JGI25405J52794_10003441 3300003911 Bacteria 2774
4 Ga0065704_10120732 3300005289 Bacteria 1777
5 Ga0065712_10000155 3300005290 Bacteria 59188
6 Ga0065712_10000302 3300005290 Bacteria 17933
7 Ga0065715_10000175 3300005293 Bacteria 46696
8 Ga0065715_10012792 3300005293 Bacteria 1952
9 Ga0065707_10100231 3300005295 Bacteria 2946
10 Ga0070676_10016572 3300005328 Bacteria 4076
11 Ga0070683_100419859 3300005329 Bacteria 1276
12 Ga0070690_100041723 3300005330 Bacteria 2906
13 Ga0070670_100000418 3300005331 Bacteria 34950
14 Ga0070670_100000846 3300005331 Bacteria 23930
15 Ga0070670_100006757 3300005331 Bacteria 9723
16 Ga0070677_10139316 3300005333 Bacteria 1117
17 Ga0068868_100181665 3300005338 Bacteria 1745
18 Ga0070660_100024211 3300005339 Bacteria 4503
19 Ga0070660_100103584 3300005339 Bacteria 2257
20 Ga0070689_100459898 3300005340 Bacteria 1084
21 Ga0070687_100062440 3300005343 Bacteria 1973
22 Ga0070661_100023135 3300005344 Bacteria 4452
23 Ga0070692_10055001 3300005345 Bacteria 2080
24 Ga0070668_100455421 3300005347 Bacteria 1101
25 Ga0070669_100087527 3300005353 Bacteria 2329
26 Ga0070669_100394597 3300005353 Bacteria 1131
27 Ga0070675_100040630 3300005354 Bacteria 3798
28 Ga0070675_100042670 3300005354 Bacteria 3707
29 Ga0070675_100195925 3300005354 Bacteria 1752
30 Ga0070675_100304759 3300005354 Bacteria 1404
31 Ga0070675_100465301 3300005354 Bacteria 1136
32 Ga0070671_100021127 3300005355 Bacteria 5315
33 Ga0070671_100074144 3300005355 Bacteria 2843
34 Ga0070674_100015236 3300005356 Bacteria 4797
35 Ga0070673_100063112 3300005364 Bacteria 2946
36 Ga0070673_100089188 3300005364 Bacteria 2517
37 Ga0070673_100257513 3300005364 Bacteria 1523
38 Ga0070659_100250910 3300005366 Bacteria 1466
39 Ga0070711_100446344 3300005439 Bacteria 1058
40 Ga0070705_100179771 3300005440 Bacteria 1432
41 Ga0070700_100615236 3300005441 Bacteria 853
42 Ga0070678_100002056 3300005456 Bacteria 10904
43 Ga0070678_100081783 3300005456 Bacteria 2450
44 Ga0070662_100017039 3300005457 Bacteria 4889
45 Ga0070681_10009210 3300005458 Bacteria 9705
46 Ga0070681_10009653 3300005458 Bacteria 9492
47 Ga0070681_10124534 3300005458 Bacteria 2510
48 Ga0068867_100233804 3300005459 Bacteria 1487
49 Ga0070698_100280391 3300005471 Bacteria 1598
50 Ga0070699_100255975 3300005518 Bacteria 1565
51 Ga0070679_100414099 3300005530 Bacteria 1293
52 Ga0070697_100101909 3300005536 Bacteria 2385
53 Ga0070697_100108022 3300005536 Bacteria 2315
54 Ga0068853_100089632 3300005539 Bacteria 2702
55 Ga0070672_100054234 3300005543 Bacteria 3137
56 Ga0070686_100112173 3300005544 Bacteria 1859
57 Ga0070686_100321469 3300005544 Bacteria 1154
58 Ga0070695_100023430 3300005545 Bacteria 3794
59 Ga0070695_100109821 3300005545 Bacteria 1870
60 Ga0070696_100023289 3300005546 Bacteria 4209
61 Ga0070696_100087843 3300005546 Bacteria 2208
62 Ga0070693_100019718 3300005547 Bacteria 3542
63 Ga0070704_100024361 3300005549 Bacteria 3971
64 Ga0070704_100186644 3300005549 Bacteria 1663
65 Ga0070664_100008071 3300005564 Bacteria 8507
66 Ga0068854_100099547 3300005578 Bacteria 2177
67 Ga0068856_100056363 3300005614 Bacteria 3877
68 Ga0070702_100086322 3300005615 Bacteria 1893
69 Ga0070702_100202045 3300005615 Bacteria 1316
70 Ga0068852_100237825 3300005616 Bacteria 1739
71 Ga0068859_100302374 3300005617 Bacteria 1693
72 Ga0068866_10049734 3300005718 Bacteria 2126
73 Ga0068861_100441710 3300005719 Bacteria 1164
74 Ga0068870_10231934 3300005840 Bacteria 1135
75 Ga0068863_100231190 3300005841 Bacteria 1784
76 Ga0068863_100285615 3300005841 Bacteria 1599
77 Ga0068860_100082323 3300005843 Bacteria 3061
78 Ga0081455_10000550 3300005937 Bacteria 48753
79 Ga0081455_10035063 3300005937 Bacteria 4488
80 Ga0081538_10005706 3300005981 Bacteria 11129
81 Ga0081538_10085359 3300005981 Bacteria 1659
82 Ga0075432_10135418 3300006058 Bacteria 936
