metagRoot

F436488

General Info

Members	Datasets	Scaffolds	Average Seq Length
407	279	370	340

Family's Representative Sequence

Representative Sequence	3300028800\|Ga0265338_10051930\|Ga0265338_100519303
Length	347
Sequence	MKFLDQCKIFIRSGDGGGGSVSFRREKFIEYGGPDDVWIEAVNGLNTLIDYRYQQHFKAETGVHGMGRNRAGHNGADIELKVPVGTQVYEEDRETLIADLDHAGMRVRLAKGGNGGFGNTHFKGPINQAPRHANPGLPGEERWLWLRLKLIADAGLVGLPNAGKSTFLAATSAAKPKVADYPFTTLTPNLGVVDLSTQERFVIADIPGLIEGASEGAGLGTKFLGHVERTAVLIHLVDGTQEDIAGAYSTIRAELAAYGEGLEDKTELLALNKIDALDPDARKAAAKILQKAAGKKTFLISGVSGEGVTELLRAAFKAVQKKRMDEGVIPRTDDLDDESPTDGGWQP

Samples

	Sample ID	Description	Type	Environment
1	2510917020	Caulobacter sp. AP07	Isolate	Rhizosphere
2	2545555834	Methylobacterium sp. WSM2598	Isolate	Nodule
3	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
4	2582581280	Caulobacter henricii CF287	Isolate	Rhizosphere
5	2582581293	Caulobacter henricii YR570	Isolate	Rhizosphere
6	2585428106	Caulobacter sp. OV484	Isolate	Rhizosphere
7	2595698237	Methylobacterium sp. UNCCL125	Isolate	Unclassified
8	2643221545	Caulobacter sp. Root1455	Isolate	Unclassified
9	2643221552	Caulobacter sp. Root1472	Isolate	Unclassified
10	2643221583	Caulobacter sp. Root655	Isolate	Unclassified
11	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
12	2643221640	Caulobacter sp. Root342	Isolate	Unclassified
13	2643221642	Caulobacter sp. Root343	Isolate	Unclassified
14	2643221691	Caulobacter sp. Root487D2Y	Isolate	Unclassified
15	2738541281	Methylobacterium sp. GV094	Isolate	Unclassified
16	2738543032	Methylobacterium sp. GV104	Isolate	Unclassified
17	2791355048	Caulobacter flavus CGMCC1 15093	Isolate	Rhizosphere
18	2818991435	Caulobacter henricii 536	Isolate	Unclassified
19	2818991454	Caulobacter rhizosphaerae 3260	Isolate	Rhizosphere
20	2829745981	Methylorubrum rhodinum DSM 2163	Isolate	Rhizosphere
21	2842698319	Methylobacterium sp. R-72139	Isolate	Unclassified
22	2843744320	Caulobacter flavus RHGG3	Isolate	Unclassified
23	2849560528	Caulobacter zeae 410	Isolate	Unclassified
24	2849573788	Caulobacter endophyticus 774	Isolate	Unclassified
25	2851153111	Caulobacter radicis 736	Isolate	Unclassified
26	2857504554	Caulobacter sp. R-72291	Isolate	Unclassified
27	2861691609	Methylorubrum thiocyanatum DSM 11490	Isolate	Rhizosphere
28	2884960567	Caulobacter sp. 602-1	Isolate	Rhizosphere
29	2889306138	Methylobacterium sp. PvR107	Isolate	Rhizosphere
30	2898329390	Caulobacter sp. 602-2	Isolate	Rhizosphere
31	2902330777	Methylobacterium sp. 2A	Isolate	Unclassified
32	2902405164	Methylobacterium sp. P1-11	Isolate	Unclassified
33	2928125067	Methylobacterium sp. 1973	Isolate	Unclassified
34	2928531327	Caulobacter sp. 1776	Isolate	Rhizosphere
35	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
36	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
37	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
38	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
39	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
40	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
41	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
42	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
43	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
44	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
45	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
46	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
47	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
48	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
49	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
50	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
51	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
52	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
53	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
54	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
55	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
56	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
57	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
58	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
59	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
60	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
61	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
62	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
63	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
64	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
65	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
66	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
67	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
68	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
69	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
70	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
71	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
72	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
73	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
74	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
75	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
76	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
77	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
78	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
79	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
80	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
81	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
82	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
83	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
84	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
85	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
86	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
88	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
90	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
91	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
92	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
93	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
94	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
95	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
96	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
97	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
98	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
99	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
100	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
101	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
102	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
104	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
107	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
139	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
143	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
144	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
145	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
146	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
147	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
148	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
149	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
150	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
151	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
152	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
153	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
154	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
155	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
156	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
157	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
158	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
159	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
160	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
161	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
162	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
163	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
164	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
165	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
166	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
167	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
168	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
169	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
170	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
171	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
172	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
173	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
174	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
175	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
176	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
177	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
178	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
179	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
180	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
181	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
182	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
183	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
184	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
185	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
186	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
187	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
188	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
189	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
190	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
191	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
192	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
193	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
194	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
195	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
196	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
197	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
198	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
199	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
200	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
201	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
202	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
203	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
204	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
205	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
206	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
207	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
208	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
209	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
210	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
211	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
212	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
213	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
215	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
216	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
223	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
226	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
229	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
232	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
233	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
235	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
238	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
239	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
240	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
241	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
242	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
243	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
244	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
245	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
246	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
247	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
248	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
249	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
250	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
251	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
252	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
253	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
254	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
255	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
256	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
257	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
258	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
259	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
260	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
261	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
262	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
263	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
264	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
265	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
266	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
267	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
268	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
269	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
270	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
271	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
272	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
273	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
274	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
275	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
276	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
277	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
278	641522639	Methylobacterium sp. 4-46	Isolate	Nodule
279	643348564	Methylobacterium nodulans ORS 2060	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	90.91
Metatranscriptomes	0
Isolates	9.09

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	16.71
Nodule	0.74
Rhizoplane	4.42
Rhizosphere	68.8
Stem	0
Stem Tuber	0
Unclassified	9.34

