F436341

General Info

Members Datasets Scaffolds Average Seq Length
406 213 402 149

Family's Representative Sequence

Representative Sequence 3300055283|Ga0500661_046302|Ga0500661_046302_128_670
Length 180
Sequence MREKQQYNGAATVAVFFYLSREKIVAPNSGVKSTSGFNAALRRKARHYAMQALYQWQISHNALRDIENQFRSEYDFTQVDLEFFQELLHQVPAQLGTLEETFSPYLDRPLKDLTPIELSLLRMGTYELANRIDVPFKVVINESVSLAKKFGAAESHKYINGVLDNVAKQLRGVEIAAEKR

Samples

Sample ID Description Type Environment
1 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
2 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
3 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
4 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
166 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
176 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
182 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
183 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
184 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
185 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
212 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
213 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0.49
Rhizoplane 2.46
Rhizosphere 92.12
Stem 0
Stem Tuber 0
Unclassified 3.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1029860 3300002073 Bacteria 656
2 rootH2_10303568 3300003320 Bacteria 3294
3 rootH1_10001451 3300003323 Bacteria 19518
4 rootH1_10025242 3300003323 Bacteria 17315
5 Ga0065715_10531600 3300005293 Bacteria 755
6 Ga0070658_10912298 3300005327 Bacteria 764
7 Ga0070676_10003255 3300005328 Bacteria 8430
8 Ga0070676_10027589 3300005328 Bacteria 3221
9 Ga0070676_10171819 3300005328 Bacteria 1403
10 Ga0070690_100066757 3300005330 Bacteria 2329
11 Ga0070670_100001861 3300005331 Bacteria 17194
12 Ga0070670_100733218 3300005331 Bacteria 890
13 Ga0068869_100000108 3300005334 Bacteria 39249
14 Ga0068869_100488478 3300005334 Bacteria 1026
15 Ga0070666_10064193 3300005335 Bacteria 2490
16 Ga0070666_10267564 3300005335 Bacteria 1213
17 Ga0070666_10326417 3300005335 Bacteria 1095
18 Ga0070666_10465956 3300005335 Bacteria 914
19 Ga0070682_100942328 3300005337 Bacteria 712
20 Ga0070682_101361434 3300005337 Bacteria 605
21 Ga0068868_100077515 3300005338 Bacteria 2659
22 Ga0068868_100330914 3300005338 Bacteria 1300
23 Ga0068868_101472790 3300005338 Bacteria 637
24 Ga0070660_100005400 3300005339 Bacteria 8847
25 Ga0070660_100096411 3300005339 Bacteria 2339
26 Ga0070689_100759530 3300005340 Bacteria 850
27 Ga0070687_100039944 3300005343 Bacteria 2361
28 Ga0070661_100001790 3300005344 Bacteria 14900
29 Ga0070661_100056801 3300005344 Bacteria 2868
30 Ga0070668_100012924 3300005347 Bacteria 6218
31 Ga0070669_100002544 3300005353 Bacteria 13184
32 Ga0070669_100241247 3300005353 Bacteria 1436
33 Ga0070669_100249411 3300005353 Bacteria 1413
34 Ga0070675_100182286 3300005354 Bacteria 1816
35 Ga0070675_100770247 3300005354 Bacteria 879
36 Ga0070671_100000025 3300005355 Bacteria 121912
