F436490

General Info

Members Datasets Scaffolds Average Seq Length
407 213 814 300

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100150474|Ga0307409_1001504742
Length 329
Sequence VTVPASQSAPVPVMAGQTPKSGNALARIWKTRELSTLLLLVLEVLFFAWYLWPDGDRRHPFLNGENALLILKYSSIYGIAAIGAAIVIISGGVDLAPGAIIALAGVAMGYCYVDAHLPSGLVSALLVVTVGLPPFIATLGIMGITRGLAFIVTEGRYIDVSQQLPPGWAPLGVPIDWIAPGMMLVLALVFQLIMRDFQWGRAVFAIGGNEIAARYSGIRVGRAKVHIYLLSGVLAAVSGVILTLSQGQAKADLATGYELDIIASAVVGGASLAGGRGSVAGAVLGTLIFGVLRNALPQIPGATFYDRLIVGLVVVSIVVMDQILVRKRA

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.91
Nodule 0
Rhizoplane 1.72
Rhizosphere 93.12
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100150474 3300031995 Bacteria 2020
2 Ga0065715_10027604 3300005293 Bacteria 1830
3 Ga0065715_10138915 3300005293 Bacteria 1884
4 Ga0065707_10007099 3300005295 Bacteria 3866
5 Ga0070676_10056280 3300005328 Bacteria 2323
6 Ga0070683_100085393 3300005329 Bacteria 2958
7 Ga0070690_100050896 3300005330 Bacteria 2643
8 Ga0070690_100131501 3300005330 Bacteria 1690
9 Ga0070670_100007123 3300005331 Bacteria 9469
10 Ga0070670_100216130 3300005331 Bacteria 1667
11 Ga0068869_100020901 3300005334 Bacteria 4497
12 Ga0068869_100069900 3300005334 Bacteria 2597
13 Ga0068869_100146237 3300005334 Bacteria 1829
14 Ga0068868_100058378 3300005338 Bacteria 3050
15 Ga0070689_100011957 3300005340 Bacteria 6235
16 Ga0070689_100025911 3300005340 Bacteria 4409
17 Ga0070689_100098989 3300005340 Bacteria 2307
18 Ga0070687_100136217 3300005343 Bacteria 1424
19 Ga0070692_10039923 3300005345 Bacteria 2398
20 Ga0070669_100012979 3300005353 Bacteria 5917
21 Ga0070669_100216275 3300005353 Bacteria 1514
22 Ga0070671_100032107 3300005355 Bacteria 4342
23 Ga0070674_100077223 3300005356 Bacteria 2370
24 Ga0070674_100082183 3300005356 Bacteria 2304
25 Ga0070673_100195936 3300005364 Bacteria 1738
26 Ga0070688_100081864 3300005365 Bacteria 2091
27 Ga0070688_100378252 3300005365 Bacteria 1043
28 Ga0070659_100129955 3300005366 Bacteria 2045
29 Ga0070659_100182432 3300005366 Bacteria 1723
30 Ga0070667_100111014 3300005367 Bacteria 2378
31 Ga0070714_100019241 3300005435 Bacteria 5557
32 Ga0070701_10004943 3300005438 Bacteria 5460
33 Ga0070701_10090600 3300005438 Bacteria 1675
34 Ga0070705_100043092 3300005440 Bacteria 2584
35 Ga0070700_100040270 3300005441 Bacteria 2859
36 Ga0070700_100177709 3300005441 Bacteria 1479
37 Ga0070700_100217711 3300005441 Bacteria 1351
38 Ga0070694_100005060 3300005444 Bacteria 7949
39 Ga0070663_100432112 3300005455 Bacteria 1082
40 Ga0070678_100100258 3300005456 Bacteria 2243
41 Ga0070662_100306017 3300005457 Bacteria 1292
42 Ga0070681_10054428 3300005458 Bacteria 3987
43 Ga0070681_10062730 3300005458 Bacteria 3690
44 Ga0068867_100006053 3300005459 Bacteria 8574
45 Ga0068867_100006578 3300005459 Bacteria 8212
46 Ga0070685_10104457 3300005466 Bacteria 1735
47 Ga0070706_100019103 3300005467 Bacteria 6323
48 Ga0070706_100025431 3300005467 Bacteria 5449
49 Ga0070707_100007545 3300005468 Bacteria 10106
50 Ga0070707_100011108 3300005468 Bacteria 8388
51 Ga0070698_100001671 3300005471 Bacteria 24770
52 Ga0070698_100146677 3300005471 Bacteria 2308
53 Ga0070699_100004113 3300005518 Bacteria 12862
54 Ga0070679_100053625 3300005530 Bacteria 4014
55 Ga0070684_100017391 3300005535 Bacteria 5901
56 Ga0070697_100004003 3300005536 Bacteria 11299
57 Ga0070697_100086631 3300005536 Bacteria 2585
58 Ga0070697_100178442 3300005536 Bacteria 1800
59 Ga0070672_100062685 3300005543 Bacteria 2935
60 Ga0070672_100081713 3300005543 Bacteria 2591
61 Ga0070686_100040372 3300005544 Bacteria 2911
62 Ga0070695_100035388 3300005545 Bacteria 3137
63 Ga0070696_100123052 3300005546 Bacteria 1879
64 Ga0070665_100003353 3300005548 Bacteria 17136
65 Ga0070704_100011556 3300005549 Bacteria 5417
66 Ga0070704_100423315 3300005549 Bacteria 1141
67 Ga0068855_100232586 3300005563 Bacteria 2063
68 Ga0068855_100307049 3300005563 Bacteria 1756