83 Ga0070712_100000903 3300006175 Bacteria 17757
84 Ga0070712_100018070 3300006175 Bacteria 4574
85 Ga0075369_10044659 3300006186 Bacteria 1904
86 Ga0097621_100189748 3300006237 Bacteria 1779
87 Ga0068871_100076887 3300006358 Bacteria 2758
88 Ga0075428_100261481 3300006844 Bacteria 1863
89 Ga0075428_100275712 3300006844 Bacteria 1810
90 Ga0075428_100464415 3300006844 Bacteria 1355
91 Ga0075430_100007470 3300006846 Bacteria 9226
92 Ga0075430_100094005 3300006846 Bacteria 2506
93 Ga0075430_100119117 3300006846 Bacteria 2200
94 Ga0075430_100433326 3300006846 Bacteria 1085
95 Ga0075430_100649582 3300006846 Bacteria 870
96 Ga0075431_100032266 3300006847 Bacteria 5396
97 Ga0075431_100077151 3300006847 Bacteria 3439
98 Ga0075431_100319158 3300006847 Bacteria 1567
99 Ga0075431_100378245 3300006847 Bacteria 1420
100 Ga0075433_10010473 3300006852 Bacteria 7443
101 Ga0075433_10124496 3300006852 Bacteria 2290
102 Ga0075433_10188712 3300006852 Bacteria 1834
103 Ga0075433_10346419 3300006852 Bacteria 1313
104 Ga0075434_100063760 3300006871 Bacteria 3668
105 Ga0075434_100109947 3300006871 Bacteria 2767
106 Ga0075434_100124033 3300006871 Bacteria 2600
107 Ga0075434_101017607 3300006871 Bacteria 842
108 Ga0075429_100038098 3300006880 Bacteria 4185
109 Ga0075429_100067027 3300006880 Bacteria 3124
110 Ga0068865_100015475 3300006881 Bacteria 4866
111 Ga0068865_100043936 3300006881 Bacteria 3056
112 Ga0075436_100073296 3300006914 Bacteria 2370
113 Ga0075436_100141346 3300006914 Bacteria 1692
114 Ga0075436_100365441 3300006914 Bacteria 1042
115 Ga0097620_100302385 3300006931 Bacteria 1693
116 Ga0075435_100028609 3300007076 Bacteria 4372
117 Ga0075435_100033732 3300007076 Bacteria 4050
118 Ga0075435_100067596 3300007076 Bacteria 2910
119 Ga0075435_100126883 3300007076 Bacteria 2133
120 Ga0075435_100343691 3300007076 Bacteria 1279
121 Ga0105240_10819836 3300009093 Bacteria 1007
122 Ga0111539_10007804 3300009094 Bacteria 13664
123 Ga0111539_10176736 3300009094 Bacteria 2494
124 Ga0111539_10662309 3300009094 Bacteria 1215
125 Ga0111539_11035799 3300009094 Bacteria 954
126 Ga0105245_10095464 3300009098 Bacteria 2743
127 Ga0114129_10005844 3300009147 Bacteria 17424
128 Ga0114129_10009720 3300009147 Bacteria 13722
129 Ga0114129_10133807 3300009147 Bacteria 3404
130 Ga0114129_11020071 3300009147 Bacteria 1041
131 Ga0105241_10055311 3300009174 Bacteria 3040
132 Ga0105242_10077005 3300009176 Bacteria 2782
133 Ga0105242_10181877 3300009176 Bacteria 1855
134 Ga0105249_10017881 3300009553 Bacteria 6299
135 Ga0105249_10180759 3300009553 Bacteria 2052
136 Ga0105249_11114889 3300009553 Bacteria 859
137 Ga0105239_10144057 3300010375 Bacteria 2656
138 Ga0105239_10257265 3300010375 Bacteria 1962
139 Ga0105239_10786873 3300010375 Bacteria 1090
140 Ga0105246_10003079 3300011119 Bacteria 10130
141 Ga0157342_1000979 3300012507 Bacteria 1970
142 Ga0157373_10127530 3300013100 Bacteria 1790
143 Ga0157371_10170447 3300013102 Bacteria 1555
144 Ga0157374_10010642 3300013296 Bacteria 7921
145 Ga0157374_10429361 3300013296 Bacteria 1321
146 Ga0157378_10031296 3300013297 Bacteria 4701
147 Ga0157378_10040714 3300013297 Bacteria 4121
148 Ga0157378_10139619 3300013297 Bacteria 2249
149 Ga0163162_10024055 3300013306 Bacteria 6011
150 Ga0163162_10042997 3300013306 Bacteria 4523
151 Ga0163163_10046583 3300014325 Bacteria 4259
152 Ga0157380_10073337 3300014326 Bacteria 2775
153 Ga0157380_10250054 3300014326 Bacteria 1604
154 Ga0157380_10535208 3300014326 Bacteria 1146
155 Ga0157380_11130993 3300014326 Bacteria 823
156 Ga0157376_10014251 3300014969 Bacteria 5960
157 Ga0163161_10166506 3300017792 Bacteria 1683
158 Ga0207697_10013892 3300025315 Bacteria 3352
159 Ga0207688_10019621 3300025901 Bacteria 3685
160 Ga0207645_10003637 3300025907 Bacteria 11652