37 Ga0070671_100000582 3300005355 Bacteria 25999
38 Ga0070671_100108840 3300005355 Bacteria 2327
39 Ga0070671_100313538 3300005355 Bacteria 1336
40 Ga0070674_100038687 3300005356 Bacteria 3217
41 Ga0070674_100289869 3300005356 Bacteria 1301
42 Ga0070674_100292402 3300005356 Bacteria 1296
43 Ga0070673_100002656 3300005364 Bacteria 10942
44 Ga0070673_100033668 3300005364 Bacteria 3872
45 Ga0070673_100552846 3300005364 Bacteria 1046
46 Ga0070659_100001088 3300005366 Bacteria 19812
47 Ga0070667_100000095 3300005367 Bacteria 109595
48 Ga0070667_100003815 3300005367 Bacteria 12806
49 Ga0070667_100020231 3300005367 Bacteria 5525
50 Ga0070667_100076944 3300005367 Bacteria 2849
51 Ga0070667_100542432 3300005367 Bacteria 1068
52 Ga0070667_101788584 3300005367 Bacteria 578
53 Ga0070703_10135093 3300005406 Bacteria 910
54 Ga0070709_10590261 3300005434 Bacteria 854
55 Ga0070663_100020141 3300005455 Bacteria 4413
56 Ga0070663_100045794 3300005455 Bacteria 3092
57 Ga0070663_100147587 3300005455 Bacteria 1801
58 Ga0070663_100312807 3300005455 Bacteria 1261
59 Ga0070678_100161469 3300005456 Bacteria 1816
60 Ga0070678_100456748 3300005456 Bacteria 1120
61 Ga0070678_100644690 3300005456 Bacteria 949
62 Ga0070662_100000134 3300005457 Bacteria 41711
63 Ga0070662_100389002 3300005457 Bacteria 1149
64 Ga0070662_100406587 3300005457 Bacteria 1124
65 Ga0070662_100588545 3300005457 Bacteria 935
66 Ga0068867_100006428 3300005459 Bacteria 8298
67 Ga0068867_100478434 3300005459 Bacteria 1066
68 Ga0070685_10000005 3300005466 Bacteria 190119
69 Ga0070679_100548302 3300005530 Bacteria 1100
70 Ga0068853_100000458 3300005539 Bacteria 27839
71 Ga0070672_100029477 3300005543 Bacteria 4116
72 Ga0070672_100148790 3300005543 Bacteria 1936
73 Ga0070672_100261819 3300005543 Bacteria 1459
74 Ga0070695_100074482 3300005545 Bacteria 2231
75 Ga0070693_100950793 3300005547 Bacteria 647
76 Ga0070665_100002661 3300005548 Bacteria 19422
77 Ga0070665_100003568 3300005548 Bacteria 16494
78 Ga0070665_100737748 3300005548 Bacteria 998
79 Ga0070704_100685936 3300005549 Bacteria 907
80 Ga0068855_100001419 3300005563 Bacteria 29756
81 Ga0068855_100002481 3300005563 Bacteria 22756
82 Ga0068855_100126098 3300005563 Bacteria 2927
83 Ga0070664_100100214 3300005564 Bacteria 2518
84 Ga0070664_100284539 3300005564 Bacteria 1491
85 Ga0070664_100391043 3300005564 Bacteria 1271
86 Ga0068857_100015058 3300005577 Bacteria 6750
87 Ga0068857_101119150 3300005577 Bacteria 761
88 Ga0068857_101434926 3300005577 Bacteria 672
89 Ga0068854_100114115 3300005578 Bacteria 2042
90 Ga0068854_100279425 3300005578 Bacteria 1344
91 Ga0068854_100516605 3300005578 Bacteria 1008
92 Ga0068856_100000265 3300005614 Bacteria 56919
93 Ga0068856_100048345 3300005614 Bacteria 4191
94 Ga0070702_100736703 3300005615 Bacteria 755
95 Ga0070702_100836032 3300005615 Bacteria 715
96 Ga0068852_100043384 3300005616 Bacteria 3815
97 Ga0068852_100050497 3300005616 Bacteria 3564
98 Ga0068859_100000217 3300005617 Bacteria 56968
