F436344

General Info

Members Datasets Scaffolds Average Seq Length
406 247 336 318

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738541333|2739036397
Length 336
Sequence IMCLMLATASMTVATVASALPAQATTDVHEAPVPIHYRTAKIEGLEIFYREAGPADAPVVLLLHGFPTSSHMFRNLIPLLADRYHVIAPDYPGYGQSESPDRSKFAYTFGGVANIVDKLLDHLAVKSYAMYVMDYGAPVGYRLALKHPERISALIIQNGNAYDEGLKEFWDPIKTYWSDGAEKSREALSGLVTLETTKFQYTDGMEDVSRISPDNWVHDQALLDRPGNKDIQLDMLYDYRTXGNKDIQLDMLYDYRTNVPLYPDFQNFFRERKPPTLIVWGKNDYIFPEAGAHPYLKDLPDAEIHILNSGHFLLEEKLDVVAPLINDFLDRNIGKK

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
5 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
6 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
7 2519899620 Rhizobium sp. Pop5 Isolate Nodule
8 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
9 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
10 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
11 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
12 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
13 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
14 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
15 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
16 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
17 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
18 2643221599 Rhizobium sp. Root708 Isolate Unclassified
19 2718217882 Rhizobium sp. N741 Isolate Nodule
20 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
21 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
22 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
23 2718218363 Rhizobium sp. N113 Isolate Nodule
24 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
25 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
26 2728369365 Rhizobium sp. N1341 Isolate Nodule
27 2738541293 Rhizobium sp. GV031 Isolate Unclassified
28 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
29 2802429633 Rhizobium anhuiense J3 Isolate Nodule
30 2802429634 Rhizobium anhuiense S10 Isolate Nodule
31 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
32 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
33 2802429637 Rhizobium anhuiense C15 Isolate Nodule
34 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
35 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
36 2838048938 Rhizobium pisi 27/80 Isolate Nodule
37 2838061910 Rhizobium phaseoli L15 Isolate Nodule
38 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
39 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
40 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
41 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
42 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
43 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
44 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
45 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
46 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
47 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
48 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
49 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
50 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
51 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
52 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
53 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
54 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
55 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
56 2842711865 Duganella sp. R-73148 Isolate Unclassified
57 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
58 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
59 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
60 2936381700 Rhizobium chutanense C16 Isolate Unclassified
61 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
62 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
63 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
64 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
65 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
66 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
67 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
68 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
69 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
70 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
73 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
74 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
75 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
76 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
77 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
115 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
161 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
237 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
238 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
239 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
243 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
246 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
247 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.76
Metatranscriptomes 0
Isolates 17.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.28
Nodule 11.82
Rhizoplane 6.9
Rhizosphere 33.99
Stem 0
Stem Tuber 0
Unclassified 16.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000001 3300002773 Bacteria 224104
2 JGI25152J39213_1000712 3300002773 Bacteria 17238
3 JGI25152J39213_1001259 3300002773 Bacteria 11500
4 JGI25152J39213_1001485 3300002773 Bacteria 10020
5 JGI25152J39213_1007334 3300002773 Bacteria 2866
6 JGI25150J39212_1000007 3300002774 Bacteria 253635
7 JGI25150J39212_1006671 3300002774 Bacteria 2364
8 JGI25151J46595_10000013 3300003187 Bacteria 253635
9 JGI25151J46595_10000273 3300003187 Bacteria 59418
10 JGI25151J46595_10000725 3300003187 Bacteria 27425
11 JGI25151J46595_10015689 3300003187 Bacteria 3328
12 JGI25153J46596_10003637 3300003215 Bacteria 8542