161 Ga0207684_10201264 3300025910 Bacteria 1718
162 Ga0207707_10055600 3300025912 Bacteria 3442
163 Ga0207693_10014192 3300025915 Bacteria 6412
164 Ga0207663_10336600 3300025916 Bacteria 1139
165 Ga0207662_10098951 3300025918 Bacteria 1805
166 Ga0207657_10007103 3300025919 Bacteria 11503
167 Ga0207657_10230853 3300025919 Bacteria 1480
168 Ga0207681_10044863 3300025923 Bacteria 2964
169 Ga0207650_10000539 3300025925 Bacteria 30939
170 Ga0207650_10009156 3300025925 Bacteria 6768
171 Ga0207650_10044584 3300025925 Bacteria 3260
172 Ga0207650_10209259 3300025925 Bacteria 1566
173 Ga0207659_10107757 3300025926 Bacteria 2112
174 Ga0207659_10618476 3300025926 Bacteria 924
175 Ga0207644_10106507 3300025931 Bacteria 2114
176 Ga0207644_10321320 3300025931 Bacteria 1251
177 Ga0207690_10093778 3300025932 Bacteria 2128
178 Ga0207706_10006169 3300025933 Bacteria 11129
179 Ga0207706_10010195 3300025933 Bacteria 8597
180 Ga0207709_10453978 3300025935 Bacteria 991
181 Ga0207670_10395676 3300025936 Bacteria 1104
182 Ga0207669_10009447 3300025937 Bacteria 4645
183 Ga0207704_10130622 3300025938 Bacteria 1738
184 Ga0207691_10055034 3300025940 Bacteria 3628
185 Ga0207679_10007575 3300025945 Bacteria 6893
186 Ga0207679_10190476 3300025945 Bacteria 1705
187 Ga0207667_10731283 3300025949 Bacteria 990
188 Ga0207651_10247969 3300025960 Bacteria 1455
189 Ga0207640_10416611 3300025981 Bacteria 1098
190 Ga0207677_10035751 3300026023 Bacteria 3229
191 Ga0207639_10272992 3300026041 Bacteria 1484
192 Ga0207678_10002860 3300026067 Bacteria 15666
193 Ga0207708_10076893 3300026075 Bacteria 2561
194 Ga0207641_10245614 3300026088 Bacteria 1670
195 Ga0207641_10305226 3300026088 Bacteria 1505
196 Ga0207641_10447325 3300026088 Bacteria 1248
197 Ga0207648_10109822 3300026089 Bacteria 2421
198 Ga0207676_10456935 3300026095 Bacteria 1205
199 Ga0207675_100089842 3300026118 Bacteria 2887
200 Ga0207683_10000309 3300026121 Bacteria 44202
201 Ga0207683_10096011 3300026121 Bacteria 2643
202 Ga0209983_1008452 3300027665 Bacteria 2106
203 Ga0209971_1020277 3300027682 Bacteria 1580
204 Ga0209966_1003555 3300027695 Bacteria 2626
205 Ga0209998_10022042 3300027717 Bacteria 1371
206 Ga0209974_10000700 3300027876 Bacteria 11429
207 Ga0207428_10010430 3300027907 Bacteria 8299
208 Ga0207428_10267770 3300027907 Bacteria 1271
209 Ga0265318_10001526 3300028577 Bacteria 13480
210 Ga0265332_10009005 3300031238 Bacteria 4463
211 Ga0265332_10067980 3300031238 Bacteria 1519
212 Ga0265325_10011345 3300031241 Bacteria 5121
213 Ga0265340_10026594 3300031247 Bacteria 2923
214 Ga0265339_10004516 3300031249 Bacteria 9476
215 Ga0265339_10134470 3300031249 Bacteria 1262
216 Ga0265316_10055964 3300031344 Bacteria 3083
217 Ga0307408_100065442 3300031548 Bacteria 2666
218 Ga0265313_10078472 3300031595 Bacteria 1505
219 Ga0265314_10042774 3300031711 Bacteria 3227
220 Ga0265342_10001995 3300031712 Bacteria 18185
221 Ga0265342_10053347 3300031712 Bacteria 2406
222 Ga0307406_10036722 3300031901 Bacteria 3021
223 Ga0307412_10086418 3300031911 Bacteria 2182
224 Ga0307409_100538637 3300031995 Bacteria 1144
225 Ga0307409_100566675 3300031995 Bacteria 1117
226 Ga0307416_100002471 3300032002 Bacteria 10625
227 Ga0307416_100013175 3300032002 Bacteria 5611
228 Ga0307416_100052991 3300032002 Bacteria 3252
229 Ga0307411_10031929 3300032005 Bacteria 3247
230 Ga0307415_100008341 3300032126 Bacteria 5734
231 Ga0373926_0026846 3300035083 Bacteria 2016
232 Ga0373932_0025904 3300035112 Bacteria 1592
233 Ga0373941_0105521 3300035115 Bacteria 987
234 Ga0373945_0133631 3300035116 Bacteria 996
235 Ga0373943_0022050 3300035170 Bacteria 2946
236 Ga0373946_0116125 3300035171 Bacteria 1217
237 Ga0373961_0115941 3300035241 Bacteria 882
238 Ga0373962_0124955 3300035242 Bacteria 824
239 Ga0373931_0000963 3300035691 Bacteria 12157
240 Ga0373935_0056849 3300035692 Bacteria 2495