99 Ga0068859_100006607 3300005617 Bacteria 11775
100 Ga0068864_100000073 3300005618 Bacteria 109681
101 Ga0068864_100001680 3300005618 Bacteria 18191
102 Ga0068864_100039293 3300005618 Bacteria 4044
103 Ga0068864_101669508 3300005618 Bacteria 642
104 Ga0068861_100004666 3300005719 Bacteria 9207
105 Ga0068861_100093225 3300005719 Bacteria 2381
106 Ga0068851_10015435 3300005834 Bacteria 3639
107 Ga0068851_10621126 3300005834 Bacteria 659
108 Ga0068870_10005304 3300005840 Bacteria 5619
109 Ga0068863_100003558 3300005841 Bacteria 15371
110 Ga0068863_100084046 3300005841 Bacteria 3017
111 Ga0068863_100528474 3300005841 Bacteria 1163
112 Ga0068858_100030245 3300005842 Bacteria 5029
113 Ga0068858_100213453 3300005842 Bacteria 1826
114 Ga0068860_100000326 3300005843 Bacteria 64692
115 Ga0068860_100006779 3300005843 Bacteria 11481
116 Ga0068860_101836976 3300005843 Bacteria 628
117 Ga0068862_100002886 3300005844 Bacteria 15044
118 Ga0068862_100026056 3300005844 Bacteria 4914
119 Ga0068862_101401844 3300005844 Bacteria 702
120 Ga0068871_101056690 3300006358 Bacteria 758
121 Ga0075428_100853361 3300006844 Bacteria 967
122 Ga0075434_100292389 3300006871 Bacteria 1649
123 Ga0075429_100294484 3300006880 Bacteria 1421
124 Ga0068865_100298701 3300006881 Bacteria 1288
125 Ga0097620_100000217 3300006931 Bacteria 56968
126 Ga0097620_100006607 3300006931 Bacteria 11775
127 Ga0097620_100311047 3300006931 Bacteria 1669
128 Ga0099826_10111354 3300006948 Bacteria 1631
129 Ga0075435_100250427 3300007076 Bacteria 1508
130 Ga0105240_10299047 3300009093 Bacteria 1841
131 Ga0105247_10028802 3300009101 Bacteria 3361
132 Ga0105243_10218135 3300009148 Bacteria 1684
133 Ga0105248_10032070 3300009177 Bacteria 5871
134 Ga0105248_10160606 3300009177 Bacteria 2535
135 Ga0105237_10168355 3300009545 Bacteria 2191
136 Ga0105237_10692743 3300009545 Bacteria 1025
137 Ga0105249_10025967 3300009553 Bacteria 5275
138 Ga0105249_10077855 3300009553 Bacteria 3076
139 Ga0105249_10170703 3300009553 Bacteria 2109
140 Ga0105249_10282214 3300009553 Bacteria 1659
141 Ga0105249_10586229 3300009553 Bacteria 1168
142 Ga0105239_10279941 3300010375 Bacteria 1878
143 Ga0105246_11443008 3300011119 Bacteria 644
144 Ga0157373_10000321 3300013100 Bacteria 38735
145 Ga0157371_10000470 3300013102 Bacteria 49205
146 Ga0157371_10273615 3300013102 Bacteria 1219
147 Ga0157369_10147643 3300013105 Bacteria 2486
148 Ga0157374_11407578 3300013296 Bacteria 720
149 Ga0163162_10030012 3300013306 Bacteria 5384
150 Ga0163162_10077697 3300013306 Bacteria 3384
151 Ga0157372_10002397 3300013307 Bacteria 20296
152 Ga0157372_10576586 3300013307 Bacteria 1311
153 Ga0157375_10024696 3300013308 Bacteria 5568
154 Ga0157375_11026341 3300013308 Bacteria 963
155 Ga0163163_10000230 3300014325 Bacteria 57639
156 Ga0157380_10185578 3300014326 Bacteria 1831
157 Ga0157377_10994578 3300014745 Bacteria 635
158 Ga0157379_10044181 3300014968 Bacteria 3977
159 Ga0157379_10501261 3300014968 Bacteria 1125