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0055537_1001344	3300003773	Bacteria	9974
2	Ga0055536_1002406	3300003781	Bacteria	10527
3	Ga0055536_1002444	3300003781	Bacteria	10431
4	Ga0055528_1002366	3300003790	Bacteria	10186
5	Ga0055530_10003637	3300003791	Bacteria	8644
6	Ga0055530_10005875	3300003791	Bacteria	5671
7	Ga0055531_10001551	3300003794	Bacteria	16821
8	Ga0055531_10005886	3300003794	Bacteria	7078
9	Ga0055531_10006877	3300003794	Bacteria	6340
10	Ga0065165_1001181	3300005262	Bacteria	30330
11	Ga0070658_10037444	3300005327	Bacteria	3911
12	Ga0070670_100047898	3300005331	Bacteria	3679
13	Ga0070660_100027621	3300005339	Bacteria	4237
14	Ga0070660_100356539	3300005339	Bacteria	1205
15	Ga0070691_10024839	3300005341	Bacteria	2787
16	Ga0070691_10067799	3300005341	Bacteria	1727
17	Ga0070668_100003919	3300005347	Bacteria	10993
18	Ga0070668_100011777	3300005347	Bacteria	6513
19	Ga0070668_100116726	3300005347	Bacteria	2129
20	Ga0070671_100002736	3300005355	Bacteria	13694
21	Ga0070659_100008914	3300005366	Bacteria	7352
22	Ga0070667_100008242	3300005367	Bacteria	8637
23	Ga0070667_100398919	3300005367	Bacteria	1252
24	Ga0070709_10145307	3300005434	Bacteria	1633
25	Ga0070714_100128772	3300005435	Bacteria	2260
26	Ga0070710_10004585	3300005437	Bacteria	6528
27	Ga0070700_100028366	3300005441	Bacteria	3329
28	Ga0070694_100002020	3300005444	Bacteria	12041
29	Ga0070708_100050926	3300005445	Bacteria	3668
30	Ga0070663_100081759	3300005455	Bacteria	2375
31	Ga0070681_10002805	3300005458	Bacteria	16089
32	Ga0070681_10012018	3300005458	Bacteria	8585
33	Ga0070706_100310420	3300005467	Bacteria	1471
34	Ga0070699_100001391	3300005518	Bacteria	22232
35	Ga0070679_100309248	3300005530	Bacteria	1530
36	Ga0068853_100037066	3300005539	Bacteria	4147
37	Ga0070695_100010639	3300005545	Bacteria	5499
38	Ga0070665_100000418	3300005548	Bacteria	62048
39	Ga0070665_100000691	3300005548	Bacteria	44984
40	Ga0070665_100017881	3300005548	Bacteria	7118
41	Ga0070704_100000778	3300005549	Bacteria	15756
42	Ga0068855_100005017	3300005563	Bacteria	16158
43	Ga0068855_100404718	3300005563	Bacteria	1495
44	Ga0070664_100051683	3300005564	Bacteria	3479
45	Ga0068857_100052533	3300005577	Bacteria	3616
46	Ga0070702_100047382	3300005615	Bacteria	2441
47	Ga0068859_100001582	3300005617	Bacteria	23209
48	Ga0068859_100004561	3300005617	Bacteria	14129
49	Ga0068863_100004097	3300005841	Bacteria	14400
50	Ga0068863_100154088	3300005841	Bacteria	2200
51	Ga0068858_100040198	3300005842	Bacteria	4336
52	Ga0068860_100000212	3300005843	Bacteria	91248
53	Ga0068860_100124911	3300005843	Bacteria	2466
54	Ga0068862_100005310	3300005844	Bacteria	10791
55	Ga0068862_100064297	3300005844	Bacteria	3158
56	Ga0068862_100270618	3300005844	Bacteria	1553
57	Ga0075363_100086741	3300006048	Bacteria	1719
58	Ga0075432_10001511	3300006058	Bacteria	7599
59	Ga0070715_10004593	3300006163	Bacteria	4548
60	Ga0070716_100002237	3300006173	Bacteria	8916
61	Ga0075369_10002976	3300006186	Bacteria	6124
62	Ga0075366_10024808	3300006195	Bacteria	3497
63	Ga0075428_100010200	3300006844	Bacteria	10427
64	Ga0075430_100001483	3300006846	Bacteria	19129
65	Ga0075431_100004837	3300006847	Bacteria	13260
66	Ga0075431_100025713	3300006847	Bacteria	6033
67	Ga0075431_100026686	3300006847	Bacteria	5925
68	Ga0075433_10002052	3300006852	Bacteria	15222
69	Ga0075434_100001473	3300006871	Bacteria	19815
70	Ga0075429_100005294	3300006880	Bacteria	11102
71	Ga0075429_100361112	3300006880	Bacteria	1272
72	Ga0097620_100001582	3300006931	Bacteria	23209
73	Ga0097620_100004561	3300006931	Bacteria	14129
74	Ga0111539_10008538	3300009094	Bacteria	13014
75	Ga0111539_10404539	3300009094	Bacteria	1590
76	Ga0114129_10007220	3300009147	Bacteria	15817
77	Ga0114129_10052416	3300009147	Bacteria	5725
78	Ga0105248_10001822	3300009177	Bacteria	23689
79	Ga0105248_10004488	3300009177	Bacteria	15447
80	Ga0105237_10077900	3300009545	Bacteria	3304
81	Ga0105238_10089409	3300009551	Bacteria	3066
82	Ga0105249_10439916	3300009553	Bacteria	1341
83	Ga0105239_10153723	3300010375	Bacteria	2569
84	Ga0105246_10033099	3300011119	Bacteria	3433
85	Ga0157373_10002536	3300013100	Bacteria	13905
86	Ga0163163_10000780	3300014325	Bacteria	27061
87	Ga0163163_10193127	3300014325	Bacteria	2084
88	Ga0157380_10154977	3300014326	Bacteria	1984
89	Ga0157379_10000947	3300014968	Bacteria	23530
90	Ga0209565_1001136	3300025263	Bacteria	12799
91	Ga0209673_1004604	3300025273	Bacteria	7311
92	Ga0209675_1010894	3300025291	Bacteria	3063
93	Ga0209676_1000253	3300025292	Bacteria	113412
94	Ga0209676_1000262	3300025292	Bacteria	111061
95	Ga0209564_1030256	3300025295	Bacteria	1680
96	Ga0209758_1000865	3300025297	Bacteria	41883
97	Ga0209050_1000411	3300025298	Bacteria	79805
98	Ga0209050_1000948	3300025298	Bacteria	37706
99	Ga0209256_1003405	3300025299	Bacteria	11209
100	Ga0209256_1008430	3300025299	Bacteria	4780
101	Ga0209051_1002481	3300025303	Bacteria	13178
102	Ga0209257_1000036	3300025304	Bacteria	616006
103	Ga0209257_1001169	3300025304	Bacteria	33227
104	Ga0209257_1011938	3300025304	Bacteria	4095
105	Ga0207713_1029069	3300025735	Bacteria	2482
106	Ga0207699_10001462	3300025906	Bacteria	11208
107	Ga0207707_10010835	3300025912	Bacteria	7922
108	Ga0207707_10023826	3300025912	Bacteria	5353
109	Ga0207695_10000837	3300025913	Bacteria	56634
110	Ga0207695_10001415	3300025913	Bacteria	40402
111	Ga0207660_10005342	3300025917	Bacteria	8345
112	Ga0207657_10011539	3300025919	Bacteria	8771
113	Ga0207657_10193650	3300025919	Bacteria	1639
114	Ga0207652_10019461	3300025921	Bacteria	5584
115	Ga0207652_10050296	3300025921	Bacteria	3570
116	Ga0207694_10142722	3300025924	Bacteria	1926
117	Ga0207650_10075855	3300025925	Bacteria	2539
118	Ga0207700_10000624	3300025928	Bacteria	20699
119	Ga0207664_10025068	3300025929	Bacteria	4486
120	Ga0207664_10112330	3300025929	Bacteria	2268
121	Ga0207644_10006266	3300025931	Bacteria	7749
122	Ga0207644_10006733	3300025931	Bacteria	7486
123	Ga0207690_10000898	3300025932	Bacteria	18981
124	Ga0207690_10013676	3300025932	Bacteria	4883
125	Ga0207706_10067095	3300025933	Bacteria	3156
126	Ga0207686_10094227	3300025934	Bacteria	1985
127	Ga0207665_10005639	3300025939	Bacteria	8346
128	Ga0207711_10005857	3300025941	Bacteria	10377
129	Ga0207711_10010603	3300025941	Bacteria	7663
130	Ga0207679_10037352	3300025945	Bacteria	3452
131	Ga0207667_10011376	3300025949	Bacteria	10348
132	Ga0207712_10272960	3300025961	Bacteria	1376
133	Ga0207668_10000019	3300025972	Bacteria	152108
134	Ga0207668_10007726	3300025972	Bacteria	6397
135	Ga0207668_10048828	3300025972	Bacteria	2906
136	Ga0207668_10145425	3300025972	Bacteria	1828
137	Ga0207658_10006523	3300025986	Bacteria	7964
138	Ga0207658_10277543	3300025986	Bacteria	1435
139	Ga0207703_10002213	3300026035	Bacteria	17068
140	Ga0207703_10236975	3300026035	Bacteria	1639
141	Ga0207678_10074671	3300026067	Bacteria	2905
142	Ga0207708_10005027	3300026075	Bacteria	9751
143	Ga0207641_10001331	3300026088	Bacteria	24454
144	Ga0207676_10067705	3300026095	Bacteria	2853
145	Ga0207674_10004362	3300026116	Bacteria	17059
146	Ga0207674_10046471	3300026116	Bacteria	4457
147	Ga0207675_100077506	3300026118	Bacteria	3114