241 Ga0373947_0310266 3300035725 Bacteria 1053
242 Ga0373937_0621795 3300036401 Bacteria 1025
243 Ga0373925_0244632 3300037068 Bacteria 1437
244 Ga0373925_0793130 3300037068 Bacteria 781
245 Ga0436360_1019914 3300039438 Bacteria 1053
246 Ga0439435_0004704 3300042436 Bacteria 2957
247 Ga0439460_0002022 3300042461 Bacteria 4861
248 Ga0466963_0031405 3300044694 Bacteria 3433
249 Ga0453684_0265249 3300044712 Bacteria 1965
250 Ga0466957_0004783 3300044842 Bacteria 7581
251 Ga0466959_0114739 3300045049 Bacteria 1919
252 Ga0451576_0028167 3300045051 Bacteria 6023
253 Ga0451576_0033234 3300045051 Bacteria 5483
254 Ga0451576_0200296 3300045051 Bacteria 2085
255 Ga0466958_0015412 3300045836 Bacteria 4381
256 Ga0466967_0109458 3300045976 Bacteria 2536
257 Ga0495603_0017974 3300046455 Bacteria 4279
258 Ga0495629_0138665 3300046459 Bacteria 1693
259 Ga0495651_0287221 3300046462 Bacteria 1109
260 Ga0495580_0029123 3300046472 Bacteria 4009
261 Ga0495580_0117504 3300046472 Bacteria 1847
262 Ga0495580_0165669 3300046472 Bacteria 1529
263 Ga0495662_0137962 3300046476 Bacteria 1200
264 Ga0495586_0014647 3300046535 Bacteria 4168
265 Ga0495598_0064456 3300046537 Bacteria 1138
266 Ga0496100_0098378 3300048903 Bacteria 2011
267 Ga0496100_0446688 3300048903 Bacteria 991
268 Ga0496103_0041887 3300048906 Bacteria 2816
269 Ga0496104_0009162 3300048907 Bacteria 8803
270 Ga0496105_0008017 3300048908 Bacteria 8205
271 Ga0496106_0060980 3300048909 Bacteria 2860
272 Ga0496108_0000373 3300048911 Bacteria 37319
273 Ga0496109_0001363 3300048912 Bacteria 20247
274 Ga0496109_0264634 3300048912 Bacteria 1620
275 Ga0496109_0609246 3300048912 Bacteria 1028
276 Ga0496109_0656737 3300048912 Bacteria 986
277 Ga0496110_0003079 3300048913 Bacteria 12645
278 Ga0496110_0109335 3300048913 Bacteria 2483
279 Ga0496111_0453843 3300048914 Bacteria 946
280 Ga0496112_0005799 3300048915 Bacteria 10742
281 Ga0496112_0011923 3300048915 Bacteria 7963
282 Ga0496112_0012092 3300048915 Bacteria 7922
283 Ga0496113_0000161 3300048916 Bacteria 29564
284 Ga0496115_0207325 3300048918 Bacteria 1619
285 Ga0501031_0004522 3300049568 Bacteria 9010
286 Ga0501032_0002333 3300049569 Bacteria 14885
287 Ga0501033_0004749 3300049570 Bacteria 10872
288 Ga0501033_0010851 3300049570 Bacteria 6985
289 Ga0501034_0210984 3300049571 Bacteria 1897
290 Ga0501036_0028550 3300049572 Bacteria 4714
291 Ga0501036_0085664 3300049572 Bacteria 2663
292 Ga0501037_0002744 3300049573 Bacteria 12736
293 Ga0501037_0056249 3300049573 Bacteria 2874
294 Ga0501038_0002267 3300049574 Bacteria 17894
295 Ga0501038_0084166 3300049574 Bacteria 2676
296 Ga0501039_0006496 3300049575 Bacteria 8891
297 Ga0501039_0064746 3300049575 Bacteria 2834
298 Ga0501039_0206129 3300049575 Bacteria 1546
299 Ga0501039_0428961 3300049575 Bacteria 1038
300 Ga0501040_0000090 3300049576 Bacteria 44991
301 Ga0501040_0034587 3300049576 Bacteria 3422
302 Ga0501040_0388176 3300049576 Bacteria 1002
303 Ga0501041_0000859 3300049577 Bacteria 16371
304 Ga0501041_0021082 3300049577 Bacteria 3903
305 Ga0501041_0195217 3300049577 Bacteria 1268
306 Ga0501042_0001763 3300049578 Bacteria 12952
307 Ga0501043_0010919 3300049579 Bacteria 7114
308 Ga0501046_0000691 3300049580 Bacteria 32754
309 Ga0501046_0015779 3300049580 Bacteria 6338
310 Ga0501046_0550964 3300049580 Bacteria 822
311 Ga0501047_0391155 3300049581 Bacteria 1224
312 Ga0501048_0006177 3300049582 Bacteria 9117
313 Ga0501048_0018798 3300049582 Bacteria 5080
314 Ga0501048_0141201 3300049582 Bacteria 1703
315 Ga0501068_0003095 3300049584 Bacteria 8881
316 Ga0501068_0006080 3300049584 Bacteria 6635
317 Ga0501068_0087375 3300049584 Bacteria 1920
318 Ga0501069_0004609 3300049585 Bacteria 7130
319 Ga0501070_0005557 3300049586 Bacteria 10751
320 Ga0501070_0083638 3300049586 Bacteria 2642