69 Ga0068855_100579716 3300005563 Bacteria 1212
70 Ga0070664_100329598 3300005564 Bacteria 1385
71 Ga0070664_100344595 3300005564 Bacteria 1354
72 Ga0068857_100454587 3300005577 Bacteria 1198
73 Ga0070702_100071286 3300005615 Bacteria 2053
74 Ga0068852_100145532 3300005616 Bacteria 2198
75 Ga0068859_100135164 3300005617 Bacteria 2538
76 Ga0068864_100055808 3300005618 Bacteria 3412
77 Ga0068864_100320721 3300005618 Bacteria 1455
78 Ga0068861_100096452 3300005719 Bacteria 2343
79 Ga0068861_100138930 3300005719 Bacteria 1981
80 Ga0068870_10047402 3300005840 Bacteria 2259
81 Ga0068870_10112299 3300005840 Bacteria 1558
82 Ga0068858_100016893 3300005842 Bacteria 6852
83 Ga0068858_100038205 3300005842 Bacteria 4452
84 Ga0068858_100204171 3300005842 Bacteria 1869
85 Ga0068860_100205987 3300005843 Bacteria 1907
86 Ga0068862_100054861 3300005844 Bacteria 3412
87 Ga0081539_10012661 3300005985 Bacteria 6466
88 Ga0075368_10012354 3300006042 Bacteria 3120
89 Ga0075368_10027500 3300006042 Bacteria 2195
90 Ga0075364_10003529 3300006051 Bacteria 8899
91 Ga0075364_10021332 3300006051 Bacteria 4081
92 Ga0075362_10002998 3300006177 Bacteria 5813
93 Ga0075367_10003167 3300006178 Bacteria 7756
94 Ga0075367_10175324 3300006178 Bacteria 1336
95 Ga0075366_10007610 3300006195 Bacteria 5993
96 Ga0075370_10011415 3300006353 Bacteria 4667
97 Ga0068871_100044604 3300006358 Bacteria 3567
98 Ga0068871_100550575 3300006358 Unclassified 1045
99 Ga0075428_100001625 3300006844 Bacteria 24011
100 Ga0075428_100008285 3300006844 Bacteria 11524
101 Ga0075428_100063986 3300006844 Bacteria 4028
102 Ga0075428_100074460 3300006844 Bacteria 3709
103 Ga0075428_100365392 3300006844 Bacteria 1548
104 Ga0075428_100501255 3300006844 Bacteria 1299
105 Ga0075430_100005503 3300006846 Bacteria 10698
106 Ga0075430_100032117 3300006846 Bacteria 4456
107 Ga0075430_100356327 3300006846 Bacteria 1208
108 Ga0075431_100043007 3300006847 Bacteria 4661
109 Ga0075431_100057974 3300006847 Bacteria 3994
110 Ga0075431_100199459 3300006847 Bacteria 2048
111 Ga0075431_100242512 3300006847 Bacteria 1833
112 Ga0075433_10012659 3300006852 Bacteria 6824
113 Ga0075433_10018161 3300006852 Bacteria 5841
114 Ga0075433_10204981 3300006852 Bacteria 1753
115 Ga0075434_100062817 3300006871 Bacteria 3697
116 Ga0075434_100088112 3300006871 Bacteria 3105
117 Ga0075429_100221908 3300006880 Bacteria 1655
118 Ga0068865_100008132 3300006881 Bacteria 6472
119 Ga0068865_100184078 3300006881 Bacteria 1610
120 Ga0075436_100041388 3300006914 Bacteria 3179
121 Ga0075436_100072609 3300006914 Bacteria 2381
122 Ga0097620_100135187 3300006931 Bacteria 2538
123 Ga0075435_100005956 3300007076 Bacteria 8577
124 Ga0075435_100019565 3300007076 Bacteria 5175
125 Ga0075435_100161682 3300007076 Bacteria 1886
126 Ga0105240_10083074 3300009093 Bacteria 3932
127 Ga0111539_10000215 3300009094 Bacteria 69057
128 Ga0111539_10058507 3300009094 Bacteria 4572
129 Ga0111539_10114354 3300009094 Bacteria 3165
130 Ga0111539_10116756 3300009094 Bacteria 3129
131 Ga0111539_10197930 3300009094 Bacteria 2344
132 Ga0105245_10010557 3300009098 Bacteria 8036
133 Ga0105245_10021741 3300009098 Bacteria 5632
134 Ga0105245_10122406 3300009098 Bacteria 2431
135 Ga0105245_10469261 3300009098 Bacteria 1270
136 Ga0105247_10053671 3300009101 Bacteria 2487
137 Ga0114129_10002597 3300009147 Bacteria 25105
138 Ga0114129_10011539 3300009147 Bacteria 12581
139 Ga0114129_10026816 3300009147 Bacteria 8158
140 Ga0114129_10026932 3300009147 Bacteria 8137
141 Ga0114129_10027467 3300009147 Bacteria 8057
142 Ga0114129_10031289 3300009147 Bacteria 7525
143 Ga0114129_10034985 3300009147 Bacteria 7096
144 Ga0114129_10048977 3300009147 Bacteria 5939
145 Ga0114129_10060412 3300009147 Bacteria 5300
146 Ga0114129_10079493 3300009147 Bacteria 4560
147 Ga0114129_10089000 3300009147 Bacteria 4280
148 Ga0114129_10090955 3300009147 Bacteria 4229
149 Ga0114129_10098887 3300009147 Bacteria 4039