148	Ga0207428_10000082	3300027907	Bacteria	133684
149	Ga0268266_10000003	3300028379	Bacteria	1701703
150	Ga0268266_10000711	3300028379	Bacteria	44986
151	Ga0268265_10001421	3300028380	Bacteria	20258
152	Ga0268265_10002496	3300028380	Bacteria	13801
153	Ga0268264_10000091	3300028381	Bacteria	233338
154	Ga0268264_10002241	3300028381	Bacteria	17148
155	Ga0268264_10010714	3300028381	Bacteria	7574
156	Ga0307517_10097555	3300028786	Bacteria	2345
157	Ga0307515_10031603	3300028794	Bacteria	8816
158	Ga0307515_10041372	3300028794	Bacteria	7247
159	Ga0265338_10045124	3300028800	Bacteria	4058
160	Ga0265338_10051930	3300028800	Bacteria	3686
161	Ga0265324_10037009	3300029957	Bacteria	1697
162	Ga0265327_10000868	3300031251	Bacteria	44811
163	Ga0265327_10002948	3300031251	Bacteria	17008
164	Ga0265327_10020045	3300031251	Bacteria	4091
165	Ga0307513_10000873	3300031456	Bacteria	43622
166	Ga0307513_10004902	3300031456	Bacteria	17766
167	Ga0307513_10015472	3300031456	Bacteria	9248
168	Ga0307516_10000030	3300031730	Bacteria	159694
169	Ga0373936_0015109	3300035113	Bacteria	2957
170	Ga0373962_0005150	3300035242	Bacteria	3159
171	Ga0373931_0053081	3300035691	Bacteria	2163
172	Ga0395899_0000018	3300037312	Bacteria	423194
173	Ga0436365_1667560	3300039437	Bacteria	1426
174	Ga0436361_0193092	3300039447	Bacteria	3364
175	Ga0439459_0009508	3300042438	Bacteria	1683
176	Ga0466959_0183253	3300045049	Bacteria	1464
177	Ga0495627_002979	3300046453	Bacteria	7759
178	Ga0495590_0000213	3300046457	Bacteria	31568
179	Ga0495629_0000062	3300046459	Bacteria	97169
180	Ga0495629_0157367	3300046459	Bacteria	1578
181	Ga0495638_0001702	3300046460	Bacteria	19352
182	Ga0495638_0002056	3300046460	Bacteria	17093
183	Ga0495638_0004768	3300046460	Bacteria	10229
184	Ga0495638_0005743	3300046460	Bacteria	9134
185	Ga0495638_0110768	3300046460	Bacteria	1631
186	Ga0495641_0021373	3300046461	Bacteria	3257
187	Ga0495651_0211852	3300046462	Bacteria	1348
188	Ga0495650_0000046	3300046471	Bacteria	342987
189	Ga0495582_0010740	3300046473	Bacteria	5038
190	Ga0495583_0000003	3300046506	Bacteria	709273
191	Ga0495606_0014307	3300046507	Bacteria	6205
192	Ga0495610_0000746	3300046512	Bacteria	30703
193	Ga0495610_0002406	3300046512	Bacteria	15756
194	Ga0495610_0002765	3300046512	Bacteria	14376
195	Ga0495616_0002861	3300046513	Bacteria	11256
196	Ga0495631_0009150	3300046518	Bacteria	4962
197	Ga0495637_0027922	3300046520	Bacteria	2522
198	Ga0495643_0009780	3300046522	Bacteria	5931
199	Ga0495648_0000391	3300046524	Bacteria	48012
200	Ga0495648_0061296	3300046524	Bacteria	2235
201	Ga0495654_0001027	3300046530	Bacteria	20450
202	Ga0495609_0031322	3300046538	Bacteria	2418
203	Ga0495597_0006043	3300046542	Bacteria	6305
204	Ga0495622_0040185	3300046557	Bacteria	2177
205	Ga0495668_0000291	3300046616	Bacteria	68802
206	Ga0495668_0011620	3300046616	Bacteria	5265
207	Ga0495668_0077620	3300046616	Bacteria	1823
208	Ga0495625_0022110	3300046660	Bacteria	4881
209	Ga0495625_0025774	3300046660	Bacteria	4452
210	Ga0495625_0029582	3300046660	Bacteria	4094
211	Ga0495625_0118180	3300046660	Bacteria	1806
212	Ga0495588_0140426	3300046674	Bacteria	1276
213	Ga0495647_0005008	3300046681	Bacteria	4337
214	Ga0495658_0001821	3300046683	Bacteria	10930
215	Ga0495669_0000322	3300046684	Bacteria	26232
216	Ga0495613_0004613	3300046689	Bacteria	10342
217	Ga0495649_0120487	3300046694	Bacteria	1388
218	Ga0495589_0021315	3300046794	Bacteria	3311
219	Ga0495660_0005950	3300046810	Bacteria	7262
220	Ga0495672_0003014	3300047320	Bacteria	14809
221	Ga0495687_069460	3300047443	Bacteria	1418
222	Ga0495677_0010094	3300047445	Bacteria	3473
223	Ga0495679_008253	3300047446	Bacteria	4250
224	Ga0495673_0000440	3300047469	Bacteria	46059
225	Ga0495673_0001073	3300047469	Bacteria	23986
226	Ga0495686_0006241	3300047472	Bacteria	9177
227	Ga0495686_0013829	3300047472	Bacteria	5587
228	Ga0495686_0016414	3300047472	Bacteria	5021
229	Ga0495686_0017329	3300047472	Bacteria	4857
230	Ga0495593_0036802	3300047673	Bacteria	2652
231	Ga0496101_0036980	3300048904	Bacteria	3461
232	Ga0496101_0071504	3300048904	Bacteria	2543
233	Ga0496101_0193955	3300048904	Bacteria	1568
234	Ga0496101_0219213	3300048904	Bacteria	1476
235	Ga0496102_0012878	3300048905	Bacteria	7240
236	Ga0496103_0075302	3300048906	Bacteria	2117
237	Ga0496104_0054874	3300048907	Bacteria	3766
238	Ga0496104_0228190	3300048907	Bacteria	1774
239	Ga0496105_0307793	3300048908	Bacteria	1272
240	Ga0496106_0007199	3300048909	Bacteria	8220
241	Ga0496106_0011268	3300048909	Bacteria	6617
242	Ga0496107_0000028	3300048910	Bacteria	105641
243	Ga0496108_0141218	3300048911	Bacteria	2075
244	Ga0496109_0090680	3300048912	Bacteria	2827
245	Ga0496109_0103319	3300048912	Bacteria	2645
246	Ga0496114_0074152	3300048917	Bacteria	2864
247	Ga0496115_0000398	3300048918	Bacteria	35876
248	Ga0496115_0003536	3300048918	Bacteria	11240
249	Ga0496116_0037547	3300048919	Bacteria	3376
250	Ga0496118_0007030	3300048921	Bacteria	12115
251	Ga0496119_0040356	3300048922	Bacteria	2986
252	Ga0496121_0000042	3300048924	Bacteria	342304
253	Ga0496121_0001627	3300048924	Bacteria	37176
254	Ga0496121_0093373	3300048924	Bacteria	2343
255	Ga0496124_0020387	3300048927	Bacteria	6127
256	Ga0496124_0056210	3300048927	Bacteria	3320
257	Ga0496125_0002080	3300048928	Bacteria	26979
258	Ga0495678_000563	3300049459	Bacteria	35633
259	Ga0495682_0018973	3300049460	Bacteria	2589
260	Ga0501032_0003541	3300049569	Bacteria	11916
261	Ga0501034_0000068	3300049571	Bacteria	182904
262	Ga0501034_0201153	3300049571	Bacteria	1950
263	Ga0501036_0042142	3300049572	Bacteria	3865
264	Ga0501037_0004851	3300049573	Bacteria	9785
265	Ga0501038_0017782	3300049574	Bacteria	6424
266	Ga0501039_0000348	3300049575	Bacteria	33083
267	Ga0501046_0004718	3300049580	Bacteria	12292
268	Ga0501047_0001128	3300049581	Bacteria	26509
269	Ga0501047_0230062	3300049581	Bacteria	1708
270	Ga0501048_0001283	3300049582	Bacteria	19050
271	Ga0501048_0063131	3300049582	Bacteria	2621
272	Ga0501048_0126377	3300049582	Bacteria	1808
273	Ga0501067_0009532	3300049583	Bacteria	5379
274	Ga0501070_0017193	3300049586	Bacteria	6071
275	Ga0501070_0046623	3300049586	Bacteria	3604
276	Ga0501070_0138100	3300049586	Bacteria	2013
277	Ga0501071_0048281	3300049587	Bacteria	3061
278	Ga0501072_0023935	3300049588	Bacteria	4747
279	Ga0501072_0358853	3300049588	Bacteria	1157
280	Ga0501073_0034806	3300049589	Bacteria	3582
281	Ga0501074_0037897	3300049590	Bacteria	3494
282	Ga0501075_0030005	3300049591	Bacteria	4024
283	Ga0501075_0142561	3300049591	Bacteria	1826
284	Ga0501075_0348906	3300049591	Bacteria	1128
285	Ga0501076_0018225	3300049592	Bacteria	5348
286	Ga0501077_0051018	3300049593	Bacteria	2629
287	Ga0501238_012481	3300049671	Bacteria	1150
288	Ga0501079_0019517	3300049741	Bacteria	5178
289	Ga0501079_0049195	3300049741	Bacteria	3253
290	Ga0501079_0220156	3300049741	Bacteria	1483
291	Ga0501080_0001093	3300049742	Bacteria	22352
292	Ga0501080_0080618	3300049742	Bacteria	3025
293	Ga0501081_0027673	3300049743	Bacteria	3823
294	Ga0501081_0047237	3300049743	Bacteria	2962
295	Ga0501083_0033719	3300049744	Bacteria	3504
296	Ga0501035_0000015	3300049822	Bacteria	246493