321 Ga0501071_0000618 3300049587 Bacteria 18442
322 Ga0501071_0004834 3300049587 Bacteria 8588
323 Ga0501071_0161259 3300049587 Bacteria 1676
324 Ga0501072_0000127 3300049588 Bacteria 56633
325 Ga0501072_0007882 3300049588 Bacteria 8088
326 Ga0501073_0007327 3300049589 Bacteria 8208
327 Ga0501073_0076007 3300049589 Bacteria 2338
328 Ga0501074_0004776 3300049590 Bacteria 9717
329 Ga0501074_0101787 3300049590 Bacteria 2056
330 Ga0501075_0000244 3300049591 Bacteria 29171
331 Ga0501075_0002155 3300049591 Bacteria 13040
332 Ga0501075_0019247 3300049591 Bacteria 4950
333 Ga0501075_0056211 3300049591 Bacteria 2962
334 Ga0501076_0000113 3300049592 Bacteria 44744
335 Ga0501076_0019021 3300049592 Bacteria 5241
336 Ga0501076_0103504 3300049592 Bacteria 2296
337 Ga0501076_0189028 3300049592 Bacteria 1680
338 Ga0501077_0000098 3300049593 Bacteria 45623
339 Ga0501077_0005544 3300049593 Bacteria 7680
340 Ga0501077_0010481 3300049593 Bacteria 5769
341 Ga0501077_0167612 3300049593 Bacteria 1395
342 Ga0501079_0000236 3300049741 Bacteria 33099
343 Ga0501079_0048026 3300049741 Bacteria 3293
344 Ga0501080_0000188 3300049742 Bacteria 45004
345 Ga0501080_0019222 3300049742 Bacteria 6326
346 Ga0501081_0000817 3300049743 Bacteria 18384
347 Ga0501081_0001979 3300049743 Bacteria 12764
348 Ga0501081_0005189 3300049743 Bacteria 8385
349 Ga0501081_0151144 3300049743 Bacteria 1668
350 Ga0501083_0001925 3300049744 Bacteria 14271
351 Ga0501083_0008131 3300049744 Bacteria 7420
352 Ga0501035_0016570 3300049822 Bacteria 6795
353 Ga0501044_0013454 3300049823 Bacteria 8849
354 Ga0501044_0332014 3300049823 Bacteria 1443
355 Ga0501045_0001007 3300049824 Bacteria 18491
356 Ga0501045_0002572 3300049824 Bacteria 12375
357 Ga0501045_0104252 3300049824 Bacteria 2101
358 Ga0501045_0488744 3300049824 Bacteria 914
359 nmdc:mga06z11_194914_c1 3300050494 Bacteria 1174
360 nmdc:mga05p37_53002_c1 3300050507 Bacteria 4989
361 nmdc:mga09592_158528_c1 3300050508 Bacteria 1954
362 nmdc:mga09592_575539_c1 3300050508 Bacteria 966
363 nmdc:mga09592_78888_c1 3300050508 Bacteria 2803
364 nmdc:mga0qj67_2592_c1 3300050509 Bacteria 12941
365 nmdc:mga0qj67_434261_c1 3300050509 Bacteria 1058
366 nmdc:mga0qj67_56048_c1 3300050509 Bacteria 3124
367 nmdc:mga06r32_260633_c1 3300050510 Bacteria 1721
368 nmdc:mga06r32_261906_c1 3300050510 Bacteria 1717
369 nmdc:mga06r32_45805_c1 3300050510 Bacteria 4171
370 nmdc:mga06r32_62650_c1 3300050510 Bacteria 3583
371 nmdc:mga06r32_90640_c1 3300050510 Bacteria 2987
372 nmdc:mga08y16_128476_c1 3300050511 Bacteria 2636
373 nmdc:mga08y16_39270_c1 3300050511 Bacteria 4967
374 nmdc:mga0n895_115347_c1 3300050512 Bacteria 2704
375 nmdc:mga0n895_1589_c1 3300050512 Bacteria 17087
376 nmdc:mga0n895_554707_c1 3300050512 Bacteria 1155
377 nmdc:mga0rr50_109661_c1 3300050513 Bacteria 2182
378 nmdc:mga0rr50_20759_c1 3300050513 Bacteria 4468
379 nmdc:mga0rr50_213987_c1 3300050513 Bacteria 1589
380 nmdc:mga0rr50_98078_c1 3300050513 Bacteria 2296
381 nmdc:mga08x19_108644_c1 3300050514 Bacteria 1848
382 nmdc:mga08x19_64907_c1 3300050514 Bacteria 2370
383 nmdc:mga0a205_10066_c1 3300050515 Bacteria 8677
384 nmdc:mga0a205_118910_c1 3300050515 Bacteria 2541
385 nmdc:mga0a205_131030_c1 3300050515 Bacteria 2408
386 nmdc:mga0a205_54558_c2 3300050515 Bacteria 1565
387 nmdc:mga0a205_61572_c1 3300050515 Bacteria 3625
388 nmdc:mga0a205_62567_c1 3300050515 Bacteria 3596
389 nmdc:mga0sz30_33434_c1 3300050516 Bacteria 2137
390 Ga0495619_0174432 3300053085 Bacteria 1487
391 Ga0501084_0002315 3300054114 Bacteria 15297
392 Ga0501084_0005989 3300054114 Bacteria 10003
393 Ga0501084_0070852 3300054114 Bacteria 2918
394 Ga0501084_0328488 3300054114 Bacteria 1292
395 Ga0501084_0437211 3300054114 Bacteria 1106
396 Ga0501084_0471016 3300054114 Bacteria 1062
397 Ga0590071_021589 3300059421 Bacteria 1517