150 Ga0114129_10123479 3300009147 Bacteria 3561
151 Ga0114129_10163661 3300009147 Bacteria 3037
152 Ga0114129_10165096 3300009147 Bacteria 3022
153 Ga0114129_10254715 3300009147 Bacteria 2355
154 Ga0114129_10256817 3300009147 Bacteria 2344
155 Ga0114129_10369054 3300009147 Bacteria 1897
156 Ga0114129_10715559 3300009147 Bacteria 1285
157 Ga0105242_10001591 3300009176 Bacteria 17854
158 Ga0105242_10108108 3300009176 Bacteria 2366
159 Ga0105242_10158695 3300009176 Bacteria 1978
160 Ga0105248_10010905 3300009177 Bacteria 10027
161 Ga0105248_10016113 3300009177 Bacteria 8225
162 Ga0105248_10058059 3300009177 Bacteria 4345
163 Ga0105248_10079568 3300009177 Bacteria 3684
164 Ga0105248_10125803 3300009177 Bacteria 2892
165 Ga0105237_10225183 3300009545 Unclassified 1876
166 Ga0105238_10107445 3300009551 Bacteria 2771
167 Ga0105249_10057624 3300009553 Bacteria 3559
168 Ga0105249_10167009 3300009553 Bacteria 2131
169 Ga0105249_10172765 3300009553 Bacteria 2097
170 Ga0157374_10070115 3300013296 Bacteria 3302
171 Ga0157378_10274823 3300013297 Bacteria 1622
172 Ga0157375_10054095 3300013308 Bacteria 3952
173 Ga0157375_10508047 3300013308 Bacteria 1369
174 Ga0163163_10000034 3300014325 Bacteria 161820
175 Ga0163163_10076536 3300014325 Bacteria 3341
176 Ga0163163_10164929 3300014325 Bacteria 2261
177 Ga0157380_10021601 3300014326 Bacteria 4830
178 Ga0157380_10023435 3300014326 Bacteria 4656
179 Ga0157380_10039943 3300014326 Bacteria 3652
180 Ga0157380_10090840 3300014326 Bacteria 2520
181 Ga0157380_10091595 3300014326 Bacteria 2510
182 Ga0157380_10216877 3300014326 Unclassified 1709
183 Ga0157380_10387732 3300014326 Bacteria 1321
184 Ga0157377_10165032 3300014745 Bacteria 1380
185 Ga0157379_10010713 3300014968 Bacteria 7988
186 Ga0206356_10744225 3300020070 Bacteria 1200
187 Ga0207682_10044477 3300025893 Bacteria 1820
188 Ga0207710_10012668 3300025900 Bacteria 3548
189 Ga0207645_10021564 3300025907 Bacteria 4199
190 Ga0207645_10100483 3300025907 Bacteria 1866
191 Ga0207643_10065642 3300025908 Bacteria 2079
192 Ga0207684_10006649 3300025910 Bacteria 10509
193 Ga0207684_10030067 3300025910 Bacteria 4624
194 Ga0207707_10082926 3300025912 Bacteria 2799
195 Ga0207695_10250937 3300025913 Bacteria 1669
196 Ga0207693_10221898 3300025915 Bacteria 1485
197 Ga0207660_10051485 3300025917 Bacteria 2927
198 Ga0207662_10013233 3300025918 Bacteria 4612
199 Ga0207662_10052540 3300025918 Bacteria 2425
200 Ga0207652_10216166 3300025921 Bacteria 1727
201 Ga0207646_10006182 3300025922 Bacteria 12450
202 Ga0207646_10145654 3300025922 Bacteria 2134
203 Ga0207681_10076182 3300025923 Bacteria 2355
204 Ga0207681_10096798 3300025923 Bacteria 2120
205 Ga0207650_10021304 3300025925 Bacteria 4580
206 Ga0207650_10133474 3300025925 Bacteria 1945
207 Ga0207687_10006546 3300025927 Bacteria 7691
208 Ga0207687_10214624 3300025927 Bacteria 1511
209 Ga0207664_10030122 3300025929 Bacteria 4142
210 Ga0207644_10063705 3300025931 Bacteria 2677
211 Ga0207690_10088002 3300025932 Bacteria 2187
212 Ga0207706_10080089 3300025933 Bacteria 2872
213 Ga0207686_10067133 3300025934 Bacteria 2293
214 Ga0207686_10183542 3300025934 Bacteria 1485
215 Ga0207670_10146566 3300025936 Bacteria 1746
216 Ga0207669_10059318 3300025937 Bacteria 2340
217 Ga0207691_10005809 3300025940 Bacteria 11938
218 Ga0207691_10024040 3300025940 Bacteria 5732
219 Ga0207711_10013045 3300025941 Bacteria 6902
220 Ga0207711_10050157 3300025941 Bacteria 3573
221 Ga0207711_10150825 3300025941 Bacteria 2097
222 Ga0207689_10008760 3300025942 Bacteria 8796
223 Ga0207689_10088320 3300025942 Bacteria 2547
224 Ga0207689_10147213 3300025942 Bacteria 1940
225 Ga0207689_10194885 3300025942 Bacteria 1672
226 Ga0207661_10064657 3300025944 Bacteria 2966
227 Ga0207679_10092941 3300025945 Bacteria 2338
228 Ga0207651_10008146 3300025960 Bacteria 5639
229 Ga0207712_10118489 3300025961 Bacteria 1999
230 Ga0207668_10266431 3300025972 Bacteria 1399
231 Ga0207668_10387458 3300025972 Bacteria 1178