160 Ga0157376_10250795 3300014969 Bacteria 1653
161 Ga0157376_10652847 3300014969 Bacteria 1053
162 Ga0163161_10131233 3300017792 Bacteria 1890
163 Ga0213876_10451564 3300021384 Bacteria 684
164 Ga0207697_10167008 3300025315 Bacteria 961
165 Ga0207656_10012668 3300025321 Bacteria 3210
166 Ga0207653_10216066 3300025885 Bacteria 727
167 Ga0207682_10121292 3300025893 Bacteria 1160
168 Ga0207682_10132702 3300025893 Bacteria 1113
169 Ga0207642_10280723 3300025899 Bacteria 958
170 Ga0207642_10281908 3300025899 Bacteria 956
171 Ga0207710_10040533 3300025900 Bacteria 2064
172 Ga0207688_10032849 3300025901 Bacteria 2868
173 Ga0207688_10464825 3300025901 Bacteria 790
174 Ga0207688_10490315 3300025901 Bacteria 769
175 Ga0207680_10038805 3300025903 Bacteria 2759
176 Ga0207680_10158146 3300025903 Bacteria 1517
177 Ga0207680_10356208 3300025903 Bacteria 1028
178 Ga0207680_10548991 3300025903 Bacteria 825
179 Ga0207680_10591565 3300025903 Bacteria 793
180 Ga0207699_10423002 3300025906 Bacteria 952
181 Ga0207645_10007023 3300025907 Bacteria 8017
182 Ga0207645_10036113 3300025907 Bacteria 3173
183 Ga0207643_10009039 3300025908 Bacteria 5350
184 Ga0207671_10355407 3300025914 Bacteria 1162
185 Ga0207662_10273032 3300025918 Bacteria 1116
186 Ga0207657_10008703 3300025919 Bacteria 10274
187 Ga0207657_10082465 3300025919 Bacteria 2699
188 Ga0207649_10130943 3300025920 Bacteria 1703
189 Ga0207652_10123760 3300025921 Bacteria 2303
190 Ga0207681_10000156 3300025923 Bacteria 56382
191 Ga0207681_10013098 3300025923 Bacteria 5127
192 Ga0207681_10200969 3300025923 Bacteria 1530
193 Ga0207681_10239049 3300025923 Bacteria 1413
194 Ga0207650_10000106 3300025925 Bacteria 110058
195 Ga0207650_10003583 3300025925 Bacteria 10654
196 Ga0207650_10658782 3300025925 Bacteria 883
197 Ga0207650_10679100 3300025925 Bacteria 869
198 Ga0207659_10021820 3300025926 Bacteria 4258
199 Ga0207687_10140861 3300025927 Bacteria 1829
200 Ga0207644_10000049 3300025931 Bacteria 95260
201 Ga0207644_10003130 3300025931 Bacteria 10655
202 Ga0207644_10250135 3300025931 Bacteria 1414
203 Ga0207690_10000395 3300025932 Bacteria 28806
204 Ga0207706_10000002 3300025933 Bacteria 360309
205 Ga0207706_10142290 3300025933 Bacteria 2110
206 Ga0207706_10222933 3300025933 Bacteria 1651
207 Ga0207686_10486652 3300025934 Bacteria 955
208 Ga0207670_10173467 3300025936 Bacteria 1619
209 Ga0207669_10005777 3300025937 Bacteria 5588
210 Ga0207669_10051451 3300025937 Bacteria 2468
211 Ga0207669_10275576 3300025937 Bacteria 1266
212 Ga0207704_10170566 3300025938 Bacteria 1560
213 Ga0207704_10682079 3300025938 Bacteria 849
214 Ga0207691_10039009 3300025940 Bacteria 4395
215 Ga0207691_10077169 3300025940 Bacteria 3002
216 Ga0207691_10116273 3300025940 Bacteria 2374
217 Ga0207691_10268973 3300025940 Bacteria 1468
218 Ga0207691_10400183 3300025940 Bacteria 1171
219 Ga0207711_10001196 3300025941 Bacteria 24599
220 Ga0207711_10016430 3300025941 Bacteria 6151
221 Ga0207689_10000030 3300025942 Bacteria 97584