398 Ga0501082_0000425 3300060353 Bacteria 37364
399 Ga0501082_0011730 3300060353 Bacteria 7534
400 Ga0501082_0167537 3300060353 Bacteria 1909
401 Ga0530510_0000379 3300061734 Bacteria 28916
402 Ga0530510_0035930 3300061734 Bacteria 3571
403 Ga0530510_0045468 3300061734 Bacteria 3172
404 Ga0530510_0079409 3300061734 Bacteria 2386
405 2644048783 2643221607 Bacteria 6314006
406 2644481584 2643221686 Bacteria 6310811
407 2842334453 2842333319 Bacteria 8899485
408 Ga0496101_0205996
409 JGI25153J46596_10015662
410 JGI25405J52794_10003441
411 Ga0065704_10120732
412 Ga0065712_10000155
413 Ga0065712_10000302
414 Ga0065715_10000175
415 Ga0065715_10012792
416 Ga0065707_10100231
417 Ga0070676_10016572
418 Ga0070683_100419859
419 Ga0070690_100041723
420 Ga0070670_100000418
421 Ga0070670_100000846
422 Ga0070670_100006757
423 Ga0070677_10139316
424 Ga0068868_100181665
425 Ga0070660_100024211
426 Ga0070660_100103584
427 Ga0070689_100459898
428 Ga0070687_100062440
429 Ga0070661_100023135
430 Ga0070692_10055001
431 Ga0070668_100455421
432 Ga0070669_100087527
433 Ga0070669_100394597
434 Ga0070675_100040630
435 Ga0070675_100042670
436 Ga0070675_100195925
437 Ga0070675_100304759
438 Ga0070675_100465301
439 Ga0070671_100021127
440 Ga0070671_100074144
441 Ga0070674_100015236
442 Ga0070673_100063112
443 Ga0070673_100089188
444 Ga0070673_100257513
445 Ga0070659_100250910
446 Ga0070711_100446344
447 Ga0070705_100179771
448 Ga0070700_100615236
449 Ga0070678_100002056
450 Ga0070678_100081783
451 Ga0070662_100017039
452 Ga0070681_10009210
453 Ga0070681_10009653
454 Ga0070681_10124534
455 Ga0068867_100233804
456 Ga0070698_100280391
457 Ga0070699_100255975
458 Ga0070679_100414099
459 Ga0070697_100101909
460 Ga0070697_100108022
461 Ga0068853_100089632
462 Ga0070672_100054234
463 Ga0070686_100112173
464 Ga0070686_100321469
465 Ga0070695_100023430
466 Ga0070695_100109821
467 Ga0070696_100023289
468 Ga0070696_100087843
469 Ga0070693_100019718
470 Ga0070704_100024361
471 Ga0070704_100186644
472 Ga0070664_100008071
473 Ga0068854_100099547
474 Ga0068856_100056363
475 Ga0070702_100086322
476 Ga0070702_100202045
477 Ga0068852_100237825
478 Ga0068859_100302374
479 Ga0068866_10049734
480 Ga0068861_100441710
481 Ga0068870_10231934
482 Ga0068863_100231190
483 Ga0068863_100285615
484 Ga0068860_100082323
485 Ga0081455_10000550
486 Ga0081455_10035063
487 Ga0081538_10005706
488 Ga0081538_10085359
489 Ga0075432_10135418
490 Ga0070712_100000903
491 Ga0070712_100018070
492 Ga0075369_10044659
493 Ga0097621_100189748
494 Ga0068871_100076887
495 Ga0075428_100261481
496 Ga0075428_100275712
497 Ga0075428_100464415
498 Ga0075430_100007470
499 Ga0075430_100094005
500 Ga0075430_100119117
501 Ga0075430_100433326
502 Ga0075430_100649582
503 Ga0075431_100032266
504 Ga0075431_100077151
505 Ga0075431_100319158
506 Ga0075431_100378245
507 Ga0075433_10010473
508 Ga0075433_10124496
509 Ga0075433_10188712
510 Ga0075433_10346419
511 Ga0075434_100063760
512 Ga0075434_100109947
513 Ga0075434_100124033
514 Ga0075434_101017607
515 Ga0075429_100038098
516 Ga0075429_100067027
517 Ga0068865_100015475
518 Ga0068865_100043936
519 Ga0075436_100073296
520 Ga0075436_100141346
521 Ga0075436_100365441
522 Ga0097620_100302385
523 Ga0075435_100028609
524 Ga0075435_100033732
525 Ga0075435_100067596
526 Ga0075435_100126883
527 Ga0075435_100343691
528 Ga0105240_10819836
529 Ga0111539_10007804
530 Ga0111539_10176736
531 Ga0111539_10662309
532 Ga0111539_11035799
533 Ga0105245_10095464
534 Ga0114129_10005844
535 Ga0114129_10009720
536 Ga0114129_10133807
537 Ga0114129_11020071
538 Ga0105241_10055311
539 Ga0105242_10077005
540 Ga0105242_10181877
541 Ga0105249_10017881
542 Ga0105249_10180759
543 Ga0105249_11114889
544 Ga0105239_10144057
545 Ga0105239_10257265
546 Ga0105239_10786873
547 Ga0105246_10003079
548 Ga0157342_1000979