297	Ga0501035_0002262	3300049822	Bacteria	19029
298	Ga0501035_0133725	3300049822	Bacteria	2161
299	Ga0501044_0000026	3300049823	Bacteria	183624
300	Ga0501045_0028363	3300049824	Bacteria	4038
301	Ga0501045_0208861	3300049824	Bacteria	1454
302	nmdc:mga05p37_138220_c1	3300050507	Bacteria	2986
303	nmdc:mga05p37_19_c3	3300050507	Bacteria	27587
304	nmdc:mga05p37_69462_c1	3300050507	Bacteria	4333
305	nmdc:mga09592_135389_c2	3300050508	Bacteria	1211
306	nmdc:mga09592_758_c1	3300050508	Bacteria	24836
307	nmdc:mga09592_89611_c1	3300050508	Bacteria	2627
308	nmdc:mga0qj67_1779_c1	3300050509	Bacteria	15251
309	nmdc:mga0qj67_2388_c1	3300050509	Bacteria	13377
310	nmdc:mga06r32_1393_c1	3300050510	Bacteria	21841
311	nmdc:mga06r32_38923_c1	3300050510	Bacteria	4508
312	nmdc:mga06r32_4145_c1	3300050510	Bacteria	12980
313	nmdc:mga06r32_4928_c1	3300050510	Bacteria	12030
314	nmdc:mga08y16_13453_c1	3300050511	Bacteria	8611
315	nmdc:mga08y16_306018_c1	3300050511	Bacteria	1637
316	nmdc:mga08y16_482415_c1	3300050511	Bacteria	1261
317	nmdc:mga0n895_1573_c1	3300050512	Bacteria	17177
318	nmdc:mga0rr50_390_c1	3300050513	Bacteria	23898
319	nmdc:mga0a205_139629_c1	3300050515	Bacteria	2323
320	nmdc:mga0a205_681_c1	3300050515	Bacteria	27171
321	nmdc:mga0sz30_2212_c1	3300050516	Bacteria	6950
322	Ga0500635_0000249	3300053080	Bacteria	23486
323	Ga0495595_0011321	3300053084	Bacteria	3726
324	Ga0495619_0000378	3300053085	Bacteria	30722
325	Ga0495619_0017765	3300053085	Bacteria	4507
326	Ga0500578_0000077	3300053086	Bacteria	108269
327	Ga0500643_000458	3300053087	Bacteria	30192
328	Ga0500643_004895	3300053087	Bacteria	5899
329	Ga0500643_006333	3300053087	Bacteria	4957
330	Ga0500644_0001165	3300053088	Bacteria	7610
331	Ga0500583_0024131	3300053092	Bacteria	2576
332	Ga0500651_0084378	3300053093	Bacteria	1964
333	Ga0500641_0015006	3300053096	Bacteria	2867
334	Ga0500556_0001964	3300053104	Bacteria	7255
335	Ga0500562_002560	3300053108	Bacteria	4530
336	Ga0500594_0000155	3300053118	Bacteria	18010
337	Ga0500595_000555	3300053119	Bacteria	22336
338	Ga0500608_000544	3300053122	Bacteria	14103
339	Ga0500618_000189	3300053125	Bacteria	50500
340	Ga0500658_0002398	3300053134	Bacteria	7253
341	Ga0500559_0000004	3300053136	Bacteria	241551
342	Ga0500559_0000221	3300053136	Bacteria	45774
343	Ga0500559_0050065	3300053136	Bacteria	1842
344	Ga0500564_000040	3300053138	Bacteria	35132
345	Ga0500616_0013961	3300053153	Bacteria	4634
346	Ga0500616_0039575	3300053153	Bacteria	2541
347	Ga0500616_0042061	3300053153	Bacteria	2448
348	Ga0500619_050034	3300053154	Bacteria	1350
349	Ga0500622_0001074	3300053156	Bacteria	22728
350	Ga0500622_0019980	3300053156	Bacteria	3556
351	Ga0500622_0024569	3300053156	Bacteria	3186
352	Ga0500622_0025932	3300053156	Bacteria	3095
353	Ga0500622_0028530	3300053156	Bacteria	2939
354	Ga0500622_0063496	3300053156	Bacteria	1880
355	Ga0500624_003984	3300053157	Bacteria	1938
356	Ga0500627_0017420	3300053158	Bacteria	2822
357	Ga0500636_0012543	3300053177	Bacteria	4968
358	Ga0500636_0120387	3300053177	Bacteria	1473
359	Ga0500637_0017954	3300053178	Bacteria	3795
360	Ga0500625_019431	3300053729	Bacteria	3192
361	Ga0500645_001667	3300053730	Bacteria	10901
362	Ga0500645_003040	3300053730	Bacteria	7057
363	Ga0500645_015379	3300053730	Bacteria	2424
364	Ga0501084_0033293	3300054114	Bacteria	4311
365	Ga0501084_0091947	3300054114	Bacteria	2547
366	Ga0501082_0009135	3300060353	Bacteria	8546
367	Ga0501082_0045474	3300060353	Bacteria	3786
368	Ga0501082_0137028	3300060353	Bacteria	2124
369	Ga0530510_0013907	3300061734	Bacteria	5669
370	Ga0530510_0032388	3300061734	Bacteria	3761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049824	Ga0501045_0208861	Ga0501045_0208861_222_1109	285
2	3300048909	Ga0496106_0007199	Ga0496106_0007199_15_914	297
3	3300046694	Ga0495649_0120487	Ga0495649_0120487_431_1339	298
4	3300049586	Ga0501070_0138100	Ga0501070_0138100_1045_1998	307
5	3300046462	Ga0495651_0211852	Ga0495651_0211852_369_1322	308
6	3300050508	nmdc:mga09592_89611_c1	nmdc:mga09592_89611_c1_20_994	312
7	3300048912	Ga0496109_0103319	Ga0496109_0103319_249_1232	316
8	3300049741	Ga0501079_0220156	Ga0501079_0220156_54_1040	317
9	3300053080	Ga0500635_0000249	Ga0500635_0000249_2134_3201	317
10	3300053157	Ga0500624_003984	Ga0500624_003984_131_1198	317
11	3300053177	Ga0500636_0120387	Ga0500636_0120387_347_1414	317
12	3300053178	Ga0500637_0017954	Ga0500637_0017954_2198_3265	317
13	3300046684	Ga0495669_0000322	Ga0495669_0000322_25038_26084	326
14	3300047445	Ga0495677_0010094	Ga0495677_0010094_2252_3298	326
15	3300053108	Ga0500562_002560	Ga0500562_002560_2166_3233	326
16	3300005434	Ga0070709_10145307	Ga0070709_101453071	327
17	3300005437	Ga0070710_10004585	Ga0070710_100045859	327
18	3300006163	Ga0070715_10004593	Ga0070715_100045932	327
19	3300006173	Ga0070716_100002237	Ga0070716_1000022372	327
20	3300025735	Ga0207713_1029069	Ga0207713_10290691	327
21	3300025906	Ga0207699_10001462	Ga0207699_1000146210	327
22	3300025928	Ga0207700_10000624	Ga0207700_1000062415	327
23	3300025929	Ga0207664_10025068	Ga0207664_100250686	327
24	3300025931	Ga0207644_10006733	Ga0207644_100067332	327
25	3300025939	Ga0207665_10005639	Ga0207665_100056396	327
26	3300046459	Ga0495629_0000062	Ga0495629_0000062_82305_83324	327
27	3300046461	Ga0495641_0021373	Ga0495641_0021373_29_1048	327
28	3300046473	Ga0495582_0010740	Ga0495582_0010740_2623_3642	327
29	3300046681	Ga0495647_0005008	Ga0495647_0005008_22_1041	327
30	3300046683	Ga0495658_0001821	Ga0495658_0001821_6136_7155	327
31	3300046689	Ga0495613_0004613	Ga0495613_0004613_5901_6920	327
32	3300048904	Ga0496101_0071504	Ga0496101_0071504_867_1886	327
33	3300048907	Ga0496104_0054874	Ga0496104_0054874_658_1677	327
34	3300048908	Ga0496105_0307793	Ga0496105_0307793_93_1112	327
35	3300048917	Ga0496114_0074152	Ga0496114_0074152_1333_2352	327
36	3300053085	Ga0495619_0000378	Ga0495619_0000378_18681_19700	327
37	iso_pu_bacteria	2595698237	2596372331	327
38	iso_pu_bacteria	2889306138	2889310947	327
39	iso_pu_bacteria	2902330777	2902336278	327
40	iso_pu_bacteria	2902405164	2902406189	327
41	iso_pu_bacteria	2928125067	2928126810	327
42	iso_pu_bacteria	3003665799	3003672558	327
43	iso_pu_bacteria	643348564	643602368	327
44	3300031251	Ga0265327_10020045	Ga0265327_100200452	328
45	3300048907	Ga0496104_0228190	Ga0496104_0228190_526_1539	328
46	3300048911	Ga0496108_0141218	Ga0496108_0141218_863_1876	328
47	3300053084	Ga0495595_0011321	Ga0495595_0011321_301_1314	328
48	3300053085	Ga0495619_0017765	Ga0495619_0017765_1326_2339	328
49	iso_pu_bacteria	2545555834	2545672523	328
50	iso_pu_bacteria	641522639	641644357	328
51	3300006058	Ga0075432_10001511	Ga0075432_100015117	329
52	3300006844	Ga0075428_100010200	Ga0075428_10001020011	329
53	3300006846	Ga0075430_100001483	Ga0075430_10000148311	329
54	3300006852	Ga0075433_10002052	Ga0075433_1000205215	329
55	3300006871	Ga0075434_100001473	Ga0075434_10000147311	329
56	3300006880	Ga0075429_100005294	Ga0075429_1000052944	329
57	3300009094	Ga0111539_10008538	Ga0111539_100085385	329
58	3300009147	Ga0114129_10052416	Ga0114129_100524163	329
59	3300027907	Ga0207428_10000082	Ga0207428_1000008223	329