232 Ga0207640_10090012 3300025981 Bacteria 2122
233 Ga0207658_10161349 3300025986 Bacteria 1838
234 Ga0207678_10108394 3300026067 Bacteria 2369
235 Ga0207678_10380723 3300026067 Bacteria 1220
236 Ga0207708_10002023 3300026075 Bacteria 14946
237 Ga0207708_10004732 3300026075 Bacteria 10016
238 Ga0207708_10007858 3300026075 Bacteria 7901
239 Ga0207708_10091439 3300026075 Bacteria 2347
240 Ga0207708_10137159 3300026075 Bacteria 1917
241 Ga0207708_10164408 3300026075 Bacteria 1754
242 Ga0207708_10210065 3300026075 Bacteria 1556
243 Ga0207641_10191881 3300026088 Bacteria 1878
244 Ga0207648_10008403 3300026089 Bacteria 9999
245 Ga0207648_10008453 3300026089 Bacteria 9967
246 Ga0207676_10009590 3300026095 Bacteria 6892
247 Ga0207676_10161775 3300026095 Bacteria 1940
248 Ga0207675_100038904 3300026118 Bacteria 4438
249 Ga0207675_100051102 3300026118 Bacteria 3857
250 Ga0207698_10132413 3300026142 Bacteria 2133
251 Ga0207698_10219247 3300026142 Bacteria 1718
252 Ga0207428_10000128 3300027907 Bacteria 104604
253 Ga0207428_10000335 3300027907 Bacteria 61204
254 Ga0207428_10030292 3300027907 Bacteria 4474
255 Ga0207428_10040565 3300027907 Bacteria 3775
256 Ga0268266_10035790 3300028379 Bacteria 4222
257 Ga0268265_10125089 3300028380 Bacteria 2126
258 Ga0268264_10133620 3300028381 Bacteria 2203
259 Ga0268264_10141617 3300028381 Bacteria 2145
260 Ga0307513_10245235 3300031456 Bacteria 1593
261 Ga0307408_100037712 3300031548 Bacteria 3405
262 Ga0307408_100101968 3300031548 Bacteria 2188
263 Ga0307408_100247976 3300031548 Bacteria 1467
264 Ga0307405_10428741 3300031731 Bacteria 1043
265 Ga0307413_10407006 3300031824 Bacteria 1068
266 Ga0307407_10047853 3300031903 Bacteria 2430
267 Ga0307407_10084345 3300031903 Bacteria 1930
268 Ga0307412_10086683 3300031911 Bacteria 2180
269 Ga0307412_10227869 3300031911 Bacteria 1433
270 Ga0307409_100132424 3300031995 Bacteria 2133
271 Ga0307416_100020390 3300032002 Bacteria 4729
272 Ga0307416_100058093 3300032002 Bacteria 3134
273 Ga0307416_100551600 3300032002 Bacteria 1226
274 Ga0307411_10301965 3300032005 Bacteria 1284
275 Ga0307415_100009475 3300032126 Bacteria 5463
276 Ga0373934_0001917 3300035086 Bacteria 7633
277 Ga0373955_0002846 3300035172 Bacteria 7593
278 Ga0373933_0057465 3300035724 Bacteria 2338
279 Ga0373937_0000485 3300036401 Bacteria 36350
280 Ga0373937_0002908 3300036401 Bacteria 14312
281 Ga0373937_0228044 3300036401 Bacteria 1754
282 Ga0373925_0001917 3300037068 Bacteria 17225
283 Ga0450923_003697 3300042125 Bacteria 2339
284 Ga0439435_0000636 3300042436 Bacteria 5751
285 Ga0439435_0007470 3300042436 Bacteria 2502
286 Ga0439435_0019497 3300042436 Bacteria 1739
287 Ga0451576_0007396 3300045051 Bacteria 13141
288 Ga0451576_0204678 3300045051 Bacteria 2061
289 Ga0451576_0403294 3300045051 Bacteria 1434
290 Ga0466967_0079148 3300045976 Bacteria 2963
291 Ga0495653_0012241 3300046463 Bacteria 6999
292 Ga0495628_0077693 3300046516 Bacteria 2582
293 Ga0495645_0189887 3300046543 Bacteria 1401
294 Ga0495623_0127256 3300046679 Bacteria 1529
295 Ga0495613_0169351 3300046689 Bacteria 1551
296 Ga0495672_0005309 3300047320 Bacteria 10254
297 Ga0495672_0049126 3300047320 Bacteria 2498
298 Ga0495684_0181484 3300047471 Bacteria 1560
299 Ga0496102_0215288 3300048905 Bacteria 1811
300 Ga0496104_0171876 3300048907 Bacteria 2078
301 Ga0496104_0281051 3300048907 Bacteria 1578
302 Ga0496106_0138086 3300048909 Bacteria 1916
303 Ga0496108_0056219 3300048911 Bacteria 3305
304 Ga0496113_0046644 3300048916 Bacteria 3217
305 Ga0496114_0017874 3300048917 Bacteria 5732
306 Ga0501036_0075258 3300049572 Bacteria 2856
307 Ga0501036_0108038 3300049572 Bacteria 2352
308 Ga0501036_0359191 3300049572 Bacteria 1216
309 Ga0501038_0115168 3300049574 Bacteria 2223
310 Ga0501039_0018673 3300049575 Bacteria 5324
311 Ga0501039_0219159 3300049575 Bacteria 1496
312 Ga0501040_0210308 3300049576 Bacteria 1383
313 Ga0501041_0140505 3300049577 Bacteria 1506