549 Ga0157373_10127530
550 Ga0157371_10170447
551 Ga0157374_10010642
552 Ga0157374_10429361
553 Ga0157378_10031296
554 Ga0157378_10040714
555 Ga0157378_10139619
556 Ga0163162_10024055
557 Ga0163162_10042997
558 Ga0163163_10046583
559 Ga0157380_10073337
560 Ga0157380_10250054
561 Ga0157380_10535208
562 Ga0157380_11130993
563 Ga0157376_10014251
564 Ga0163161_10166506
565 Ga0207697_10013892
566 Ga0207688_10019621
567 Ga0207645_10003637
568 Ga0207684_10201264
569 Ga0207707_10055600
570 Ga0207693_10014192
571 Ga0207663_10336600
572 Ga0207662_10098951
573 Ga0207657_10007103
574 Ga0207657_10230853
575 Ga0207681_10044863
576 Ga0207650_10000539
577 Ga0207650_10009156
578 Ga0207650_10044584
579 Ga0207650_10209259
580 Ga0207659_10107757
581 Ga0207659_10618476
582 Ga0207644_10106507
583 Ga0207644_10321320
584 Ga0207690_10093778
585 Ga0207706_10006169
586 Ga0207706_10010195
587 Ga0207709_10453978
588 Ga0207670_10395676
589 Ga0207669_10009447
590 Ga0207704_10130622
591 Ga0207691_10055034
592 Ga0207679_10007575
593 Ga0207679_10190476
594 Ga0207667_10731283
595 Ga0207651_10247969
596 Ga0207640_10416611
597 Ga0207677_10035751
598 Ga0207639_10272992
599 Ga0207678_10002860
600 Ga0207708_10076893
601 Ga0207641_10245614
602 Ga0207641_10305226
603 Ga0207641_10447325
604 Ga0207648_10109822
605 Ga0207676_10456935
606 Ga0207675_100089842
607 Ga0207683_10000309
608 Ga0207683_10096011
609 Ga0209983_1008452
610 Ga0209971_1020277
611 Ga0209966_1003555
612 Ga0209998_10022042
613 Ga0209974_10000700
614 Ga0207428_10010430
615 Ga0207428_10267770
616 Ga0265318_10001526
617 Ga0265332_10009005
618 Ga0265332_10067980
619 Ga0265325_10011345
620 Ga0265340_10026594
621 Ga0265339_10004516
622 Ga0265339_10134470
623 Ga0265316_10055964
624 Ga0307408_100065442
625 Ga0265313_10078472
626 Ga0265314_10042774
627 Ga0265342_10001995
628 Ga0265342_10053347
629 Ga0307406_10036722
630 Ga0307412_10086418
631 Ga0307409_100538637
632 Ga0307409_100566675
633 Ga0307416_100002471
634 Ga0307416_100013175
635 Ga0307416_100052991
636 Ga0307411_10031929
637 Ga0307415_100008341
638 Ga0373926_0026846
639 Ga0373932_0025904
640 Ga0373941_0105521
641 Ga0373945_0133631
642 Ga0373943_0022050
643 Ga0373946_0116125
644 Ga0373961_0115941
645 Ga0373962_0124955
646 Ga0373931_0000963
647 Ga0373935_0056849
648 Ga0373947_0310266
649 Ga0373937_0621795
650 Ga0373925_0244632
651 Ga0373925_0793130
652 Ga0436360_1019914
653 Ga0439435_0004704
654 Ga0439460_0002022
655 Ga0466963_0031405
656 Ga0453684_0265249
657 Ga0466957_0004783
658 Ga0466959_0114739
659 Ga0451576_0028167
660 Ga0451576_0033234
661 Ga0451576_0200296
662 Ga0466958_0015412
663 Ga0466967_0109458
664 Ga0495603_0017974
665 Ga0495629_0138665
666 Ga0495651_0287221
667 Ga0495580_0029123
668 Ga0495580_0117504
669 Ga0495580_0165669
670 Ga0495662_0137962
671 Ga0495586_0014647
672 Ga0495598_0064456
673 Ga0496100_0098378
674 Ga0496100_0446688
675 Ga0496103_0041887
676 Ga0496104_0009162
677 Ga0496105_0008017
678 Ga0496106_0060980
679 Ga0496108_0000373
680 Ga0496109_0001363
681 Ga0496109_0264634
682 Ga0496109_0609246
683 Ga0496109_0656737
684 Ga0496110_0003079
685 Ga0496110_0109335
686 Ga0496111_0453843
687 Ga0496112_0005799
688 Ga0496112_0011923
689 Ga0496112_0012092
690 Ga0496113_0000161
691 Ga0496115_0207325
692 Ga0501031_0004522
693 Ga0501032_0002333
694 Ga0501033_0004749
695 Ga0501033_0010851
696 Ga0501034_0210984
697 Ga0501036_0028550
698 Ga0501036_0085664
699 Ga0501037_0002744
700 Ga0501037_0056249
701 Ga0501038_0002267
702 Ga0501038_0084166
703 Ga0501039_0006496
704 Ga0501039_0064746
705 Ga0501039_0206129
706 Ga0501039_0428961
707 Ga0501040_0000090
708 Ga0501040_0034587
709 Ga0501040_0388176
710 Ga0501041_0000859
711 Ga0501041_0021082
712 Ga0501041_0195217
713 Ga0501042_0001763
714 Ga0501043_0010919
715 Ga0501046_0000691
716 Ga0501046_0015779
717 Ga0501046_0550964