222 Ga0207689_10744547 3300025942 Bacteria 827
223 Ga0207679_10001203 3300025945 Bacteria 16448
224 Ga0207679_10046161 3300025945 Bacteria 3156
225 Ga0207679_10491869 3300025945 Bacteria 1093
226 Ga0207667_10002085 3300025949 Bacteria 25050
227 Ga0207667_10002263 3300025949 Bacteria 24190
228 Ga0207667_10113627 3300025949 Bacteria 2792
229 Ga0207667_10366496 3300025949 Bacteria 1469
230 Ga0207651_10000744 3300025960 Bacteria 13955
231 Ga0207651_10014965 3300025960 Bacteria 4494
232 Ga0207651_10542833 3300025960 Bacteria 1010
233 Ga0207712_10010093 3300025961 Bacteria 5988
234 Ga0207712_10052270 3300025961 Bacteria 2861
235 Ga0207712_10118546 3300025961 Bacteria 1998
236 Ga0207712_10205056 3300025961 Bacteria 1566
237 Ga0207712_10418266 3300025961 Bacteria 1130
238 Ga0207668_10014281 3300025972 Bacteria 4914
239 Ga0207668_10225941 3300025972 Bacteria 1506
240 Ga0207668_10338942 3300025972 Bacteria 1253
241 Ga0207668_10398488 3300025972 Bacteria 1163
242 Ga0207640_10010032 3300025981 Bacteria 5321
243 Ga0207640_10126682 3300025981 Bacteria 1839
244 Ga0207658_10000073 3300025986 Bacteria 111738
245 Ga0207658_10067229 3300025986 Bacteria 2699
246 Ga0207658_10184701 3300025986 Bacteria 1728
247 Ga0207658_10291982 3300025986 Bacteria 1401
248 Ga0207658_10376451 3300025986 Bacteria 1242
249 Ga0207677_10061755 3300026023 Bacteria 2596
250 Ga0207677_10707715 3300026023 Bacteria 894
251 Ga0207677_11217889 3300026023 Bacteria 689
252 Ga0207703_10002181 3300026035 Bacteria 17180
253 Ga0207703_10080975 3300026035 Bacteria 2705
254 Ga0207703_10441012 3300026035 Bacteria 1215
255 Ga0207639_10001640 3300026041 Bacteria 15075
256 Ga0207678_10003781 3300026067 Bacteria 13610
257 Ga0207678_10213759 3300026067 Bacteria 1650
258 Ga0207678_10354007 3300026067 Bacteria 1266
259 Ga0207678_10452064 3300026067 Bacteria 1117
260 Ga0207708_11400925 3300026075 Bacteria 613
261 Ga0207702_10000810 3300026078 Bacteria 33176
262 Ga0207702_10022175 3300026078 Bacteria 5263
263 Ga0207641_10007204 3300026088 Bacteria 9272
264 Ga0207641_10022040 3300026088 Bacteria 5238
265 Ga0207641_10206717 3300026088 Bacteria 1813
266 Ga0207641_10242640 3300026088 Unclassified 1679
267 Ga0207648_10011609 3300026089 Bacteria 8294
268 Ga0207648_10029102 3300026089 Bacteria 4898
269 Ga0207648_10130265 3300026089 Bacteria 2214
270 Ga0207676_10000010 3300026095 Bacteria 519402
271 Ga0207676_10304745 3300026095 Bacteria 1456
272 Ga0207674_10264169 3300026116 Bacteria 1668
273 Ga0207674_11304059 3300026116 Bacteria 695
274 Ga0207675_100000852 3300026118 Bacteria 30393
275 Ga0207675_100104516 3300026118 Bacteria 2669
276 Ga0207675_100433709 3300026118 Bacteria 1300
277 Ga0207683_10038714 3300026121 Bacteria 4158
278 Ga0207683_10049980 3300026121 Bacteria 3661
279 Ga0207683_10252029 3300026121 Bacteria 1611
280 Ga0207683_10455426 3300026121 Bacteria 1180
281 Ga0207698_10042011 3300026142 Bacteria 3412
282 Ga0207698_10572340 3300026142 Bacteria 1110