314 Ga0501042_0106512 3300049578 Bacteria 2018
315 Ga0501042_0270543 3300049578 Bacteria 1227
316 Ga0501043_0184272 3300049579 Bacteria 1626
317 Ga0501048_0046124 3300049582 Bacteria 3112
318 Ga0501048_0053896 3300049582 Bacteria 2858
319 Ga0501048_0183774 3300049582 Bacteria 1482
320 Ga0501068_0228678 3300049584 Bacteria 1183
321 Ga0501069_0256183 3300049585 Bacteria 1021
322 Ga0501071_0013404 3300049587 Bacteria 5585
323 Ga0501071_0106791 3300049587 Unclassified 2067
324 Ga0501072_0072710 3300049588 Bacteria 2718
325 Ga0501072_0085919 3300049588 Bacteria 2496
326 Ga0501072_0087052 3300049588 Bacteria 2479
327 Ga0501072_0219489 3300049588 Bacteria 1515
328 Ga0501072_0393495 3300049588 Bacteria 1099
329 Ga0501073_0011681 3300049589 Bacteria 6414
330 Ga0501073_0039861 3300049589 Bacteria 3327
331 Ga0501074_0033947 3300049590 Bacteria 3699
332 Ga0501075_0026330 3300049591 Bacteria 4281
333 Ga0501075_0030671 3300049591 Bacteria 3984
334 Ga0501075_0030847 3300049591 Bacteria 3974
335 Ga0501076_0070117 3300049592 Bacteria 2802
336 Ga0501076_0183081 3300049592 Bacteria 1708
337 Ga0501076_0278175 3300049592 Bacteria 1371
338 Ga0501076_0319993 3300049592 Bacteria 1272
339 Ga0501077_0023495 3300049593 Bacteria 3910
340 Ga0501079_0050982 3300049741 Bacteria 3194
341 Ga0501079_0095906 3300049741 Bacteria 2299
342 Ga0501080_0188313 3300049742 Bacteria 1897
343 Ga0501080_0420439 3300049742 Bacteria 1201
344 Ga0501081_0088942 3300049743 Bacteria 2170
345 Ga0501035_0457567 3300049822 Bacteria 1055
346 Ga0501045_0017435 3300049824 Bacteria 5098
347 nmdc:mga0yw44_74531_c1 3300050492 Bacteria 2114
348 nmdc:mga0k408_14486_c1 3300050493 Bacteria 4346
349 nmdc:mga0k408_444_c1 3300050493 Bacteria 22630
350 nmdc:mga06z11_10186_c1 3300050494 Bacteria 3993
351 nmdc:mga06z11_237752_c1 3300050494 Bacteria 1069
352 nmdc:mga07m45_40606_c1 3300050496 Bacteria 1848
353 nmdc:mga05p37_124675_c1 3300050507 Bacteria 3163
354 nmdc:mga05p37_205120_c1 3300050507 Bacteria 2385
355 nmdc:mga05p37_26100_c1 3300050507 Bacteria 7104
356 nmdc:mga05p37_27662_c1 3300050507 Bacteria 6907
357 nmdc:mga05p37_318590_c1 3300050507 Bacteria 1841
358 nmdc:mga05p37_338146_c1 3300050507 Bacteria 1776
359 nmdc:mga05p37_34686_c1 3300050507 Bacteria 6181
360 nmdc:mga05p37_39_c1 3300050507 Bacteria 108676
361 nmdc:mga05p37_442850_c1 3300050507 Bacteria 1506
362 nmdc:mga05p37_620506_c1 3300050507 Bacteria 1217
363 nmdc:mga05p37_93644_c1 3300050507 Bacteria 3702
364 nmdc:mga09592_378927_c1 3300050508 Bacteria 1223
365 nmdc:mga09592_46950_c2 3300050508 Bacteria 2152
366 nmdc:mga0qj67_31088_c1 3300050509 Bacteria 4158
367 nmdc:mga0qj67_55310_c1 3300050509 Bacteria 3144
368 nmdc:mga06r32_230000_c1 3300050510 Bacteria 1842
369 nmdc:mga06r32_24542_c1 3300050510 Bacteria 5599
370 nmdc:mga06r32_325073_c1 3300050510 Unclassified 1523
371 nmdc:mga06r32_43569_c1 3300050510 Bacteria 4270
372 nmdc:mga06r32_464729_c1 3300050510 Unclassified 1244
373 nmdc:mga06r32_97921_c1 3300050510 Bacteria 2875
374 nmdc:mga08y16_10579_c1 3300050511 Bacteria 9681
375 nmdc:mga08y16_159964_c1 3300050511 Bacteria 2340
376 nmdc:mga08y16_18306_c1 3300050511 Bacteria 7381
377 nmdc:mga08y16_195681_c1 3300050511 Unclassified 2096
378 nmdc:mga08y16_587455_c1 3300050511 Bacteria 1124
379 nmdc:mga0n895_412530_c1 3300050512 Bacteria 1365
380 nmdc:mga0n895_418223_c1 3300050512 Bacteria 1355
381 nmdc:mga0n895_52053_c1 3300050512 Bacteria 4018
382 nmdc:mga0n895_600225_c1 3300050512 Bacteria 1103
383 nmdc:mga0rr50_51077_c1 3300050513 Bacteria 3067
384 nmdc:mga0rr50_6312_c1 3300050513 Bacteria 7201
385 nmdc:mga08x19_127010_c1 3300050514 Bacteria 1713
386 nmdc:mga08x19_28990_c1 3300050514 Bacteria 3471
387 nmdc:mga0a205_120619_c1 3300050515 Bacteria 2521
388 nmdc:mga0a205_156640_c1 3300050515 Bacteria 2176
389 nmdc:mga0a205_322815_c1 3300050515 Bacteria 1415
390 nmdc:mga0a205_68579_c1 3300050515 Bacteria 3425