60	3300039447	Ga0436361_0193092	Ga0436361_0193092_440_1498	329
61	3300050507	nmdc:mga05p37_19_c3	nmdc:mga05p37_19_c3_13465_14484	329
62	3300050508	nmdc:mga09592_758_c1	nmdc:mga09592_758_c1_12220_13239	329
63	3300050509	nmdc:mga0qj67_1779_c1	nmdc:mga0qj67_1779_c1_3549_4568	329
64	3300050510	nmdc:mga06r32_4145_c1	nmdc:mga06r32_4145_c1_364_1383	329
65	3300050511	nmdc:mga08y16_13453_c1	nmdc:mga08y16_13453_c1_4046_5065	329
66	3300050512	nmdc:mga0n895_1573_c1	nmdc:mga0n895_1573_c1_8579_9598	329
67	3300050513	nmdc:mga0rr50_390_c1	nmdc:mga0rr50_390_c1_11530_12549	329
68	3300050515	nmdc:mga0a205_681_c1	nmdc:mga0a205_681_c1_15520_16539	329
69	iso_pu_bacteria	2738541281	2738746337	329
70	iso_pu_bacteria	2738543032	2739355567	329
71	iso_pu_bacteria	2842698319	2842699847	329
72	iso_pu_bacteria	2861691609	2861692424	329
73	3300049822	Ga0501035_0002262	Ga0501035_0002262_7154_8203	330
74	iso_pu_bacteria	2829745981	2829748192	330
75	3300049581	Ga0501047_0230062	Ga0501047_0230062_428_1477	331
76	3300031456	Ga0307513_10004902	Ga0307513_100049029	332
77	3300050515	nmdc:mga0a205_139629_c1	nmdc:mga0a205_139629_c1_118_1146	332
78	3300010375	Ga0105239_10153723	Ga0105239_101537232	333
79	3300035242	Ga0373962_0005150	Ga0373962_0005150_1839_2891	333
80	3300035691	Ga0373931_0053081	Ga0373931_0053081_759_1811	333
81	3300039437	Ga0436365_1667560	Ga0436365_1667560_137_1174	333
82	3300053156	Ga0500622_0019980	Ga0500622_0019980_736_1767	333
83	3300005435	Ga0070714_100128772	Ga0070714_1001287723	334
84	3300014326	Ga0157380_10154977	Ga0157380_101549772	334
85	3300025929	Ga0207664_10112330	Ga0207664_101123302	334
86	3300006048	Ga0075363_100086741	Ga0075363_1000867412	335
87	3300006847	Ga0075431_100025713	Ga0075431_1000257135	335
88	3300009147	Ga0114129_10007220	Ga0114129_1000722015	335
89	3300009545	Ga0105237_10077900	Ga0105237_100779002	335
90	3300009551	Ga0105238_10089409	Ga0105238_100894092	335
91	3300025924	Ga0207694_10142722	Ga0207694_101427222	335
92	3300031251	Ga0265327_10000868	Ga0265327_1000086824	335
93	3300049569	Ga0501032_0003541	Ga0501032_0003541_10361_11401	335
94	3300049571	Ga0501034_0000068	Ga0501034_0000068_170069_171109	335
95	3300049571	Ga0501034_0201153	Ga0501034_0201153_615_1652	335
96	3300049572	Ga0501036_0042142	Ga0501036_0042142_784_1824	335
97	3300049573	Ga0501037_0004851	Ga0501037_0004851_1392_2432	335
98	3300049574	Ga0501038_0017782	Ga0501038_0017782_4056_5096	335
99	3300049575	Ga0501039_0000348	Ga0501039_0000348_3293_4333	335
100	3300049580	Ga0501046_0004718	Ga0501046_0004718_2681_3721	335
101	3300049581	Ga0501047_0001128	Ga0501047_0001128_5874_6914	335
102	3300049582	Ga0501048_0001283	Ga0501048_0001283_2677_3717	335
103	3300049582	Ga0501048_0063131	Ga0501048_0063131_1134_2174	335
104	3300049583	Ga0501067_0009532	Ga0501067_0009532_766_1806	335
105	3300049586	Ga0501070_0017193	Ga0501070_0017193_467_1507	335
106	3300049586	Ga0501070_0046623	Ga0501070_0046623_1632_2669	335
107	3300049587	Ga0501071_0048281	Ga0501071_0048281_719_1759	335
108	3300049588	Ga0501072_0023935	Ga0501072_0023935_1900_2940	335
109	3300049589	Ga0501073_0034806	Ga0501073_0034806_1963_3003	335
110	3300049591	Ga0501075_0030005	Ga0501075_0030005_1357_2397	335
111	3300049592	Ga0501076_0018225	Ga0501076_0018225_1134_2174	335
112	3300049741	Ga0501079_0019517	Ga0501079_0019517_1060_2100	335
113	3300049742	Ga0501080_0001093	Ga0501080_0001093_14549_15589	335
114	3300049822	Ga0501035_0000015	Ga0501035_0000015_22063_23103	335
115	3300049822	Ga0501035_0133725	Ga0501035_0133725_547_1584	335
116	3300049823	Ga0501044_0000026	Ga0501044_0000026_138116_139156	335
117	3300050507	nmdc:mga05p37_69462_c1	nmdc:mga05p37_69462_c1_1875_2915	335
118	3300050510	nmdc:mga06r32_38923_c1	nmdc:mga06r32_38923_c1_575_1615	335
119	3300053153	Ga0500616_0039575	Ga0500616_0039575_1057_2097	335
120	3300054114	Ga0501084_0033293	Ga0501084_0033293_1474_2514	335
121	3300060353	Ga0501082_0009135	Ga0501082_0009135_4696_5736	335
122	3300005347	Ga0070668_100011777	Ga0070668_1000117772	336
123	3300005367	Ga0070667_100398919	Ga0070667_1003989191	336
124	3300005548	Ga0070665_100000418	Ga0070665_10000041830	336
125	3300005843	Ga0068860_100000212	Ga0068860_10000021268	336
126	3300006847	Ga0075431_100026686	Ga0075431_1000266866	336
127	3300006880	Ga0075429_100361112	Ga0075429_1003611121	336
128	3300009094	Ga0111539_10404539	Ga0111539_104045392	336
129	3300025972	Ga0207668_10145425	Ga0207668_101454252	336
130	3300025986	Ga0207658_10277543	Ga0207658_102775431	336
131	3300028379	Ga0268266_10000003	Ga0268266_100000031155	336
132	3300028380	Ga0268265_10001421	Ga0268265_100014219	336
133	3300028381	Ga0268264_10000091	Ga0268264_10000091162	336
134	3300046674	Ga0495588_0140426	Ga0495588_0140426_83_1129	336
135	3300049590	Ga0501074_0037897	Ga0501074_0037897_1420_2463	336
136	3300049591	Ga0501075_0142561	Ga0501075_0142561_494_1537	336
137	3300049593	Ga0501077_0051018	Ga0501077_0051018_49_1092	336
138	3300049741	Ga0501079_0049195	Ga0501079_0049195_1840_2883	336
139	3300049742	Ga0501080_0080618	Ga0501080_0080618_1683_2726	336
140	3300049743	Ga0501081_0047237	Ga0501081_0047237_1710_2753	336
141	3300049744	Ga0501083_0033719	Ga0501083_0033719_1809_2852	336
142	3300049824	Ga0501045_0028363	Ga0501045_0028363_1886_2929	336
143	3300050508	nmdc:mga09592_135389_c2	nmdc:mga09592_135389_c2_75_1118	336
144	3300050510	nmdc:mga06r32_4928_c1	nmdc:mga06r32_4928_c1_5892_6935	336
145	3300050511	nmdc:mga08y16_306018_c1	nmdc:mga08y16_306018_c1_292_1338	336
146	3300054114	Ga0501084_0091947	Ga0501084_0091947_902_1945	336
147	3300060353	Ga0501082_0045474	Ga0501082_0045474_1712_2755	336
148	3300061734	Ga0530510_0032388	Ga0530510_0032388_2044_3087	336
149	3300003781	Ga0055536_1002406	Ga0055536_10024067	337
150	3300003791	Ga0055530_10003637	Ga0055530_100036372	337
151	3300003794	Ga0055531_10001551	Ga0055531_1000155114	337
152	3300005341	Ga0070691_10067799	Ga0070691_100677992	337
153	3300005347	Ga0070668_100003919	Ga0070668_1000039195	337
154	3300005347	Ga0070668_100116726	Ga0070668_1001167262	337
155	3300005441	Ga0070700_100028366	Ga0070700_1000283663	337
156	3300005444	Ga0070694_100002020	Ga0070694_1000020203	337
157	3300005445	Ga0070708_100050926	Ga0070708_1000509264	337
158	3300005455	Ga0070663_100081759	Ga0070663_1000817592	337
159	3300005458	Ga0070681_10012018	Ga0070681_100120186	337
160	3300005467	Ga0070706_100310420	Ga0070706_1003104202	337
161	3300005518	Ga0070699_100001391	Ga0070699_10000139112	337
162	3300005545	Ga0070695_100010639	Ga0070695_1000106393	337
163	3300005548	Ga0070665_100000691	Ga0070665_10000069143	337
164	3300005549	Ga0070704_100000778	Ga0070704_10000077811	337
165	3300005563	Ga0068855_100404718	Ga0068855_1004047182	337
166	3300005615	Ga0070702_100047382	Ga0070702_1000473821	337
167	3300005617	Ga0068859_100004561	Ga0068859_1000045617	337
168	3300005841	Ga0068863_100154088	Ga0068863_1001540882	337
169	3300005844	Ga0068862_100005310	Ga0068862_1000053108	337
170	3300005844	Ga0068862_100270618	Ga0068862_1002706182	337
171	3300006931	Ga0097620_100004561	Ga0097620_1000045617	337
172	3300009553	Ga0105249_10439916	Ga0105249_104399161	337
173	3300011119	Ga0105246_10033099	Ga0105246_100330993	337