13 JGI25153J46596_10007926 3300003215 Bacteria 5150
14 JGI25153J46596_10016130 3300003215 Bacteria 3010
15 JGI25160J50197_1004496 3300003354 Bacteria 6018
16 JGI25160J50197_1005888 3300003354 Bacteria 5038
17 JGI25161J50226_1000025 3300003374 Bacteria 148471
18 Ga0055542_1000060 3300003762 Bacteria 162275
19 Ga0055529_1000043 3300003763 Bacteria 221704
20 Ga0055526_1003039 3300003771 Bacteria 10909
21 Ga0055526_1003597 3300003771 Bacteria 9726
22 Ga0055526_1008056 3300003771 Bacteria 5322
23 Ga0055526_1012669 3300003771 Bacteria 3650
24 Ga0055524_1000327 3300003775 Bacteria 44413
25 Ga0055524_1002114 3300003775 Bacteria 10493
26 Ga0055524_1002158 3300003775 Bacteria 10352
27 Ga0055524_1016727 3300003775 Bacteria 2616
28 Ga0055528_1000207 3300003790 Bacteria 49794
29 Ga0055528_1000293 3300003790 Bacteria 42514
30 Ga0055528_1000673 3300003790 Bacteria 24747
31 Ga0055530_10020014 3300003791 Bacteria 2012
32 Ga0055540_1001774 3300003792 Bacteria 12298
33 Ga0055540_1008032 3300003792 Bacteria 3861
34 Ga0055540_1011573 3300003792 Bacteria 2833
35 Ga0055531_10006810 3300003794 Bacteria 6379
36 Ga0055543_1000021 3300004625 Bacteria 150116
37 Ga0065165_1004736 3300005262 Bacteria 8161
38 Ga0065165_1005684 3300005262 Bacteria 6873
39 Ga0065165_1013192 3300005262 Bacteria 3303
40 Ga0070671_100026626 3300005355 Bacteria 4754
41 Ga0070674_100315408 3300005356 Bacteria 1252
42 Ga0070686_100075353 3300005544 Bacteria 2219
43 Ga0070665_100012466 3300005548 Bacteria 8570
44 Ga0068855_100036373 3300005563 Bacteria 5861
45 Ga0068859_100351527 3300005617 Bacteria 1569
46 Ga0068851_10045719 3300005834 Bacteria 2213
47 Ga0068863_100025006 3300005841 Bacteria 5695
48 Ga0068858_100007527 3300005842 Bacteria 10527
49 Ga0068858_100120231 3300005842 Bacteria 2456
50 Ga0081540_1062507 3300005983 Bacteria 1768
51 Ga0075365_10024887 3300006038 Bacteria 3783
52 Ga0075365_10026530 3300006038 Bacteria 3678
53 Ga0075362_10009659 3300006177 Bacteria 3740
54 Ga0075362_10045029 3300006177 Bacteria 1959
55 Ga0075367_10045480 3300006178 Bacteria 2576
56 Ga0075367_10085209 3300006178 Bacteria 1917
57 Ga0075369_10026914 3300006186 Bacteria 2401
58 Ga0075369_10043365 3300006186 Bacteria 1930
59 Ga0075366_10022529 3300006195 Bacteria 3665
60 Ga0075428_100000506 3300006844 Bacteria 39571
61 Ga0075430_100003343 3300006846 Bacteria 13430
62 Ga0075431_100000343 3300006847 Bacteria 36664
63 Ga0075431_100117088 3300006847 Bacteria 2749
64 Ga0075429_100149380 3300006880 Bacteria 2046
65 Ga0099795_10017917 3300007788 Bacteria 2265
66 Ga0105244_10048647 3300009036 Bacteria 2169
67 Ga0105250_10032324 3300009092 Bacteria 2101
68 Ga0105240_10001626 3300009093 Bacteria 38125
69 Ga0105240_10131630 3300009093 Bacteria 3000
70 Ga0105247_10047752 3300009101 Bacteria 2629
71 Ga0105243_10014008 3300009148 Bacteria 6068
72 Ga0105248_10016476 3300009177 Bacteria 8135
73 Ga0105237_10011381 3300009545 Bacteria 9411
74 Ga0105237_10484457 3300009545 Bacteria 1243
75 Ga0105246_10175513 3300011119 Bacteria 1645
76 Ga0105246_10481060 3300011119 Bacteria 1050
77 Ga0157370_10000305 3300013104 Bacteria 61632
78 Ga0157369_10196657 3300013105 Bacteria 2117
79 Ga0157369_10391677 3300013105 Bacteria 1441
80 Ga0157378_10428975 3300013297 Bacteria 1308
81 Ga0163162_10289270 3300013306 Bacteria 1771
82 Ga0157375_10228119 3300013308 Bacteria 2021
83 Ga0163163_10156274 3300014325 Bacteria 2325
84 Ga0163163_10706190 3300014325 Bacteria 1072
85 Ga0157379_10119702 3300014968 Bacteria 2368
86 Ga0157379_10244630 3300014968 Bacteria 1627
87 Ga0214544_1000238 3300021320 Bacteria 90741
88 Ga0214542_1000244 3300021321 Bacteria 90727
89 Ga0213872_10013392 3300021361 Bacteria 3843
90 Ga0213872_10037737 3300021361 Bacteria 2206
91 Ga0213871_10010314 3300021441 Bacteria 2116
92 Ga0209563_100106 3300025230 Bacteria 146256
93 Ga0207425_1000032 3300025245 Bacteria 253689
94 Ga0207425_1001191 3300025245 Bacteria 11559
95 Ga0207425_1007317 3300025245 Bacteria 2924
96 Ga0209148_1000017 3300025254 Bacteria 787064
97 Ga0209129_1000016 3300025258 Bacteria 485491
98 Ga0209129_1000056 3300025258 Bacteria 253689
99 Ga0209129_1000347 3300025258 Bacteria 39276
100 Ga0209129_1000560 3300025258 Bacteria 25649
101 Ga0209129_1002310 3300025258 Bacteria 9466
102 Ga0209129_1002593 3300025258 Bacteria 8654
103 Ga0209565_1016435 3300025263 Bacteria 1645
104 Ga0209455_1000005 3300025272 Bacteria 1416756
105 Ga0209673_1000022 3300025273 Bacteria 413125
106 Ga0209673_1000162 3300025273 Bacteria 139078
107 Ga0209673_1001049 3300025273 Bacteria 31972
108 Ga0209673_1005141 3300025273 Bacteria 6693
109 Ga0209673_1009816 3300025273 Bacteria 4102
110 Ga0209673_1017892 3300025273 Bacteria 2598
111 Ga0209025_1000090 3300025294 Bacteria 253689
112 Ga0209025_1000530 3300025294 Bacteria 72703
113 Ga0209025_1001236 3300025294 Bacteria 35534
114 Ga0209025_1010165 3300025294 Bacteria 6420
115 Ga0209025_1011025 3300025294 Bacteria 6028
116 Ga0209564_1000163 3300025295 Bacteria 162077
117 Ga0209564_1000234 3300025295 Bacteria 121532
118 Ga0209564_1000571 3300025295 Bacteria 58425
119 Ga0209564_1000720 3300025295 Bacteria 47562
120 Ga0209564_1002151 3300025295 Bacteria 16647
121 Ga0209564_1003308 3300025295 Bacteria 11196
122 Ga0209758_1000084 3300025297 Bacteria 256346
123 Ga0209758_1000195 3300025297 Bacteria 133982
124 Ga0209758_1000514 3300025297 Bacteria 62177
125 Ga0209758_1008107 3300025297 Bacteria 6915
126 Ga0209758_1010583 3300025297 Bacteria 5494
127 Ga0209758_1012575 3300025297 Bacteria 4721
128 Ga0209758_1022601 3300025297 Bacteria 2874
129 Ga0209758_1037469 3300025297 Bacteria 1874
130 Ga0209050_1001179 3300025298 Bacteria 30818
131 Ga0209256_1000520 3300025299 Bacteria 56308
132 Ga0209256_1001398 3300025299 Bacteria 25156
133 Ga0209256_1002390 3300025299 Bacteria 15468
134 Ga0209256_1003646 3300025299 Bacteria 10543
135 Ga0209256_1006864 3300025299 Bacteria 5849