283 Ga0209281_1018539 3300027111 Bacteria 1389
284 Ga0209983_1005806 3300027665 Bacteria 2549
285 Ga0209974_10021246 3300027876 Bacteria 2149
286 Ga0207428_10356015 3300027907 Bacteria 1076
287 Ga0268266_10022816 3300028379 Bacteria 5327
288 Ga0268266_11166705 3300028379 Bacteria 745
289 Ga0268266_11745085 3300028379 Bacteria 597
290 Ga0268265_10003355 3300028380 Bacteria 11563
291 Ga0268265_10042309 3300028380 Bacteria 3379
292 Ga0268265_10187093 3300028380 Bacteria 1785
293 Ga0268264_10000123 3300028381 Bacteria 189361
294 Ga0268264_10025783 3300028381 Bacteria 4801
295 Ga0268264_10237766 3300028381 Bacteria 1686
296 Ga0268264_11289102 3300028381 Bacteria 741
297 Ga0265332_10327927 3300031238 Bacteria 632
298 Ga0265331_10169709 3300031250 Unclassified 987
299 Ga0265327_10000094 3300031251 Bacteria 195099
300 Ga0307513_10558015 3300031456 Bacteria 857
301 Ga0307408_100000192 3300031548 Bacteria 65993
302 Ga0307408_100015800 3300031548 Bacteria 5030
303 Ga0316579_10249930 3300031691 Bacteria 858
304 Ga0316576_10215957 3300031727 Bacteria 1443
305 Ga0316576_10524532 3300031727 Bacteria 870
306 Ga0316576_10595747 3300031727 Bacteria 807
307 Ga0316576_10755572 3300031727 Bacteria 702
308 Ga0307405_10002481 3300031731 Bacteria 8146
309 Ga0307405_10768660 3300031731 Bacteria 804
310 Ga0316577_10331073 3300031733 Bacteria 864
311 Ga0307413_10005033 3300031824 Bacteria 5837
312 Ga0307413_10069433 3300031824 Bacteria 2211
313 Ga0307413_10095738 3300031824 Bacteria 1947
314 Ga0307410_10007305 3300031852 Bacteria 6037
315 Ga0307410_10136031 3300031852 Bacteria 1812
316 Ga0307406_10001571 3300031901 Bacteria 12584
317 Ga0307406_10017922 3300031901 Bacteria 4131
318 Ga0307406_10088287 3300031901 Bacteria 2080
319 Ga0307407_10000698 3300031903 Bacteria 10903
320 Ga0307407_10191206 3300031903 Bacteria 1364
321 Ga0307407_11205757 3300031903 Bacteria 591
322 Ga0307412_10021547 3300031911 Bacteria 3938
323 Ga0307409_100005474 3300031995 Bacteria 7317
324 Ga0307409_100019629 3300031995 Bacteria 4583
325 Ga0307409_100159059 3300031995 Bacteria 1973
326 Ga0307409_100184609 3300031995 Bacteria 1850
327 Ga0307416_100013567 3300032002 Bacteria 5545
328 Ga0307416_100232235 3300032002 Bacteria 1779
329 Ga0307416_102980361 3300032002 Bacteria 566
330 Ga0307414_10029227 3300032004 Bacteria 3585
331 Ga0307414_10080652 3300032004 Bacteria 2380
332 Ga0307411_10000867 3300032005 Bacteria 11397
333 Ga0307411_10648647 3300032005 Bacteria 914
334 Ga0307411_10715437 3300032005 Bacteria 874
335 Ga0307411_10720312 3300032005 Bacteria 871
336 Ga0307415_100009857 3300032126 Bacteria 5383
337 Ga0307415_100099231 3300032126 Bacteria 2131
338 Ga0316585_10266538 3300032137 Bacteria 568
339 Ga0316580_10096741 3300032139 Bacteria 904
340 Ga0316580_10105252 3300032139 Bacteria 864
341 Ga0373955_0681664 3300035172 Bacteria 631
342 Ga0373961_0212617 3300035241 Bacteria 686
343 Ga0316574_0065044 3300035398 Bacteria 2295