391 Ga0495619_0048622 3300053085 Bacteria 2795
392 Ga0495619_0110175 3300053085 Bacteria 1881
393 Ga0500641_0001064 3300053096 Bacteria 9780
394 Ga0500555_000049 3300053103 Bacteria 61213
395 Ga0500568_0002037 3300053139 Bacteria 12293
396 Ga0500616_0000100 3300053153 Bacteria 173477
397 Ga0500645_000146 3300053730 Bacteria 55117
398 Ga0501084_0086391 3300054114 Bacteria 2634
399 Ga0501084_0097176 3300054114 Bacteria 2473
400 Ga0590071_000642 3300059421 Bacteria 9937
401 Ga0590074_000538 3300059423 Bacteria 5688
402 Ga0590075_008262 3300059424 Bacteria 2485
403 Ga0590077_003534 3300059426 Bacteria 3236
404 Ga0501082_0107818 3300060353 Bacteria 2410
405 Ga0501082_0117788 3300060353 Bacteria 2301
406 Ga0501082_0172113 3300060353 Bacteria 1883
407 Ga0530510_0209341 3300061734 Bacteria 1449
408 Ga0307409_100150474
409 Ga0065715_10027604
410 Ga0065715_10138915
411 Ga0065707_10007099
412 Ga0070676_10056280
413 Ga0070683_100085393
414 Ga0070690_100050896
415 Ga0070690_100131501
416 Ga0070670_100007123
417 Ga0070670_100216130
418 Ga0068869_100020901
419 Ga0068869_100069900
420 Ga0068869_100146237
421 Ga0068868_100058378
422 Ga0070689_100011957
423 Ga0070689_100025911
424 Ga0070689_100098989
425 Ga0070687_100136217
426 Ga0070692_10039923
427 Ga0070669_100012979
428 Ga0070669_100216275
429 Ga0070671_100032107
430 Ga0070674_100077223
431 Ga0070674_100082183
432 Ga0070673_100195936
433 Ga0070688_100081864
434 Ga0070688_100378252
435 Ga0070659_100129955
436 Ga0070659_100182432
437 Ga0070667_100111014
438 Ga0070714_100019241
439 Ga0070701_10004943
440 Ga0070701_10090600
441 Ga0070705_100043092
442 Ga0070700_100040270
443 Ga0070700_100177709
444 Ga0070700_100217711
445 Ga0070694_100005060
446 Ga0070663_100432112
447 Ga0070678_100100258
448 Ga0070662_100306017
449 Ga0070681_10054428
450 Ga0070681_10062730
451 Ga0068867_100006053
452 Ga0068867_100006578
453 Ga0070685_10104457
454 Ga0070706_100019103
455 Ga0070706_100025431
456 Ga0070707_100007545
457 Ga0070707_100011108
458 Ga0070698_100001671
459 Ga0070698_100146677
460 Ga0070699_100004113
461 Ga0070679_100053625
462 Ga0070684_100017391
463 Ga0070697_100004003
464 Ga0070697_100086631
465 Ga0070697_100178442
466 Ga0070672_100062685
467 Ga0070672_100081713
468 Ga0070686_100040372
469 Ga0070695_100035388
470 Ga0070696_100123052
471 Ga0070665_100003353
472 Ga0070704_100011556
473 Ga0070704_100423315
474 Ga0068855_100232586
475 Ga0068855_100307049
476 Ga0068855_100579716
477 Ga0070664_100329598
478 Ga0070664_100344595
479 Ga0068857_100454587
480 Ga0070702_100071286
481 Ga0068852_100145532
482 Ga0068859_100135164
483 Ga0068864_100055808
484 Ga0068864_100320721
485 Ga0068861_100096452
486 Ga0068861_100138930
487 Ga0068870_10047402
488 Ga0068870_10112299
489 Ga0068858_100016893
490 Ga0068858_100038205
491 Ga0068858_100204171
492 Ga0068860_100205987
493 Ga0068862_100054861
494 Ga0081539_10012661
495 Ga0075368_10012354
496 Ga0075368_10027500
497 Ga0075364_10003529
498 Ga0075364_10021332
499 Ga0075362_10002998
500 Ga0075367_10003167
501 Ga0075367_10175324
502 Ga0075366_10007610
503 Ga0075370_10011415
504 Ga0068871_100044604
505 Ga0068871_100550575
506 Ga0075428_100001625
507 Ga0075428_100008285
508 Ga0075428_100063986
509 Ga0075428_100074460
510 Ga0075428_100365392
511 Ga0075428_100501255
512 Ga0075430_100005503
513 Ga0075430_100032117
514 Ga0075430_100356327
515 Ga0075431_100043007
516 Ga0075431_100057974
517 Ga0075431_100199459
518 Ga0075431_100242512
519 Ga0075433_10012659
520 Ga0075433_10018161
521 Ga0075433_10204981
522 Ga0075434_100062817
523 Ga0075434_100088112
524 Ga0075429_100221908
525 Ga0068865_100008132
526 Ga0068865_100184078
527 Ga0075436_100041388
528 Ga0075436_100072609
529 Ga0097620_100135187
530 Ga0075435_100005956
531 Ga0075435_100019565
532 Ga0075435_100161682
533 Ga0105240_10083074
534 Ga0111539_10000215
535 Ga0111539_10058507
536 Ga0111539_10114354
537 Ga0111539_10116756
538 Ga0111539_10197930
539 Ga0105245_10010557