136 Ga0209256_1009285 3300025299 Bacteria 4340
137 Ga0207426_1002406 3300025302 Bacteria 12044
138 Ga0207426_1004235 3300025302 Bacteria 7128
139 Ga0209051_1000292 3300025303 Bacteria 80255
140 Ga0209051_1002385 3300025303 Bacteria 13549
141 Ga0209051_1016639 3300025303 Bacteria 3315
142 Ga0209051_1024647 3300025303 Bacteria 2467
143 Ga0209051_1049210 3300025303 Bacteria 1422
144 Ga0209257_1000428 3300025304 Bacteria 80856
145 Ga0207697_10072151 3300025315 Bacteria 1448
146 Ga0207656_10030302 3300025321 Bacteria 2234
147 Ga0207688_10089560 3300025901 Bacteria 1765
148 Ga0207647_10175639 3300025904 Bacteria 1246
149 Ga0207695_10000423 3300025913 Bacteria 93807
150 Ga0207671_10000148 3300025914 Bacteria 108473
151 Ga0207671_10004211 3300025914 Bacteria 13866
152 Ga0207671_10021011 3300025914 Bacteria 4961
153 Ga0207644_10189178 3300025931 Bacteria 1618
154 Ga0207709_10008140 3300025935 Bacteria 5805
155 Ga0207667_10018903 3300025949 Bacteria 7707
156 Ga0207667_10383982 3300025949 Bacteria 1431
157 Ga0207658_10101036 3300025986 Bacteria 2259
158 Ga0207703_10001084 3300026035 Bacteria 25907
159 Ga0207678_10148076 3300026067 Bacteria 2004
160 Ga0209179_1009950 3300027512 Bacteria 1645
161 Ga0209999_1008899 3300027543 Bacteria 1816
162 Ga0209971_1003544 3300027682 Bacteria 3689
163 Ga0268266_10190830 3300028379 Bacteria 1871
164 Ga0307517_10000008 3300028786 Bacteria 243202
165 Ga0307412_10380988 3300031911 Bacteria 1142
166 Ga0307416_100219963 3300032002 Bacteria 1820
167 Ga0307510_10038931 3300033180 Bacteria 5248
168 Ga0373953_0074113 3300035117 Bacteria 1408
169 Ga0373954_0028227 3300035118 Bacteria 2579
170 Ga0373937_0151959 3300036401 Bacteria 2169
171 Ga0436361_0170397 3300039447 Bacteria 12564
172 Ga0436361_0568167 3300039447 Bacteria 4062
173 Ga0436361_0843888 3300039447 Bacteria 2867
174 Ga0439465_0025567 3300041413 Bacteria 1864
175 Ga0451795_0034973 3300041456 Bacteria 1916
176 Ga0451802_0328342 3300041460 Bacteria 1501
177 Ga0451849_0629309 3300041505 Bacteria 5420
178 Ga0451851_0910284 3300041507 Bacteria 5095
179 Ga0439445_0013253 3300042004 Bacteria 1994
180 Ga0495638_0081683 3300046460 Bacteria 1962
181 Ga0495638_0141604 3300046460 Bacteria 1403
182 Ga0495641_0090359 3300046461 Bacteria 1368
183 Ga0495653_0334354 3300046463 Bacteria 978
184 Ga0495582_0160051 3300046473 Bacteria 1280
185 Ga0495584_0006837 3300046491 Bacteria 5959
186 Ga0495594_0236548 3300046499 Bacteria 1041
187 Ga0495607_0033370 3300046501 Bacteria 3132
188 Ga0495583_0004116 3300046506 Bacteria 10661
189 Ga0495583_0004521 3300046506 Bacteria 9913
190 Ga0495610_0000899 3300046512 Bacteria 27646
191 Ga0495610_0009044 3300046512 Bacteria 6354
192 Ga0495616_0005317 3300046513 Bacteria 7938
193 Ga0495620_0000509 3300046515 Bacteria 25242
194 Ga0495643_0000227 3300046522 Bacteria 85333
195 Ga0495648_0064839 3300046524 Bacteria 2150
196 Ga0495609_0000054 3300046538 Bacteria 147369
197 Ga0495609_0049071 3300046538 Bacteria 1885
198 Ga0495597_0000311 3300046542 Bacteria 43804
199 Ga0495597_0067362 3300046542 Bacteria 1549
200 Ga0495622_0000074 3300046557 Bacteria 87846
201 Ga0495633_0000360 3300046558 Bacteria 49094
202 Ga0495633_0051788 3300046558 Bacteria 1934
203 Ga0495633_0075315 3300046558 Bacteria 1572
204 Ga0495668_0000100 3300046616 Bacteria 137684
205 Ga0495668_0011585 3300046616 Bacteria 5272
206 Ga0495625_0004776 3300046660 Bacteria 12671
207 Ga0495625_0010847 3300046660 Bacteria 7492
208 Ga0495635_0287694 3300046663 Bacteria 1103
209 Ga0495661_0027402 3300046665 Bacteria 3658
210 Ga0495669_0001086 3300046684 Bacteria 11266
211 Ga0495649_0001277 3300046694 Bacteria 19351
212 Ga0495649_0006598 3300046694 Bacteria 7215
213 Ga0495636_0000911 3300047318 Bacteria 11002
214 Ga0495672_0000182 3300047320 Bacteria 91245
215 Ga0495676_0446692 3300047321 Bacteria 853
216 Ga0495683_0076832 3300047323 Bacteria 1633
217 Ga0495687_003269 3300047443 Bacteria 11941
218 Ga0495687_003787 3300047443 Bacteria 10678
219 Ga0495677_0001270 3300047445 Bacteria 10120
220 Ga0495685_000196 3300047447 Bacteria 20363
221 Ga0495681_0006298 3300047470 Bacteria 7820
222 Ga0495686_0000293 3300047472 Bacteria 87130
223 Ga0495593_0055362 3300047673 Bacteria 2088
224 Ga0496100_0012473 3300048903 Bacteria 4874
225 Ga0496100_0181851 3300048903 Bacteria 1521
226 Ga0496101_0000030 3300048904 Bacteria 198447
227 Ga0496101_0004546 3300048904 Bacteria 8759
228 Ga0496102_0020928 3300048905 Bacteria 5783
229 Ga0496102_0269973 3300048905 Bacteria 1604
230 Ga0496102_0301114 3300048905 Bacteria 1511
231 Ga0496103_0081596 3300048906 Bacteria 2034
232 Ga0496104_0001984 3300048907 Bacteria 17739
233 Ga0496104_0035219 3300048907 Bacteria 4674
234 Ga0496105_0000472 3300048908 Bacteria 26459
235 Ga0496105_0142022 3300048908 Bacteria 1976
236 Ga0496106_0008488 3300048909 Bacteria 7600
237 Ga0496106_0008885 3300048909 Bacteria 7426
238 Ga0496107_0007791 3300048910 Bacteria 7396
239 Ga0496109_0143290 3300048912 Bacteria 2235
240 Ga0496112_0002613 3300048915 Bacteria 14540
241 Ga0496113_0033240 3300048916 Bacteria 3755
242 Ga0496113_0211027 3300048916 Bacteria 1546
243 Ga0496113_0249781 3300048916 Bacteria 1416
244 Ga0496114_0003143 3300048917 Bacteria 12676
245 Ga0496114_0282244 3300048917 Bacteria 1464
246 Ga0496115_0007182 3300048918 Bacteria 8182
247 Ga0496115_0065903 3300048918 Bacteria 2926
248 Ga0496115_0333549 3300048918 Bacteria 1239
249 Ga0496116_0000649 3300048919 Bacteria 45467
250 Ga0496116_0000829 3300048919 Bacteria 39056
251 Ga0496116_0012029 3300048919 Bacteria 7100
252 Ga0496117_0019963 3300048920 Bacteria 5481
253 Ga0496117_0056653 3300048920 Bacteria 2728
254 Ga0496118_0002479 3300048921 Bacteria 24773
255 Ga0496118_0018018 3300048921 Bacteria 6395
256 Ga0496118_0019694 3300048921 Bacteria 6020
257 Ga0496118_0022889 3300048921 Bacteria 5446
258 Ga0496118_0044444 3300048921 Bacteria 3478
259 Ga0496118_0114468 3300048921 Bacteria 1778