344 Ga0316574_0079477 3300035398 Bacteria 2080
345 Ga0316574_0302312 3300035398 Bacteria 1017
346 Ga0373931_0531206 3300035691 Bacteria 762
347 Ga0373937_0266350 3300036401 Bacteria 1617
348 Ga0316582_0072515 3300036647 Bacteria 2232
349 Ga0316582_0181438 3300036647 Bacteria 1432
350 Ga0316582_0412322 3300036647 Bacteria 931
351 Ga0316582_0418514 3300036647 Bacteria 923
352 Ga0316582_0660438 3300036647 Bacteria 719
353 Ga0316584_0016769 3300036712 Bacteria 5255
354 Ga0316584_0060045 3300036712 Bacteria 2847
355 Ga0316584_0075231 3300036712 Bacteria 2531
356 Ga0316584_0202763 3300036712 Bacteria 1463
357 Ga0395900_1001327 3300037418 Bacteria 756
358 Ga0316581_0002317 3300037588 Bacteria 4523
359 Ga0400483_028483 3300039062 Bacteria 154566
360 Ga0400483_029989 3300039062 Bacteria 58053
361 Ga0400483_077867 3300039062 Bacteria 2043
362 Ga0400483_151143 3300039062 Bacteria 268199
363 Ga0400483_242281 3300039062 Bacteria 55044
364 Ga0436365_0115737 3300039437 Bacteria 3142
365 Ga0451797_0799138 3300041453 Bacteria 1561
366 Ga0451802_1835745 3300041460 Bacteria 1063
367 Ga0451807_0832178 3300041486 Bacteria 2043
368 Ga0451833_0042069 3300041491 Bacteria 757
369 Ga0451851_0565157 3300041507 Bacteria 675
370 Ga0451843_1202550 3300041509 Bacteria 953
371 Ga0439432_133216 3300042006 Bacteria 733
372 Ga0450914_000785 3300042118 Bacteria 1703
373 Ga0439435_0189397 3300042436 Bacteria 674
374 Ga0451577_0111952 3300042876 Bacteria 2442
375 Ga0451577_0283774 3300042876 Bacteria 1500
376 Ga0453684_0373300 3300044712 Bacteria 1603
377 Ga0495630_0277749 3300046517 Bacteria 1280
378 Ga0495587_0562797 3300046536 Bacteria 629
379 Ga0495598_0116272 3300046537 Bacteria 902
380 Ga0495621_0027977 3300046539 Bacteria 1914
381 Ga0495668_0491986 3300046616 Bacteria 676
382 Ga0495634_0336190 3300046642 Bacteria 907
383 Ga0495680_0082739 3300047322 Bacteria 2422
384 Ga0495680_0121387 3300047322 Unclassified 1929
385 Ga0496101_0045751 3300048904 Bacteria 3136
386 Ga0496102_0001905 3300048905 Bacteria 17998
387 Ga0496103_0250998 3300048906 Bacteria 1138
388 Ga0496106_0000553 3300048909 Bacteria 26612
389 Ga0496107_0007756 3300048910 Bacteria 7416
390 Ga0496109_0595386 3300048912 Bacteria 1042
391 Ga0496113_0594655 3300048916 Bacteria 886
392 Ga0496124_0007877 3300048927 Bacteria 11222
393 Ga0496125_0050172 3300048928 Bacteria 3458
394 Ga0501290_006225 3300049513 Bacteria 1494
395 Ga0501034_0942433 3300049571 Bacteria 749
396 Ga0501275_000535 3300049772 Bacteria 4274
397 nmdc:mga0n895_173694_c1 3300050512 Bacteria 2186
398 nmdc:mga0rr50_323023_c1 3300050513 Bacteria 1294
399 Ga0500595_013196 3300053119 Bacteria 3169
400 Ga0500617_201809 3300053124 Bacteria 728
401 Ga0500588_0000119 3300053146 Bacteria 10440
402 Ga0500661_046302 3300055283 Bacteria 773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047322 Ga0495680_0082739 Ga0495680_0082739_156_539 127
2 3300047322 Ga0495680_0121387 Ga0495680_0121387_654_1037 127
3 3300035398 Ga0316574_0065044 Ga0316574_0065044_1849_2241 130