718 Ga0501047_0391155
719 Ga0501048_0006177
720 Ga0501048_0018798
721 Ga0501048_0141201
722 Ga0501068_0003095
723 Ga0501068_0006080
724 Ga0501068_0087375
725 Ga0501069_0004609
726 Ga0501070_0005557
727 Ga0501070_0083638
728 Ga0501071_0000618
729 Ga0501071_0004834
730 Ga0501071_0161259
731 Ga0501072_0000127
732 Ga0501072_0007882
733 Ga0501073_0007327
734 Ga0501073_0076007
735 Ga0501074_0004776
736 Ga0501074_0101787
737 Ga0501075_0000244
738 Ga0501075_0002155
739 Ga0501075_0019247
740 Ga0501075_0056211
741 Ga0501076_0000113
742 Ga0501076_0019021
743 Ga0501076_0103504
744 Ga0501076_0189028
745 Ga0501077_0000098
746 Ga0501077_0005544
747 Ga0501077_0010481
748 Ga0501077_0167612
749 Ga0501079_0000236
750 Ga0501079_0048026
751 Ga0501080_0000188
752 Ga0501080_0019222
753 Ga0501081_0000817
754 Ga0501081_0001979
755 Ga0501081_0005189
756 Ga0501081_0151144
757 Ga0501083_0001925
758 Ga0501083_0008131
759 Ga0501035_0016570
760 Ga0501044_0013454
761 Ga0501044_0332014
762 Ga0501045_0001007
763 Ga0501045_0002572
764 Ga0501045_0104252
765 Ga0501045_0488744
766 nmdc:mga06z11_194914_c1
767 nmdc:mga05p37_53002_c1
768 nmdc:mga09592_158528_c1
769 nmdc:mga09592_575539_c1
770 nmdc:mga09592_78888_c1
771 nmdc:mga0qj67_2592_c1
772 nmdc:mga0qj67_434261_c1
773 nmdc:mga0qj67_56048_c1
774 nmdc:mga06r32_260633_c1
775 nmdc:mga06r32_261906_c1
776 nmdc:mga06r32_45805_c1
777 nmdc:mga06r32_62650_c1
778 nmdc:mga06r32_90640_c1
779 nmdc:mga08y16_128476_c1
780 nmdc:mga08y16_39270_c1
781 nmdc:mga0n895_115347_c1
782 nmdc:mga0n895_1589_c1
783 nmdc:mga0n895_554707_c1
784 nmdc:mga0rr50_109661_c1
785 nmdc:mga0rr50_20759_c1
786 nmdc:mga0rr50_213987_c1
787 nmdc:mga0rr50_98078_c1
788 nmdc:mga08x19_108644_c1
789 nmdc:mga08x19_64907_c1
790 nmdc:mga0a205_10066_c1
791 nmdc:mga0a205_118910_c1
792 nmdc:mga0a205_131030_c1
793 nmdc:mga0a205_54558_c2
794 nmdc:mga0a205_61572_c1
795 nmdc:mga0a205_62567_c1
796 nmdc:mga0sz30_33434_c1
797 Ga0495619_0174432
798 Ga0501084_0002315
799 Ga0501084_0005989
800 Ga0501084_0070852
801 Ga0501084_0328488
802 Ga0501084_0437211
803 Ga0501084_0471016
804 Ga0590071_021589
805 Ga0501082_0000425
806 Ga0501082_0011730
807 Ga0501082_0167537
808 Ga0530510_0000379
809 Ga0530510_0035930
810 Ga0530510_0045468
811 Ga0530510_0079409
812 2644048783
813 2644481584
814 2842334453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

41

186

0.89

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

116

213

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9556 5 235
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.948 4 224
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.941 5 224
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9386 4 234
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.9356 4 224
ID Description Score Start End Superfamily
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9708 5 235 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9667 1 236 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9627 1 236 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9506 5 235 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.946 4 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N9MLZ7-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2, HAAT family 0.982 5 235 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A536ECH0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9781 5 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A381SD12-F1-model_v4 ABC transporter domain-containing protein 0.9742 27 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A2E7F6C8-F1-model_v4 ABC transporter ATP-binding protein 0.9706 1 235 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1A9BXE0-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2, HAAT family 0.969 5 235 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map