260 Ga0496118_0181968 3300048921 Bacteria 1269
261 Ga0496119_0000685 3300048922 Bacteria 45308
262 Ga0496119_0009818 3300048922 Bacteria 8138
263 Ga0496119_0017630 3300048922 Bacteria 5362
264 Ga0496119_0117136 3300048922 Bacteria 1469
265 Ga0496120_0000294 3300048923 Bacteria 83826
266 Ga0496120_0002485 3300048923 Bacteria 18548
267 Ga0496120_0007541 3300048923 Bacteria 8076
268 Ga0496121_0002069 3300048924 Bacteria 31763
269 Ga0496121_0002123 3300048924 Bacteria 31151
270 Ga0496121_0017348 3300048924 Bacteria 7361
271 Ga0496121_0078102 3300048924 Bacteria 2633
272 Ga0496121_0091690 3300048924 Bacteria 2371
273 Ga0496121_0112675 3300048924 Bacteria 2072
274 Ga0496122_0009255 3300048925 Bacteria 10422
275 Ga0496122_0012181 3300048925 Bacteria 8601
276 Ga0496122_0035373 3300048925 Bacteria 4065
277 Ga0496123_0002488 3300048926 Bacteria 22744
278 Ga0496123_0012548 3300048926 Bacteria 7214
279 Ga0496123_0016448 3300048926 Bacteria 6007
280 Ga0496123_0074281 3300048926 Bacteria 2105
281 Ga0496124_0000754 3300048927 Bacteria 53087
282 Ga0496124_0002679 3300048927 Bacteria 22819
283 Ga0496124_0009557 3300048927 Bacteria 9964
284 Ga0496124_0040856 3300048927 Bacteria 4007
285 Ga0496124_0066241 3300048927 Bacteria 3008
286 Ga0496124_0071375 3300048927 Bacteria 2879
287 Ga0496124_0103394 3300048927 Bacteria 2304
288 Ga0496124_0220572 3300048927 Bacteria 1426
289 Ga0496124_0307024 3300048927 Bacteria 1143
290 Ga0496125_0001292 3300048928 Bacteria 37138
291 Ga0496125_0001780 3300048928 Bacteria 29771
292 Ga0496125_0002427 3300048928 Bacteria 24245
293 Ga0496125_0019956 3300048928 Bacteria 6302
294 Ga0496125_0035069 3300048928 Bacteria 4410
295 Ga0496125_0089641 3300048928 Bacteria 2312
296 Ga0496126_0069648 3300048929 Bacteria 3136
297 Ga0496126_0163339 3300048929 Bacteria 1902
298 Ga0496126_0171884 3300048929 Bacteria 1845
299 Ga0496126_0220732 3300048929 Bacteria 1592
300 Ga0495678_000147 3300049459 Bacteria 85326
301 Ga0495682_0002065 3300049460 Bacteria 9806
302 Ga0501076_0022570 3300049592 Bacteria 4838
303 Ga0501081_0221277 3300049743 Bacteria 1377
304 Ga0501083_0124983 3300049744 Bacteria 1686
305 nmdc:mga03683_573_c2 3300050489 Bacteria 10023
306 nmdc:mga03683_60218_c1 3300050489 Bacteria 1603
307 nmdc:mga03n38_3332_c1 3300050490 Bacteria 5143
308 nmdc:mga0yw44_12015_c1 3300050492 Bacteria 4496
309 nmdc:mga0yw44_9958_c1 3300050492 Bacteria 4834
310 nmdc:mga0k408_108197_c1 3300050493 Bacteria 1642
311 nmdc:mga0k408_3326_c1 3300050493 Bacteria 8506
312 nmdc:mga0k408_7767_c1 3300050493 Bacteria 5734
313 nmdc:mga06z11_25111_c1 3300050494 Bacteria 2820
314 nmdc:mga06z11_67485_c1 3300050494 Bacteria 1883
315 nmdc:mga07m45_30839_c1 3300050496 Bacteria 2971
316 nmdc:mga07m45_3237_c1 3300050496 Bacteria 7822
317 nmdc:mga07m45_86251_c1 3300050496 Bacteria 1796
318 nmdc:mga09592_193542_c1 3300050508 Bacteria 1760
319 nmdc:mga0qj67_2352_c1 3300050509 Bacteria 13459
320 nmdc:mga06r32_2493_c1 3300050510 Bacteria 16478
321 nmdc:mga06r32_77647_c1 3300050510 Bacteria 3226
322 nmdc:mga0rr50_418262_c1 3300050513 Bacteria 1134
323 nmdc:mga0sz30_75261_c1 3300050516 Bacteria 1457
324 nmdc:mga0sz30_88356_c1 3300050516 Bacteria 1347
325 Ga0500578_0058682 3300053086 Bacteria 2459
326 Ga0500556_0030292 3300053104 Bacteria 1832
327 Ga0500608_000008 3300053122 Bacteria 97962
328 Ga0500617_064087 3300053124 Bacteria 1622
329 Ga0500568_0001267 3300053139 Bacteria 16668
330 Ga0500604_0003863 3300053151 Bacteria 4006
331 Ga0500604_0012607 3300053151 Bacteria 2284
332 Ga0500622_0000522 3300053156 Bacteria 35691
333 Ga0500622_0004799 3300053156 Bacteria 8306
334 Ga0500633_0000441 3300053160 Bacteria 6539
335 Ga0500633_0014500 3300053160 Bacteria 2238
336 Ga0501082_0045659 3300060353 Bacteria 3778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035117 Ga0373953_0074113 Ga0373953_0074113_14_784 242
2 3300041460 Ga0451802_0328342 Ga0451802_0328342_708_1469 248
3 3300047321 Ga0495676_0446692 Ga0495676_0446692_56_829 248
4 3300050516 nmdc:mga0sz30_75261_c1 nmdc:mga0sz30_75261_c1_643_1404 248
5 3300036401 Ga0373937_0151959 Ga0373937_0151959_1360_2136 249
6 3300046463 Ga0495653_0334354 Ga0495653_0334354_197_955 249
7 3300046663 Ga0495635_0287694 Ga0495635_0287694_42_797 249
8 3300048929 Ga0496126_0163339 Ga0496126_0163339_62_817 249
9 3300046473 Ga0495582_0160051 Ga0495582_0160051_13_858 279
10 iso_pu_bacteria 8057568493 8057568868 280
11 3300005617 Ga0068859_100351527 Ga0068859_1003515272 286
12 3300005841 Ga0068863_100025006 Ga0068863_1000250062 286
13 3300005842 Ga0068858_100007527 Ga0068858_1000075279 286
14 3300009545 Ga0105237_10484457 Ga0105237_104844572 286
15 3300014968 Ga0157379_10119702 Ga0157379_101197022 286
16 3300025901 Ga0207688_10089560 Ga0207688_100895602 286
17 3300025914 Ga0207671_10021011 Ga0207671_100210115 286
18 3300025986 Ga0207658_10101036 Ga0207658_101010362 286
19 3300026035 Ga0207703_10001084 Ga0207703_100010847 286
20 3300048923 Ga0496120_0000294 Ga0496120_0000294_35812_36696 286
21 3300048928 Ga0496125_0001780 Ga0496125_0001780_15516_16400 286
22 3300021441 Ga0213871_10010314 Ga0213871_100103142 287
23 3300039447 Ga0436361_0843888 Ga0436361_0843888_1399_2289 287
24 3300009093 Ga0105240_10131630 Ga0105240_101316302 288
25 3300009148 Ga0105243_10014008 Ga0105243_100140082 288
26 3300013105 Ga0157369_10196657 Ga0157369_101966572 288
27 3300013105 Ga0157369_10391677 Ga0157369_103916771 288
28 3300014325 Ga0163163_10156274 Ga0163163_101562741 288
29 3300025315 Ga0207697_10072151 Ga0207697_100721512 288
30 3300025904 Ga0207647_10175639 Ga0207647_101756392 288
31 3300025935 Ga0207709_10008140 Ga0207709_100081408 288
32 3300027512 Ga0209179_1009950 Ga0209179_10099501 288
33 3300027543 Ga0209999_1008899 Ga0209999_10088993 288
34 3300027682 Ga0209971_1003544 Ga0209971_10035444 288
35 3300033180 Ga0307510_10038931 Ga0307510_100389314 288