174	3300025292	Ga0209676_1000262	Ga0209676_100026286	337
175	3300025298	Ga0209050_1000411	Ga0209050_100041181	337
176	3300025304	Ga0209257_1001169	Ga0209257_100116926	337
177	3300025912	Ga0207707_10023826	Ga0207707_100238263	337
178	3300025933	Ga0207706_10067095	Ga0207706_100670955	337
179	3300025961	Ga0207712_10272960	Ga0207712_102729602	337
180	3300025972	Ga0207668_10000019	Ga0207668_10000019113	337
181	3300025972	Ga0207668_10048828	Ga0207668_100488283	337
182	3300026035	Ga0207703_10236975	Ga0207703_102369752	337
183	3300026067	Ga0207678_10074671	Ga0207678_100746713	337
184	3300026075	Ga0207708_10005027	Ga0207708_100050273	337
185	3300026095	Ga0207676_10067705	Ga0207676_100677051	337
186	3300026116	Ga0207674_10004362	Ga0207674_1000436212	337
187	3300026118	Ga0207675_100077506	Ga0207675_1000775064	337
188	3300028379	Ga0268266_10000711	Ga0268266_1000071141	337
189	3300028380	Ga0268265_10002496	Ga0268265_100024967	337
190	3300028381	Ga0268264_10002241	Ga0268264_100022419	337
191	3300028800	Ga0265338_10045124	Ga0265338_100451245	337
192	3300031456	Ga0307513_10000873	Ga0307513_100008735	337
193	3300031730	Ga0307516_10000030	Ga0307516_10000030114	337
194	3300048904	Ga0496101_0036980	Ga0496101_0036980_858_1904	337
195	3300048905	Ga0496102_0012878	Ga0496102_0012878_184_1230	337
196	3300048912	Ga0496109_0090680	Ga0496109_0090680_496_1542	337
197	3300049582	Ga0501048_0126377	Ga0501048_0126377_739_1785	337
198	3300049588	Ga0501072_0358853	Ga0501072_0358853_26_1072	337
199	3300049591	Ga0501075_0348906	Ga0501075_0348906_40_1086	337
200	3300049743	Ga0501081_0027673	Ga0501081_0027673_1538_2584	337
201	3300050511	nmdc:mga08y16_482415_c1	nmdc:mga08y16_482415_c1_53_1099	337
202	3300053087	Ga0500643_000458	Ga0500643_000458_11374_12420	337
203	3300053087	Ga0500643_004895	Ga0500643_004895_451_1497	337
204	3300053087	Ga0500643_006333	Ga0500643_006333_32_1081	337
205	3300053096	Ga0500641_0015006	Ga0500641_0015006_1632_2678	337
206	3300053153	Ga0500616_0013961	Ga0500616_0013961_25_1071	337
207	3300053156	Ga0500622_0024569	Ga0500622_0024569_16_1062	337
208	3300053156	Ga0500622_0025932	Ga0500622_0025932_1834_2880	337
209	3300053730	Ga0500645_003040	Ga0500645_003040_1562_2608	337
210	3300053730	Ga0500645_015379	Ga0500645_015379_761_1807	337
211	3300060353	Ga0501082_0137028	Ga0501082_0137028_639_1685	337
212	3300061734	Ga0530510_0013907	Ga0530510_0013907_2977_4023	337
213	3300003781	Ga0055536_1002444	Ga0055536_10024447	338
214	3300003791	Ga0055530_10005875	Ga0055530_100058754	338
215	3300006847	Ga0075431_100004837	Ga0075431_10000483711	338
216	3300025292	Ga0209676_1000253	Ga0209676_100025377	338
217	3300025298	Ga0209050_1000948	Ga0209050_10009489	338
218	3300025303	Ga0209051_1002481	Ga0209051_10024812	338
219	3300025304	Ga0209257_1011938	Ga0209257_10119382	338
220	3300037312	Ga0395899_0000018	Ga0395899_0000018_156858_157901	338
221	3300045049	Ga0466959_0183253	Ga0466959_0183253_252_1295	338
222	3300048928	Ga0496125_0002080	Ga0496125_0002080_24502_25557	338
223	3300050507	nmdc:mga05p37_138220_c1	nmdc:mga05p37_138220_c1_845_1897	338
224	3300050509	nmdc:mga0qj67_2388_c1	nmdc:mga0qj67_2388_c1_1753_2805	338
225	3300050510	nmdc:mga06r32_1393_c1	nmdc:mga06r32_1393_c1_6910_7962	338
226	3300031456	Ga0307513_10015472	Ga0307513_100154727	339
227	3300005331	Ga0070670_100047898	Ga0070670_1000478982	340
228	3300005355	Ga0070671_100002736	Ga0070671_10000273618	340
229	3300005367	Ga0070667_100008242	Ga0070667_1000082425	340
230	3300005548	Ga0070665_100017881	Ga0070665_1000178817	340
231	3300005617	Ga0068859_100001582	Ga0068859_10000158213	340
232	3300005841	Ga0068863_100004097	Ga0068863_10000409714	340
233	3300005842	Ga0068858_100040198	Ga0068858_1000401981	340
234	3300005843	Ga0068860_100124911	Ga0068860_1001249112	340
235	3300005844	Ga0068862_100064297	Ga0068862_1000642972	340
236	3300006931	Ga0097620_100001582	Ga0097620_10000158217	340
237	3300009177	Ga0105248_10004488	Ga0105248_1000448815	340
238	3300014325	Ga0163163_10000780	Ga0163163_100007807	340
239	3300014968	Ga0157379_10000947	Ga0157379_1000094712	340
240	3300025925	Ga0207650_10075855	Ga0207650_100758552	340
241	3300025931	Ga0207644_10006266	Ga0207644_100062663	340
242	3300025941	Ga0207711_10005857	Ga0207711_100058575	340
243	3300025972	Ga0207668_10007726	Ga0207668_100077269	340
244	3300025986	Ga0207658_10006523	Ga0207658_100065238	340
245	3300026035	Ga0207703_10002213	Ga0207703_100022139	340
246	3300026088	Ga0207641_10001331	Ga0207641_100013318	340
247	3300028381	Ga0268264_10010714	Ga0268264_100107149	340
248	3300046459	Ga0495629_0157367	Ga0495629_0157367_284_1351	340
249	3300047673	Ga0495593_0036802	Ga0495593_0036802_1100_2167	340
250	3300048904	Ga0496101_0219213	Ga0496101_0219213_112_1161	340
251	3300053093	Ga0500651_0084378	Ga0500651_0084378_310_1377	340
252	3300053136	Ga0500559_0050065	Ga0500559_0050065_628_1695	340
253	3300053154	Ga0500619_050034	Ga0500619_050034_107_1174	340
254	3300005327	Ga0070658_10037444	Ga0070658_100374443	341
255	3300005339	Ga0070660_100027621	Ga0070660_1000276213	341
256	3300005366	Ga0070659_100008914	Ga0070659_1000089143	341
257	3300005458	Ga0070681_10002805	Ga0070681_100028056	341
258	3300005563	Ga0068855_100005017	Ga0068855_1000050176	341
259	3300005564	Ga0070664_100051683	Ga0070664_1000516833	341
260	3300005577	Ga0068857_100052533	Ga0068857_1000525334	341
261	3300014325	Ga0163163_10193127	Ga0163163_101931273	341
262	3300025912	Ga0207707_10010835	Ga0207707_100108356	341
263	3300025913	Ga0207695_10001415	Ga0207695_1000141532	341
264	3300025917	Ga0207660_10005342	Ga0207660_100053424	341
265	3300025919	Ga0207657_10011539	Ga0207657_1001153910	341
266	3300025921	Ga0207652_10019461	Ga0207652_100194612	341
267	3300025932	Ga0207690_10000898	Ga0207690_100008989	341
268	3300025932	Ga0207690_10013676	Ga0207690_100136762	341
269	3300025934	Ga0207686_10094227	Ga0207686_100942272	341
270	3300025945	Ga0207679_10037352	Ga0207679_100373522	341
271	3300025949	Ga0207667_10011376	Ga0207667_100113765	341
272	3300026116	Ga0207674_10046471	Ga0207674_100464712	341
273	3300028786	Ga0307517_10097555	Ga0307517_100975551	341
274	3300048918	Ga0496115_0000398	Ga0496115_0000398_4681_5739	341
275	iso_pu_bacteria	2510917020	2511125269	341
276	iso_pu_bacteria	2582581279	2585148870	341
277	iso_pu_bacteria	2582581280	2585152608	341
278	iso_pu_bacteria	2582581293	2585198811	341
279	iso_pu_bacteria	2585428106	2587917022	341
280	iso_pu_bacteria	2643221545	2643748944	341
281	iso_pu_bacteria	2643221552	2643780789	341
282	iso_pu_bacteria	2643221583	2643927035	341
283	iso_pu_bacteria	2643221584	2643930274	341
284	iso_pu_bacteria	2643221640	2644223774	341
285	iso_pu_bacteria	2643221642	2644236140	341
286	iso_pu_bacteria	2643221691	2644509297	341
287	iso_pu_bacteria	2791355048	2792460395	341
288	iso_pu_bacteria	2818991435	2819537622	341
289	iso_pu_bacteria	2818991454	2819647398	341
290	iso_pu_bacteria	2843744320	2843745083	341
291	iso_pu_bacteria	2849560528	2849564124	341
292	iso_pu_bacteria	2849573788	2849575563	341
293	iso_pu_bacteria	2851153111	2851155255	341
294	iso_pu_bacteria	2857504554	2857506168	341
295	iso_pu_bacteria	2884960567	2884963418	341