540 Ga0105245_10021741
541 Ga0105245_10122406
542 Ga0105245_10469261
543 Ga0105247_10053671
544 Ga0114129_10002597
545 Ga0114129_10011539
546 Ga0114129_10026816
547 Ga0114129_10026932
548 Ga0114129_10027467
549 Ga0114129_10031289
550 Ga0114129_10034985
551 Ga0114129_10048977
552 Ga0114129_10060412
553 Ga0114129_10079493
554 Ga0114129_10089000
555 Ga0114129_10090955
556 Ga0114129_10098887
557 Ga0114129_10123479
558 Ga0114129_10163661
559 Ga0114129_10165096
560 Ga0114129_10254715
561 Ga0114129_10256817
562 Ga0114129_10369054
563 Ga0114129_10715559
564 Ga0105242_10001591
565 Ga0105242_10108108
566 Ga0105242_10158695
567 Ga0105248_10010905
568 Ga0105248_10016113
569 Ga0105248_10058059
570 Ga0105248_10079568
571 Ga0105248_10125803
572 Ga0105237_10225183
573 Ga0105238_10107445
574 Ga0105249_10057624
575 Ga0105249_10167009
576 Ga0105249_10172765
577 Ga0157374_10070115
578 Ga0157378_10274823
579 Ga0157375_10054095
580 Ga0157375_10508047
581 Ga0163163_10000034
582 Ga0163163_10076536
583 Ga0163163_10164929
584 Ga0157380_10021601
585 Ga0157380_10023435
586 Ga0157380_10039943
587 Ga0157380_10090840
588 Ga0157380_10091595
589 Ga0157380_10216877
590 Ga0157380_10387732
591 Ga0157377_10165032
592 Ga0157379_10010713
593 Ga0206356_10744225
594 Ga0207682_10044477
595 Ga0207710_10012668
596 Ga0207645_10021564
597 Ga0207645_10100483
598 Ga0207643_10065642
599 Ga0207684_10006649
600 Ga0207684_10030067
601 Ga0207707_10082926
602 Ga0207695_10250937
603 Ga0207693_10221898
604 Ga0207660_10051485
605 Ga0207662_10013233
606 Ga0207662_10052540
607 Ga0207652_10216166
608 Ga0207646_10006182
609 Ga0207646_10145654
610 Ga0207681_10076182
611 Ga0207681_10096798
612 Ga0207650_10021304
613 Ga0207650_10133474
614 Ga0207687_10006546
615 Ga0207687_10214624
616 Ga0207664_10030122
617 Ga0207644_10063705
618 Ga0207690_10088002
619 Ga0207706_10080089
620 Ga0207686_10067133
621 Ga0207686_10183542
622 Ga0207670_10146566
623 Ga0207669_10059318
624 Ga0207691_10005809
625 Ga0207691_10024040
626 Ga0207711_10013045
627 Ga0207711_10050157
628 Ga0207711_10150825
629 Ga0207689_10008760
630 Ga0207689_10088320
631 Ga0207689_10147213
632 Ga0207689_10194885
633 Ga0207661_10064657
634 Ga0207679_10092941
635 Ga0207651_10008146
636 Ga0207712_10118489
637 Ga0207668_10266431
638 Ga0207668_10387458
639 Ga0207640_10090012
640 Ga0207658_10161349
641 Ga0207678_10108394
642 Ga0207678_10380723
643 Ga0207708_10002023
644 Ga0207708_10004732
645 Ga0207708_10007858
646 Ga0207708_10091439
647 Ga0207708_10137159
648 Ga0207708_10164408
649 Ga0207708_10210065
650 Ga0207641_10191881
651 Ga0207648_10008403
652 Ga0207648_10008453
653 Ga0207676_10009590
654 Ga0207676_10161775
655 Ga0207675_100038904
656 Ga0207675_100051102
657 Ga0207698_10132413
658 Ga0207698_10219247
659 Ga0207428_10000128
660 Ga0207428_10000335
661 Ga0207428_10030292
662 Ga0207428_10040565
663 Ga0268266_10035790
664 Ga0268265_10125089
665 Ga0268264_10133620
666 Ga0268264_10141617
667 Ga0307513_10245235
668 Ga0307408_100037712
669 Ga0307408_100101968
670 Ga0307408_100247976
671 Ga0307405_10428741
672 Ga0307413_10407006
673 Ga0307407_10047853
674 Ga0307407_10084345
675 Ga0307412_10086683
676 Ga0307412_10227869
677 Ga0307409_100132424
678 Ga0307416_100020390
679 Ga0307416_100058093
680 Ga0307416_100551600
681 Ga0307411_10301965
682 Ga0307415_100009475
683 Ga0373934_0001917
684 Ga0373955_0002846
685 Ga0373933_0057465
686 Ga0373937_0000485
687 Ga0373937_0002908
688 Ga0373937_0228044
689 Ga0373925_0001917
690 Ga0450923_003697
691 Ga0439435_0000636
692 Ga0439435_0007470
693 Ga0439435_0019497
694 Ga0451576_0007396
695 Ga0451576_0204678
696 Ga0451576_0403294
697 Ga0466967_0079148
698 Ga0495653_0012241
699 Ga0495628_0077693
700 Ga0495645_0189887
701 Ga0495623_0127256
702 Ga0495613_0169351
703 Ga0495672_0005309
704 Ga0495672_0049126
705 Ga0495684_0181484
706 Ga0496102_0215288
707 Ga0496104_0171876
708 Ga0496104_0281051
709 Ga0496106_0138086
710 Ga0496108_0056219