36 3300035118 Ga0373954_0028227 Ga0373954_0028227_1621_2547 288
37 3300046660 Ga0495625_0004776 Ga0495625_0004776_3804_4694 288
38 3300048915 Ga0496112_0002613 Ga0496112_0002613_2658_3548 288
39 3300048916 Ga0496113_0033240 Ga0496113_0033240_425_1315 288
40 3300005983 Ga0081540_1062507 Ga0081540_10625071 289
41 3300007788 Ga0099795_10017917 Ga0099795_100179172 289
42 3300050513 nmdc:mga0rr50_418262_c1 nmdc:mga0rr50_418262_c1_133_1035 289
43 3300003792 Ga0055540_1001774 Ga0055540_100177410 290
44 3300003792 Ga0055540_1008032 Ga0055540_10080323 290
45 3300005356 Ga0070674_100315408 Ga0070674_1003154082 290
46 3300005544 Ga0070686_100075353 Ga0070686_1000753532 290
47 3300005563 Ga0068855_100036373 Ga0068855_1000363732 290
48 3300005842 Ga0068858_100120231 Ga0068858_1001202312 290
49 3300009101 Ga0105247_10047752 Ga0105247_100477522 290
50 3300009177 Ga0105248_10016476 Ga0105248_100164762 290
51 3300011119 Ga0105246_10175513 Ga0105246_101755132 290
52 3300013297 Ga0157378_10428975 Ga0157378_104289751 290
53 3300013306 Ga0163162_10289270 Ga0163162_102892702 290
54 3300013308 Ga0157375_10228119 Ga0157375_102281192 290
55 3300014325 Ga0163163_10706190 Ga0163163_107061901 290
56 3300014968 Ga0157379_10244630 Ga0157379_102446302 290
57 3300021361 Ga0213872_10037737 Ga0213872_100377372 290
58 3300025303 Ga0209051_1000292 Ga0209051_100029224 290
59 3300025914 Ga0207671_10004211 Ga0207671_1000421113 290
60 3300025949 Ga0207667_10018903 Ga0207667_100189037 290
61 3300026067 Ga0207678_10148076 Ga0207678_101480763 290
62 3300028379 Ga0268266_10190830 Ga0268266_101908302 290
63 3300039447 Ga0436361_0170397 Ga0436361_0170397_9827_10735 290
64 3300041456 Ga0451795_0034973 Ga0451795_0034973_89_976 290
65 3300042004 Ga0439445_0013253 Ga0439445_0013253_188_1063 290
66 3300046461 Ga0495641_0090359 Ga0495641_0090359_111_1010 290
67 3300046499 Ga0495594_0236548 Ga0495594_0236548_33_932 290
68 3300047673 Ga0495593_0055362 Ga0495593_0055362_63_962 290
69 3300048903 Ga0496100_0012473 Ga0496100_0012473_3745_4632 290
70 3300048904 Ga0496101_0004546 Ga0496101_0004546_3627_4514 290
71 3300048905 Ga0496102_0269973 Ga0496102_0269973_51_950 290
72 3300048907 Ga0496104_0001984 Ga0496104_0001984_12222_13109 290
73 3300048908 Ga0496105_0142022 Ga0496105_0142022_122_1009 290
74 3300048909 Ga0496106_0008885 Ga0496106_0008885_1895_2782 290
75 3300048910 Ga0496107_0007791 Ga0496107_0007791_5175_6062 290
76 3300048912 Ga0496109_0143290 Ga0496109_0143290_1085_1984 290
77 3300048917 Ga0496114_0003143 Ga0496114_0003143_1521_2408 290
78 3300048918 Ga0496115_0007182 Ga0496115_0007182_5571_6458 290
79 3300048918 Ga0496115_0333549 Ga0496115_0333549_199_1098 290
80 3300046460 Ga0495638_0081683 Ga0495638_0081683_403_1326 295
81 3300048922 Ga0496119_0000685 Ga0496119_0000685_3992_4966 295
82 3300048923 Ga0496120_0007541 Ga0496120_0007541_6346_7320 295
83 3300048924 Ga0496121_0002123 Ga0496121_0002123_8804_9778 295
84 3300048928 Ga0496125_0001292 Ga0496125_0001292_3909_4883 295
85 iso_pu_bacteria 8054302542 8054304614 296
86 3300048904 Ga0496101_0000030 Ga0496101_0000030_105194_106132 297
87 3300031911 Ga0307412_10380988 Ga0307412_103809882 300
88 3300048918 Ga0496115_0065903 Ga0496115_0065903_229_1431 302
89 3300049592 Ga0501076_0022570 Ga0501076_0022570_144_1169 303
90 3300049743 Ga0501081_0221277 Ga0501081_0221277_308_1333 303
91 3300006847 Ga0075431_100117088 Ga0075431_1001170882 304
92 3300006880 Ga0075429_100149380 Ga0075429_1001493802 304
93 3300032002 Ga0307416_100219963 Ga0307416_1002199633 304
94 3300050508 nmdc:mga09592_193542_c1 nmdc:mga09592_193542_c1_802_1749 304
95 3300050510 nmdc:mga06r32_77647_c1 nmdc:mga06r32_77647_c1_534_1481 304
96 3300053122 Ga0500608_000008 Ga0500608_000008_36382_37350 304
97 3300053156 Ga0500622_0004799 Ga0500622_0004799_2808_3776 304
98 3300048925 Ga0496122_0035373 Ga0496122_0035373_558_1529 305
99 3300048926 Ga0496123_0016448 Ga0496123_0016448_4244_5215 305
100 3300048927 Ga0496124_0307024 Ga0496124_0307024_127_1098 305
101 3300005548 Ga0070665_100012466 Ga0070665_1000124662 306
102 3300005834 Ga0068851_10045719 Ga0068851_100457192 306
103 3300006844 Ga0075428_100000506 Ga0075428_1000005068 306
104 3300006846 Ga0075430_100003343 Ga0075430_1000033439 306
105 3300006847 Ga0075431_100000343 Ga0075431_10000034316 306
106 3300009093 Ga0105240_10001626 Ga0105240_1000162624 306
107 3300009545 Ga0105237_10011381 Ga0105237_100113812 306
108 3300013104 Ga0157370_10000305 Ga0157370_1000030531 306
109 3300025321 Ga0207656_10030302 Ga0207656_100303023 306
110 3300025913 Ga0207695_10000423 Ga0207695_1000042328 306
111 3300025914 Ga0207671_10000148 Ga0207671_1000014841 306
112 3300025949 Ga0207667_10383982 Ga0207667_103839822 306
113 3300048905 Ga0496102_0020928 Ga0496102_0020928_4637_5614 306
114 3300048906 Ga0496103_0081596 Ga0496103_0081596_954_1931 306
115 3300048921 Ga0496118_0019694 Ga0496118_0019694_527_1504 306
116 3300048922 Ga0496119_0117136 Ga0496119_0117136_359_1327 306
117 3300048928 Ga0496125_0002427 Ga0496125_0002427_15675_16652 306
118 3300048929 Ga0496126_0069648 Ga0496126_0069648_346_1323 306
119 3300048929 Ga0496126_0171884 Ga0496126_0171884_395_1504 306
120 3300050509 nmdc:mga0qj67_2352_c1 nmdc:mga0qj67_2352_c1_2241_3194 306
121 3300050510 nmdc:mga06r32_2493_c1 nmdc:mga06r32_2493_c1_1492_2445 306
122 iso_pu_bacteria 2842341865 2842342277 306
123 3300046694 Ga0495649_0001277 Ga0495649_0001277_7564_8499 308
124 3300050496 nmdc:mga07m45_86251_c1 nmdc:mga07m45_86251_c1_557_1528 308
125 iso_pu_bacteria 2582581304 2585258938 308
126 3300025303 Ga0209051_1049210 Ga0209051_10492101 309
127 3300005262 Ga0065165_1013192 Ga0065165_10131924 310
128 3300006177 Ga0075362_10009659 Ga0075362_100096594 310
129 3300025297 Ga0209758_1022601 Ga0209758_10226013 310
130 3300046558 Ga0495633_0000360 Ga0495633_0000360_27383_28366 310
131 3300047472 Ga0495686_0000293 Ga0495686_0000293_60985_61932 310