296	iso_pu_bacteria	2898329390	2898331128	341
297	iso_pu_bacteria	2928531327	2928534662	341
298	3300005339	Ga0070660_100356539	Ga0070660_1003565391	342
299	3300005341	Ga0070691_10024839	Ga0070691_100248392	342
300	3300005530	Ga0070679_100309248	Ga0070679_1003092482	342
301	3300005539	Ga0068853_100037066	Ga0068853_1000370662	342
302	3300013100	Ga0157373_10002536	Ga0157373_1000253615	342
303	3300025913	Ga0207695_10000837	Ga0207695_1000083749	342
304	3300025919	Ga0207657_10193650	Ga0207657_101936502	342
305	3300025921	Ga0207652_10050296	Ga0207652_100502964	342
306	3300035113	Ga0373936_0015109	Ga0373936_0015109_1555_2610	342
307	3300046616	Ga0495668_0000291	Ga0495668_0000291_64792_65847	342
308	3300046660	Ga0495625_0118180	Ga0495625_0118180_166_1221	342
309	3300049671	Ga0501238_012481	Ga0501238_012481_82_1137	342
310	3300053122	Ga0500608_000544	Ga0500608_000544_8109_9164	342
311	3300028800	Ga0265338_10051930	Ga0265338_100519303	343
312	3300029957	Ga0265324_10037009	Ga0265324_100370092	343
313	3300031251	Ga0265327_10002948	Ga0265327_100029489	343
314	3300053177	Ga0500636_0012543	Ga0500636_0012543_1368_2435	343
315	3300009177	Ga0105248_10001822	Ga0105248_100018228	344
316	3300025299	Ga0209256_1008430	Ga0209256_10084304	344
317	3300025941	Ga0207711_10010603	Ga0207711_100106034	344
318	3300046522	Ga0495643_0009780	Ga0495643_0009780_4153_5220	344
319	3300046538	Ga0495609_0031322	Ga0495609_0031322_990_2057	344
320	3300046542	Ga0495597_0006043	Ga0495597_0006043_322_1389	344
321	3300046557	Ga0495622_0040185	Ga0495622_0040185_514_1581	344
322	3300047443	Ga0495687_069460	Ga0495687_069460_135_1202	344
323	3300048906	Ga0496103_0075302	Ga0496103_0075302_139_1206	344
324	3300048919	Ga0496116_0037547	Ga0496116_0037547_1343_2410	344
325	3300048921	Ga0496118_0007030	Ga0496118_0007030_1455_2522	344
326	3300048922	Ga0496119_0040356	Ga0496119_0040356_1157_2224	344
327	3300048924	Ga0496121_0000042	Ga0496121_0000042_111897_112964	344
328	3300049460	Ga0495682_0018973	Ga0495682_0018973_903_1970	344
329	3300053092	Ga0500583_0024131	Ga0500583_0024131_673_1740	344
330	3300053119	Ga0500595_000555	Ga0500595_000555_19004_20071	344
331	3300053729	Ga0500625_019431	Ga0500625_019431_444_1511	344
332	3300003773	Ga0055537_1001344	Ga0055537_10013445	345
333	3300003790	Ga0055528_1002366	Ga0055528_10023666	345
334	3300003794	Ga0055531_10005886	Ga0055531_100058862	345
335	3300003794	Ga0055531_10006877	Ga0055531_100068772	345
336	3300005262	Ga0065165_1001181	Ga0065165_10011815	345
337	3300006186	Ga0075369_10002976	Ga0075369_100029762	345
338	3300006195	Ga0075366_10024808	Ga0075366_100248083	345
339	3300025263	Ga0209565_1001136	Ga0209565_10011363	345
340	3300025273	Ga0209673_1004604	Ga0209673_10046046	345
341	3300025291	Ga0209675_1010894	Ga0209675_10108943	345
342	3300025295	Ga0209564_1030256	Ga0209564_10302562	345
343	3300025297	Ga0209758_1000865	Ga0209758_100086546	345
344	3300025299	Ga0209256_1003405	Ga0209256_10034055	345
345	3300025304	Ga0209257_1000036	Ga0209257_100003691	345
346	3300028794	Ga0307515_10031603	Ga0307515_100316037	345
347	3300028794	Ga0307515_10041372	Ga0307515_100413725	345
348	3300042438	Ga0439459_0009508	Ga0439459_0009508_105_1169	345
349	3300046453	Ga0495627_002979	Ga0495627_002979_1694_2758	345
350	3300046457	Ga0495590_0000213	Ga0495590_0000213_7612_8676	345
351	3300046460	Ga0495638_0001702	Ga0495638_0001702_18269_19333	345
352	3300046460	Ga0495638_0002056	Ga0495638_0002056_2987_4051	345
353	3300046460	Ga0495638_0004768	Ga0495638_0004768_6530_7651	345
354	3300046460	Ga0495638_0005743	Ga0495638_0005743_5216_6280	345
355	3300046460	Ga0495638_0110768	Ga0495638_0110768_177_1241	345
356	3300046471	Ga0495650_0000046	Ga0495650_0000046_122690_123811	345
357	3300046506	Ga0495583_0000003	Ga0495583_0000003_179100_180164	345
358	3300046507	Ga0495606_0014307	Ga0495606_0014307_2788_3909	345
359	3300046512	Ga0495610_0000746	Ga0495610_0000746_15475_16668	345
360	3300046512	Ga0495610_0002406	Ga0495610_0002406_11882_12946	345
361	3300046512	Ga0495610_0002765	Ga0495610_0002765_10646_11767	345
362	3300046513	Ga0495616_0002861	Ga0495616_0002861_4743_5807	345
363	3300046518	Ga0495631_0009150	Ga0495631_0009150_714_1778	345
364	3300046520	Ga0495637_0027922	Ga0495637_0027922_1189_2253	345
365	3300046524	Ga0495648_0000391	Ga0495648_0000391_31390_32454	345
366	3300046524	Ga0495648_0061296	Ga0495648_0061296_1143_2207	345
367	3300046530	Ga0495654_0001027	Ga0495654_0001027_9845_10966	345
368	3300046616	Ga0495668_0011620	Ga0495668_0011620_2750_3814	345
369	3300046616	Ga0495668_0077620	Ga0495668_0077620_21_1085	345
370	3300046660	Ga0495625_0022110	Ga0495625_0022110_3020_4084	345
371	3300046660	Ga0495625_0025774	Ga0495625_0025774_1847_2968	345
372	3300046660	Ga0495625_0029582	Ga0495625_0029582_758_1822	345
373	3300046794	Ga0495589_0021315	Ga0495589_0021315_942_2006	345
374	3300046810	Ga0495660_0005950	Ga0495660_0005950_5333_6397	345
375	3300047320	Ga0495672_0003014	Ga0495672_0003014_3216_4337	345
376	3300047446	Ga0495679_008253	Ga0495679_008253_1495_2559	345
377	3300047469	Ga0495673_0000440	Ga0495673_0000440_15731_16795	345
378	3300047469	Ga0495673_0001073	Ga0495673_0001073_4504_5568	345
379	3300047472	Ga0495686_0006241	Ga0495686_0006241_2691_3755	345
380	3300047472	Ga0495686_0013829	Ga0495686_0013829_1772_2887	345
381	3300047472	Ga0495686_0016414	Ga0495686_0016414_1093_2286	345
382	3300047472	Ga0495686_0017329	Ga0495686_0017329_1065_2129	345
383	3300048904	Ga0496101_0193955	Ga0496101_0193955_124_1188	345
384	3300048909	Ga0496106_0011268	Ga0496106_0011268_1693_2757	345
385	3300048910	Ga0496107_0000028	Ga0496107_0000028_15868_16932	345
386	3300048918	Ga0496115_0003536	Ga0496115_0003536_6742_7806	345
387	3300048924	Ga0496121_0001627	Ga0496121_0001627_2389_3453	345
388	3300048924	Ga0496121_0093373	Ga0496121_0093373_1230_2294	345
389	3300048927	Ga0496124_0020387	Ga0496124_0020387_582_1646	345
390	3300048927	Ga0496124_0056210	Ga0496124_0056210_1179_2300	345
391	3300049459	Ga0495678_000563	Ga0495678_000563_17800_18864	345
392	3300050516	nmdc:mga0sz30_2212_c1	nmdc:mga0sz30_2212_c1_642_1706	345
393	3300053086	Ga0500578_0000077	Ga0500578_0000077_90380_91444	345
394	3300053088	Ga0500644_0001165	Ga0500644_0001165_2932_3996	345
395	3300053104	Ga0500556_0001964	Ga0500556_0001964_3522_4643	345
396	3300053118	Ga0500594_0000155	Ga0500594_0000155_15030_16094	345
397	3300053125	Ga0500618_000189	Ga0500618_000189_39452_40516	345
398	3300053134	Ga0500658_0002398	Ga0500658_0002398_5647_6768	345
399	3300053136	Ga0500559_0000004	Ga0500559_0000004_5986_7053	345
400	3300053136	Ga0500559_0000221	Ga0500559_0000221_29232_30296	345
401	3300053138	Ga0500564_000040	Ga0500564_000040_18499_19563	345
402	3300053153	Ga0500616_0042061	Ga0500616_0042061_1049_2170	345
403	3300053156	Ga0500622_0001074	Ga0500622_0001074_13131_14195	345
404	3300053156	Ga0500622_0028530	Ga0500622_0028530_1177_2241	345
405	3300053156	Ga0500622_0063496	Ga0500622_0063496_790_1854	345
406	3300053158	Ga0500627_0017420	Ga0500627_0017420_220_1341	345
407	3300053730	Ga0500645_001667	Ga0500645_001667_7783_8904	345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01018