711 Ga0496113_0046644
712 Ga0496114_0017874
713 Ga0501036_0075258
714 Ga0501036_0108038
715 Ga0501036_0359191
716 Ga0501038_0115168
717 Ga0501039_0018673
718 Ga0501039_0219159
719 Ga0501040_0210308
720 Ga0501041_0140505
721 Ga0501042_0106512
722 Ga0501042_0270543
723 Ga0501043_0184272
724 Ga0501048_0046124
725 Ga0501048_0053896
726 Ga0501048_0183774
727 Ga0501068_0228678
728 Ga0501069_0256183
729 Ga0501071_0013404
730 Ga0501071_0106791
731 Ga0501072_0072710
732 Ga0501072_0085919
733 Ga0501072_0087052
734 Ga0501072_0219489
735 Ga0501072_0393495
736 Ga0501073_0011681
737 Ga0501073_0039861
738 Ga0501074_0033947
739 Ga0501075_0026330
740 Ga0501075_0030671
741 Ga0501075_0030847
742 Ga0501076_0070117
743 Ga0501076_0183081
744 Ga0501076_0278175
745 Ga0501076_0319993
746 Ga0501077_0023495
747 Ga0501079_0050982
748 Ga0501079_0095906
749 Ga0501080_0188313
750 Ga0501080_0420439
751 Ga0501081_0088942
752 Ga0501035_0457567
753 Ga0501045_0017435
754 nmdc:mga0yw44_74531_c1
755 nmdc:mga0k408_14486_c1
756 nmdc:mga0k408_444_c1
757 nmdc:mga06z11_10186_c1
758 nmdc:mga06z11_237752_c1
759 nmdc:mga07m45_40606_c1
760 nmdc:mga05p37_124675_c1
761 nmdc:mga05p37_205120_c1
762 nmdc:mga05p37_26100_c1
763 nmdc:mga05p37_27662_c1
764 nmdc:mga05p37_318590_c1
765 nmdc:mga05p37_338146_c1
766 nmdc:mga05p37_34686_c1
767 nmdc:mga05p37_39_c1
768 nmdc:mga05p37_442850_c1
769 nmdc:mga05p37_620506_c1
770 nmdc:mga05p37_93644_c1
771 nmdc:mga09592_378927_c1
772 nmdc:mga09592_46950_c2
773 nmdc:mga0qj67_31088_c1
774 nmdc:mga0qj67_55310_c1
775 nmdc:mga06r32_230000_c1
776 nmdc:mga06r32_24542_c1
777 nmdc:mga06r32_325073_c1
778 nmdc:mga06r32_43569_c1
779 nmdc:mga06r32_464729_c1
780 nmdc:mga06r32_97921_c1
781 nmdc:mga08y16_10579_c1
782 nmdc:mga08y16_159964_c1
783 nmdc:mga08y16_18306_c1
784 nmdc:mga08y16_195681_c1
785 nmdc:mga08y16_587455_c1
786 nmdc:mga0n895_412530_c1
787 nmdc:mga0n895_418223_c1
788 nmdc:mga0n895_52053_c1
789 nmdc:mga0n895_600225_c1
790 nmdc:mga0rr50_51077_c1
791 nmdc:mga0rr50_6312_c1
792 nmdc:mga08x19_127010_c1
793 nmdc:mga08x19_28990_c1
794 nmdc:mga0a205_120619_c1
795 nmdc:mga0a205_156640_c1
796 nmdc:mga0a205_322815_c1
797 nmdc:mga0a205_68579_c1
798 Ga0495619_0048622
799 Ga0495619_0110175
800 Ga0500641_0001064
801 Ga0500555_000049
802 Ga0500568_0002037
803 Ga0500616_0000100
804 Ga0500645_000146
805 Ga0501084_0086391
806 Ga0501084_0097176
807 Ga0590071_000642
808 Ga0590074_000538
809 Ga0590075_008262
810 Ga0590077_003534
811 Ga0501082_0107818
812 Ga0501082_0117788
813 Ga0501082_0172113
814 Ga0530510_0209341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

66

318

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4962 9 280
5b57-assembly1.cif.gz_A inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.488 9 272
5b58-assembly1.cif.gz_B inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia 0.4873 8 282
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.4826 1 278
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4812 9 280
ID Description Score Start End Superfamily
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8141 46 277 1.10.3470.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7873 44 278 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7839 45 278 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7673 44 278 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7662 44 278 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A7Y5WUH1-F1-model_v4 Autoinducer 2 import system permease protein LsrD 0.838 7 280 GO:0005886
GO:0022857
AF-A0A1H1XM23-F1-model_v4 Xylose transport system permease protein XylH 0.8138 13 277 GO:0005886
GO:0022857
AF-A0A7Y5WUH1-F1-model_v4 Autoinducer 2 import system permease protein LsrD 0.8135 7 280 GO:0005886
GO:0022857
AF-A0A7Y0ZTD7-F1-model_v4 L-arabinose ABC transporter permease AraH 0.8134 38 277 GO:0005886
GO:0022857
AF-A0A1H5YRI8-F1-model_v4 Ribose transport system permease protein 0.8125 14 279 GO:0005886
GO:0022857

Map