132 3300011119 Ga0105246_10481060 Ga0105246_104810601 311
133 3300048920 Ga0496117_0056653 Ga0496117_0056653_1173_2108 311
134 3300048921 Ga0496118_0114468 Ga0496118_0114468_351_1286 311
135 3300048927 Ga0496124_0040856 Ga0496124_0040856_43_978 311
136 3300048928 Ga0496125_0089641 Ga0496125_0089641_195_1130 311
137 3300050489 nmdc:mga03683_60218_c1 nmdc:mga03683_60218_c1_493_1443 311
138 3300050492 nmdc:mga0yw44_12015_c1 nmdc:mga0yw44_12015_c1_1262_2212 311
139 3300050516 nmdc:mga0sz30_88356_c1 nmdc:mga0sz30_88356_c1_198_1148 311
140 iso_pu_bacteria 2599185236 2599723081 311
141 iso_pu_bacteria 2842711865 2842716629 311
142 iso_pu_bacteria 3005445848 3005452477 311
143 3300048916 Ga0496113_0249781 Ga0496113_0249781_247_1356 312
144 3300048919 Ga0496116_0012029 Ga0496116_0012029_1947_3056 312
145 3300048921 Ga0496118_0018018 Ga0496118_0018018_4892_6001 312
146 3300048922 Ga0496119_0017630 Ga0496119_0017630_945_2054 312
147 3300048923 Ga0496120_0002485 Ga0496120_0002485_8883_9992 312
148 3300048924 Ga0496121_0002069 Ga0496121_0002069_26365_27474 312
149 3300053151 Ga0500604_0003863 Ga0500604_0003863_1430_2392 313
150 3300003762 Ga0055542_1000060 Ga0055542_1000060122 314
151 3300003763 Ga0055529_1000043 Ga0055529_100004345 314
152 3300009092 Ga0105250_10032324 Ga0105250_100323242 314
153 3300025230 Ga0209563_100106 Ga0209563_100106124 314
154 3300025254 Ga0209148_1000017 Ga0209148_1000017270 314
155 3300025272 Ga0209455_1000005 Ga0209455_1000005270 314
156 3300041505 Ga0451849_0629309 Ga0451849_0629309_2392_3351 314
157 3300041507 Ga0451851_0910284 Ga0451851_0910284_956_1915 314
158 3300046506 Ga0495583_0004116 Ga0495583_0004116_4662_5621 314
159 3300046542 Ga0495597_0067362 Ga0495597_0067362_99_1058 314
160 3300046558 Ga0495633_0051788 Ga0495633_0051788_917_1876 314
161 3300047443 Ga0495687_003787 Ga0495687_003787_4908_5867 314
162 3300048905 Ga0496102_0301114 Ga0496102_0301114_390_1349 314
163 3300048907 Ga0496104_0035219 Ga0496104_0035219_1365_2324 314
164 3300048908 Ga0496105_0000472 Ga0496105_0000472_15689_16648 314
165 3300048916 Ga0496113_0211027 Ga0496113_0211027_17_976 314
166 3300048917 Ga0496114_0282244 Ga0496114_0282244_72_1031 314
167 3300048919 Ga0496116_0000649 Ga0496116_0000649_301_1281 314
168 3300048921 Ga0496118_0002479 Ga0496118_0002479_3182_4141 314
169 3300048921 Ga0496118_0181968 Ga0496118_0181968_161_1120 314
170 3300048922 Ga0496119_0009818 Ga0496119_0009818_2496_3455 314
171 3300048926 Ga0496123_0074281 Ga0496123_0074281_632_1591 314
172 3300048927 Ga0496124_0002679 Ga0496124_0002679_2839_3819 314
173 3300048927 Ga0496124_0066241 Ga0496124_0066241_1429_2388 314
174 3300048928 Ga0496125_0019956 Ga0496125_0019956_3893_4852 314
175 3300048929 Ga0496126_0220732 Ga0496126_0220732_402_1361 314
176 3300053124 Ga0500617_064087 Ga0500617_064087_485_1462 314
177 iso_pu_bacteria 2510917030 2511197573 314
178 iso_pu_bacteria 2599185170 2599416349 314
179 iso_pu_bacteria 2838035591 2838036467 314
180 iso_pu_bacteria 2842217011 2842223648 314
181 iso_pu_bacteria 2919100787 2919103424 314
182 3300028786 Ga0307517_10000008 Ga0307517_1000000872 315
183 3300046460 Ga0495638_0141604 Ga0495638_0141604_351_1322 315
184 3300046501 Ga0495607_0033370 Ga0495607_0033370_1365_2336 315
185 3300046506 Ga0495583_0004521 Ga0495583_0004521_6466_7437 315
186 3300046512 Ga0495610_0000899 Ga0495610_0000899_5909_6880 315
187 3300046522 Ga0495643_0000227 Ga0495643_0000227_6073_7044 315
188 3300046524 Ga0495648_0064839 Ga0495648_0064839_924_1895 315
189 3300046538 Ga0495609_0000054 Ga0495609_0000054_127049_128020 315
190 3300046538 Ga0495609_0049071 Ga0495609_0049071_427_1398 315
191 3300046542 Ga0495597_0000311 Ga0495597_0000311_10830_11801 315
192 3300046616 Ga0495668_0011585 Ga0495668_0011585_1366_2337 315
193 3300046665 Ga0495661_0027402 Ga0495661_0027402_1371_2342 315
194 3300047320 Ga0495672_0000182 Ga0495672_0000182_6072_7043 315
195 3300047447 Ga0495685_000196 Ga0495685_000196_4718_5689 315
196 3300049459 Ga0495678_000147 Ga0495678_000147_78283_79254 315
197 3300049460 Ga0495682_0002065 Ga0495682_0002065_4482_5453 315
198 3300053104 Ga0500556_0030292 Ga0500556_0030292_528_1511 315
199 iso_pu_bacteria 2509276021 2509390367 315
200 iso_pu_bacteria 2510917028 2511186612 315
201 iso_pu_bacteria 2513237162 2514021010 315
202 iso_pu_bacteria 2515154113 2515639350 315
203 iso_pu_bacteria 2519899620 2520377802 315
204 iso_pu_bacteria 2582581294 2585205191 315
205 iso_pu_bacteria 2582581308 2585282544 315
206 iso_pu_bacteria 2582581316 2585332949 315
207 iso_pu_bacteria 2582581867 2585404776 315
208 iso_pu_bacteria 2585427527 2585536227 315
209 iso_pu_bacteria 2585427530 2585557528 315
210 iso_pu_bacteria 2615840626 2616311655 315
211 iso_pu_bacteria 2643221599 2644002733 315
212 iso_pu_bacteria 2718217882 2719181386 315
213 iso_pu_bacteria 2718217997 2719667992 315
214 iso_pu_bacteria 2718218199 2720494755 315
215 iso_pu_bacteria 2718218233 2720617950 315
216 iso_pu_bacteria 2718218363 2721147547 315
217 iso_pu_bacteria 2721755556 2723029317 315
218 iso_pu_bacteria 2728369352 2730105631 315
219 iso_pu_bacteria 2728369365 2730164690 315
220 iso_pu_bacteria 2738541293 2738805048 315
221 iso_pu_bacteria 2738541333 2739033391 315
222 iso_pu_bacteria 2738541333 2739036397 315
223 iso_pu_bacteria 2802429633 2806046503 315
224 iso_pu_bacteria 2802429633 2806049295 315
225 iso_pu_bacteria 2802429634 2806055573 315
226 iso_pu_bacteria 2802429635 2806061401 315
227 iso_pu_bacteria 2802429636 2806068431 315
228 iso_pu_bacteria 2802429636 2806069922 315
229 iso_pu_bacteria 2802429637 2806078118 315
230 iso_pu_bacteria 2802429637 2806078122 315
231 iso_pu_bacteria 2818991453 2819642035 315
232 iso_pu_bacteria 2838048938 2838050489 315
233 iso_pu_bacteria 2838680041 2838682537 315
234 iso_pu_bacteria 2838694306 2838697108 315
235 iso_pu_bacteria 2838707686 2838709651 315