GTP1_OBG

GTP1/OBG

4

150

0.99 PF01926

MMR_HSR1

50S ribosome-binding GTPase

153

273

0.89 PF02421

FeoB_N

Ferrous iron transport protein B

152

315

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7of7-assembly1.cif.gz_x	structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with mterf4-nsun4 and gtpbp5 (dataset1).	0.8098	5	147
7of7-assembly1.cif.gz_x	structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with mterf4-nsun4 and gtpbp5 (dataset1).	0.7794	5	147
2gjs-assembly2.cif.gz_B	the crystal structure of human rrad in complex with gdp	0.7674	153	322
1mky-assembly1.cif.gz_A	structural analysis of the domain interactions in der, a switch protein containing two gtpase domains	0.7648	153	323
7aoi-assembly1.cif.gz_XL	trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate	0.7449	150	327

ID	Description	Score	Start	End	Superfamily
af_K7K3X8_315_495_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8353	150	321	3.40.50.300
1lnzB02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8351	150	320	3.40.50.300
af_Q9VLN0_205_380_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8343	150	322	3.40.50.300
af_A0A1D6F3W0_466_646_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8342	150	330	3.40.50.300
5m04A02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8339	150	321	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A526YLT7-F1-model_v4	GTPase ObgE	0.9356	217	314	GO:0003924 GO:0005525
AF-A0A7U8KYS2-F1-model_v4	deleted	0.9127	217	327
AF-A0A349MAG8-F1-model_v4	GTPase ObgE	0.9025	205	324	GO:0003924 GO:0005525
AF-A0A526YLT7-F1-model_v4	GTPase ObgE	0.9005	217	314	GO:0003924 GO:0005525
AF-A0A831YDK7-F1-model_v4	GTPase ObgE	0.8845	3	118	GO:0003924 GO:0005525 GO:0042254

Feature Viewer

pLDDT	pTM	Quality
70.51	0.56	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F436488

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01018

GTP1_OBG

GTP1/OBG

4

150

0.99

PF01926

MMR_HSR1

50S ribosome-binding GTPase

153

273

0.89

PF02421

FeoB_N

Ferrous iron transport protein B

152

315

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map