236 iso_pu_bacteria 2841864319 2841866304 315
237 iso_pu_bacteria 2842077413 2842077825 315
238 iso_pu_bacteria 2842118031 2842119667 315
239 iso_pu_bacteria 2842237096 2842239064 315
240 iso_pu_bacteria 2842291075 2842291487 315
241 iso_pu_bacteria 2842363717 2842365815 315
242 iso_pu_bacteria 2842370503 2842373104 315
243 iso_pu_bacteria 2842377471 2842377883 315
244 iso_pu_bacteria 2842384541 2842386176 315
245 iso_pu_bacteria 2842447887 2842453991 315
246 iso_pu_bacteria 2842521101 2842527412 315
247 iso_pu_bacteria 2923556063 2923560107 315
248 iso_pu_bacteria 2935894831 2935899026 315
249 iso_pu_bacteria 2936381700 2936385343 315
250 iso_pu_bacteria 3005416602 3005419377 315
251 iso_pu_bacteria 3005445848 3005451478 315
252 iso_pu_bacteria 8005570704 8005572508 315
253 3300009036 Ga0105244_10048647 Ga0105244_100486473 316
254 3300021361 Ga0213872_10013392 Ga0213872_100133922 316
255 3300039447 Ga0436361_0568167 Ga0436361_0568167_1357_2352 316
256 3300046491 Ga0495584_0006837 Ga0495584_0006837_2218_3192 316
257 3300046513 Ga0495616_0005317 Ga0495616_0005317_1714_2688 316
258 3300046557 Ga0495622_0000074 Ga0495622_0000074_12601_13575 316
259 3300046558 Ga0495633_0075315 Ga0495633_0075315_143_1117 316
260 3300046660 Ga0495625_0010847 Ga0495625_0010847_5636_6610 316
261 3300046684 Ga0495669_0001086 Ga0495669_0001086_4094_5068 316
262 3300046694 Ga0495649_0006598 Ga0495649_0006598_2771_3745 316
263 3300047318 Ga0495636_0000911 Ga0495636_0000911_7658_8632 316
264 3300047323 Ga0495683_0076832 Ga0495683_0076832_19_993 316
265 3300047443 Ga0495687_003269 Ga0495687_003269_2999_3973 316
266 3300047445 Ga0495677_0001270 Ga0495677_0001270_4611_5585 316
267 3300047470 Ga0495681_0006298 Ga0495681_0006298_2514_3488 316
268 3300053160 Ga0500633_0014500 Ga0500633_0014500_502_1569 316
269 3300002773 JGI25152J39213_1001485 JGI25152J39213_10014854 318
270 3300003215 JGI25153J46596_10007926 JGI25153J46596_100079264 318
271 3300003374 JGI25161J50226_1000025 JGI25161J50226_1000025118 318
272 3300003775 Ga0055524_1002158 Ga0055524_10021589 318
273 3300003791 Ga0055530_10020014 Ga0055530_100200142 318
274 3300003794 Ga0055531_10006810 Ga0055531_100068105 318
275 3300004625 Ga0055543_1000021 Ga0055543_100002177 318
276 3300005262 Ga0065165_1004736 Ga0065165_10047367 318
277 3300006186 Ga0075369_10026914 Ga0075369_100269142 318
278 3300025263 Ga0209565_1016435 Ga0209565_10164352 318
279 3300025273 Ga0209673_1017892 Ga0209673_10178922 318
280 3300025295 Ga0209564_1003308 Ga0209564_10033082 318
281 3300025297 Ga0209758_1010583 Ga0209758_10105834 318
282 3300025297 Ga0209758_1037469 Ga0209758_10374692 318
283 3300025298 Ga0209050_1001179 Ga0209050_100117921 318
284 3300025299 Ga0209256_1002390 Ga0209256_10023903 318
285 3300025303 Ga0209051_1024647 Ga0209051_10246473 318
286 3300025304 Ga0209257_1000428 Ga0209257_100042819 318
287 3300041413 Ga0439465_0025567 Ga0439465_0025567_92_1063 318
288 3300046512 Ga0495610_0009044 Ga0495610_0009044_4953_5924 318
289 3300046616 Ga0495668_0000100 Ga0495668_0000100_116355_117326 318
290 3300048903 Ga0496100_0181851 Ga0496100_0181851_366_1337 318
291 3300048909 Ga0496106_0008488 Ga0496106_0008488_3779_4750 318
292 3300048919 Ga0496116_0000829 Ga0496116_0000829_10795_11766 318
293 3300048920 Ga0496117_0019963 Ga0496117_0019963_124_1095 318
294 3300048921 Ga0496118_0022889 Ga0496118_0022889_70_1041 318
295 3300048921 Ga0496118_0044444 Ga0496118_0044444_2401_3372 318
296 3300048924 Ga0496121_0078102 Ga0496121_0078102_806_1777 318
297 3300048924 Ga0496121_0091690 Ga0496121_0091690_51_1022 318
298 3300048924 Ga0496121_0112675 Ga0496121_0112675_438_1430 318
299 3300048925 Ga0496122_0012181 Ga0496122_0012181_233_1204 318
300 3300048926 Ga0496123_0012548 Ga0496123_0012548_5964_6935 318
301 3300048927 Ga0496124_0000754 Ga0496124_0000754_51255_52226 318
302 3300048927 Ga0496124_0071375 Ga0496124_0071375_1273_2247 318
303 3300048927 Ga0496124_0103394 Ga0496124_0103394_51_1022 318
304 3300048928 Ga0496125_0035069 Ga0496125_0035069_1029_2000 318
305 3300053139 Ga0500568_0001267 Ga0500568_0001267_6325_7296 318
306 3300053151 Ga0500604_0012607 Ga0500604_0012607_744_1715 318
307 3300053156 Ga0500622_0000522 Ga0500622_0000522_28387_29358 318
308 3300053160 Ga0500633_0000441 Ga0500633_0000441_2623_3594 318
309 3300060353 Ga0501082_0045659 Ga0501082_0045659_35_1006 318
310 3300002773 JGI25152J39213_1000712 JGI25152J39213_100071213 319
311 3300002773 JGI25152J39213_1001259 JGI25152J39213_100125911 319
312 3300002773 JGI25152J39213_1007334 JGI25152J39213_10073342 319
313 3300002774 JGI25150J39212_1006671 JGI25150J39212_10066712 319
314 3300003187 JGI25151J46595_10000273 JGI25151J46595_100002737 319
315 3300003187 JGI25151J46595_10000725 JGI25151J46595_100007253 319
316 3300003187 JGI25151J46595_10015689 JGI25151J46595_100156892 319
317 3300003215 JGI25153J46596_10003637 JGI25153J46596_100036378 319
318 3300003354 JGI25160J50197_1004496 JGI25160J50197_10044963 319
319 3300003354 JGI25160J50197_1005888 JGI25160J50197_10058884 319
320 3300003771 Ga0055526_1003039 Ga0055526_10030395 319
321 3300003771 Ga0055526_1003597 Ga0055526_100359710 319
322 3300003771 Ga0055526_1008056 Ga0055526_10080563 319
323 3300003771 Ga0055526_1012669 Ga0055526_10126692 319
324 3300003775 Ga0055524_1000327 Ga0055524_100032719 319
325 3300003775 Ga0055524_1002114 Ga0055524_10021145 319
326 3300003775 Ga0055524_1016727 Ga0055524_10167271 319
327 3300003790 Ga0055528_1000207 Ga0055528_10002076 319
328 3300003790 Ga0055528_1000293 Ga0055528_100029326 319
329 3300003790 Ga0055528_1000673 Ga0055528_100067317 319
330 3300003792 Ga0055540_1011573 Ga0055540_10115732 319
331 3300005262 Ga0065165_1005684 Ga0065165_10056845 319
332 3300005355 Ga0070671_100026626 Ga0070671_1000266261 319
333 3300006038 Ga0075365_10024887 Ga0075365_100248875 319
334 3300006038 Ga0075365_10026530 Ga0075365_100265303 319
335 3300006177 Ga0075362_10045029 Ga0075362_100450291 319
336 3300006178 Ga0075367_10045480 Ga0075367_100454802 319
337 3300006178 Ga0075367_10085209 Ga0075367_100852092 319
338 3300006186 Ga0075369_10043365 Ga0075369_100433652 319
339 3300006195 Ga0075366_10022529 Ga0075366_100225293 319
340 3300021320 Ga0214544_1000238 Ga0214544_100023877 319
341 3300021321 Ga0214542_1000244 Ga0214542_100024416 319
342 3300025245 Ga0207425_1001191 Ga0207425_10011917 319
343 3300025245 Ga0207425_1007317 Ga0207425_10073172 319
344 3300025258 Ga0209129_1000016 Ga0209129_1000016239 319
345 3300025258 Ga0209129_1000347 Ga0209129_10003479 319
346 3300025258 Ga0209129_1002310 Ga0209129_10023102 319
347 3300025258 Ga0209129_1002593 Ga0209129_10025932 319
348 3300025273 Ga0209673_1000022 Ga0209673_1000022266 319
349 3300025273 Ga0209673_1000162 Ga0209673_1000162100 319
350 3300025273 Ga0209673_1001049 Ga0209673_100104926 319
351 3300025273 Ga0209673_1005141 Ga0209673_10051415 319
352 3300025273 Ga0209673_1009816 Ga0209673_10098162 319
353 3300025294 Ga0209025_1001236 Ga0209025_100123625 319
354 3300025294 Ga0209025_1010165 Ga0209025_10101654 319
355 3300025294 Ga0209025_1011025 Ga0209025_10110252 319
356 3300025295 Ga0209564_1000163 Ga0209564_100016316 319
357 3300025295 Ga0209564_1000234 Ga0209564_100023478 319
358 3300025295 Ga0209564_1000571 Ga0209564_100057126 319
359 3300025295 Ga0209564_1000720 Ga0209564_100072037 319
360 3300025295 Ga0209564_1002151 Ga0209564_10021518 319
361 3300025297 Ga0209758_1008107 Ga0209758_10081076 319
362 3300025297 Ga0209758_1012575 Ga0209758_10125754 319
363 3300025299 Ga0209256_1000520 Ga0209256_100052026 319
364 3300025299 Ga0209256_1001398 Ga0209256_100139816 319
365 3300025299 Ga0209256_1003646 Ga0209256_10036463 319
366 3300025299 Ga0209256_1006864 Ga0209256_10068645 319
367 3300025299 Ga0209256_1009285 Ga0209256_10092854 319
368 3300025302 Ga0207426_1002406 Ga0207426_10024069 319
369 3300025302 Ga0207426_1004235 Ga0207426_10042356 319
370 3300025303 Ga0209051_1002385 Ga0209051_100238512 319
371 3300025303 Ga0209051_1016639 Ga0209051_10166393 319
372 3300025931 Ga0207644_10189178 Ga0207644_101891781 319
373 3300048927 Ga0496124_0220572 Ga0496124_0220572_394_1368 319
374 3300050490 nmdc:mga03n38_3332_c1 nmdc:mga03n38_3332_c1_1151_2209 319
375 3300050492 nmdc:mga0yw44_9958_c1 nmdc:mga0yw44_9958_c1_1949_3007 319
376 3300050493 nmdc:mga0k408_3326_c1 nmdc:mga0k408_3326_c1_1680_2738 319
377 3300050494 nmdc:mga06z11_25111_c1 nmdc:mga06z11_25111_c1_1327_2385 319
378 3300050496 nmdc:mga07m45_30839_c1 nmdc:mga07m45_30839_c1_1172_2230 319
379 3300053086 Ga0500578_0058682 Ga0500578_0058682_1114_2088 319
380 3300003215 JGI25153J46596_10016130 JGI25153J46596_100161302 320
381 3300025245 Ga0207425_1000032 Ga0207425_100003236 320
382 3300025258 Ga0209129_1000056 Ga0209129_100005636 320
383 3300025294 Ga0209025_1000090 Ga0209025_100009036 320
384 3300025297 Ga0209758_1000084 Ga0209758_100008436 320
385 3300048924 Ga0496121_0017348 Ga0496121_0017348_315_1295 320
386 3300048925 Ga0496122_0009255 Ga0496122_0009255_3359_4339 320
387 3300048926 Ga0496123_0002488 Ga0496123_0002488_835_1815 320
388 3300048927 Ga0496124_0009557 Ga0496124_0009557_2794_3774 320
389 3300050493 nmdc:mga0k408_108197_c1 nmdc:mga0k408_108197_c1_427_1404 320
390 3300046515 Ga0495620_0000509 Ga0495620_0000509_3399_4385 323
391 iso_pu_bacteria 2842311132 2842316481 325
392 3300025258 Ga0209129_1000560 Ga0209129_100056019 327
393 3300025294 Ga0209025_1000530 Ga0209025_100053049 327
394 3300025297 Ga0209758_1000195 Ga0209758_100019533 327
395 3300025297 Ga0209758_1000514 Ga0209758_100051430 327
396 3300049744 Ga0501083_0124983 Ga0501083_0124983_217_1242 327
397 3300050489 nmdc:mga03683_573_c2 nmdc:mga03683_573_c2_4698_5750 327
398 3300050493 nmdc:mga0k408_7767_c1 nmdc:mga0k408_7767_c1_3188_4240 327
399 3300050494 nmdc:mga06z11_67485_c1 nmdc:mga06z11_67485_c1_294_1346 327
400 3300050496 nmdc:mga07m45_3237_c1 nmdc:mga07m45_3237_c1_4926_5978 327
401 iso_pu_bacteria 2842198810 2842202062 327
402 iso_pu_bacteria 2513237159 2514002009 332
403 iso_pu_bacteria 2838061910 2838063187 332
404 3300002773 JGI25152J39213_1000001 JGI25152J39213_1000001196 333
405 3300002774 JGI25150J39212_1000007 JGI25150J39212_100000736 333
406 3300003187 JGI25151J46595_10000013 JGI25151J46595_1000001337 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

58

318

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

60

324

0.56

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.9249 45 172
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.9195 45 169
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9109 45 172
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9096 45 172
4ns4-assembly1.cif.gz_A crystal structure of cold-active estarase from psychrobacter cryohalolentis k5t 0.8561 48 327
ID Description Score Start End Superfamily
af_P53750_3_288_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9785 47 325 3.40.50.1820
af_P53750_3_288_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9515 47 325 3.40.50.1820
af_P9WMS1_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8651 45 324 3.40.50.1820
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8605 46 161 3.40.50.12270
af_Q6P5P5_40_334_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8582 50 327 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2S9FGM7-F1-model_v4 Alpha/beta hydrolase 0.9982 46 170 GO:0004301
AF-A0A220S740-F1-model_v4 Hydrolase 0.9899 45 327 GO:0004301
AF-A0A521BE86-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9895 47 327 GO:0004301
AF-A0A162Z171-F1-model_v4 Hydrolase 0.9893 46 328 GO:0004301
AF-A0A1H6YCW8-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9875 47 330 GO:0004301

Feature Viewer

pLDDT pTM Quality
89.12 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map