4 3300035398 Ga0316574_0302312 Ga0316574_0302312_59_457 131
5 3300025903 Ga0207680_10548991 Ga0207680_105489912 132
6 3300025961 Ga0207712_10418266 Ga0207712_104182662 132
7 3300026121 Ga0207683_10049980 Ga0207683_100499805 132
8 3300028381 Ga0268264_10237766 Ga0268264_102377662 132
9 3300042436 Ga0439435_0189397 Ga0439435_0189397_101_559 136
10 3300041491 Ga0451833_0042069 Ga0451833_0042069_113_559 138
11 3300005563 Ga0068855_100002481 Ga0068855_1000024815 139
12 3300005614 Ga0068856_100048345 Ga0068856_1000483455 139
13 3300009093 Ga0105240_10299047 Ga0105240_102990472 139
14 3300009545 Ga0105237_10168355 Ga0105237_101683554 139
15 3300010375 Ga0105239_10279941 Ga0105239_102799413 139
16 3300025914 Ga0207671_10355407 Ga0207671_103554072 139
17 3300025949 Ga0207667_10002085 Ga0207667_1000208510 139
18 3300026078 Ga0207702_10022175 Ga0207702_100221755 139
19 3300042876 Ga0451577_0283774 Ga0451577_0283774_718_1170 139
20 iso_pu_bacteria 2895498888 2895499497 139
21 iso_pu_bacteria 2895511927 2895512519 139
22 iso_pu_bacteria 2895522137 2895522530 139
23 iso_pu_bacteria 2895525241 2895525704 139
24 3300006948 Ga0099826_10111354 Ga0099826_101113542 140
25 3300039437 Ga0436365_0115737 Ga0436365_0115737_470_913 140
26 3300053124 Ga0500617_201809 Ga0500617_201809_125_592 140
27 3300053146 Ga0500588_0000119 Ga0500588_0000119_9774_10241 140
28 3300025949 Ga0207667_10366496 Ga0207667_103664962 141
29 3300032004 Ga0307414_10029227 Ga0307414_100292272 141
30 3300032005 Ga0307411_10648647 Ga0307411_106486472 141
31 3300041453 Ga0451797_0799138 Ga0451797_0799138_333_791 141
32 3300041460 Ga0451802_1835745 Ga0451802_1835745_258_716 141
33 3300041486 Ga0451807_0832178 Ga0451807_0832178_758_1216 141
34 3300041509 Ga0451843_1202550 Ga0451843_1202550_257_715 141
35 3300048927 Ga0496124_0007877 Ga0496124_0007877_3468_3908 141
36 3300005335 Ga0070666_10326417 Ga0070666_103264172 142
37 3300026023 Ga0207677_11217889 Ga0207677_112178892 142
38 3300031727 Ga0316576_10595747 Ga0316576_105957471 142
39 3300032005 Ga0307411_10715437 Ga0307411_107154372 142
40 3300049513 Ga0501290_006225 Ga0501290_006225_548_1012 142
41 3300049772 Ga0501275_000535 Ga0501275_000535_2024_2488 142
42 3300005618 Ga0068864_100039293 Ga0068864_1000392932 143
43 3300005841 Ga0068863_100084046 Ga0068863_1000840462 143
44 3300006931 Ga0097620_100311047 Ga0097620_1003110473 143
45 3300009177 Ga0105248_10032070 Ga0105248_100320705 143
46 3300009553 Ga0105249_10025967 Ga0105249_100259672 143
47 3300009553 Ga0105249_10170703 Ga0105249_101707033 143
48 3300025942 Ga0207689_10744547 Ga0207689_107445471 143
49 3300025961 Ga0207712_10010093 Ga0207712_100100939 143
50 3300025961 Ga0207712_10205056 Ga0207712_102050562 143
51 3300026088 Ga0207641_10206717 Ga0207641_102067172 143
52 3300026095 Ga0207676_10304745 Ga0207676_103047452 143
53 3300028380 Ga0268265_10187093 Ga0268265_101870932 143
54 3300031691 Ga0316579_10249930 Ga0316579_102499302 143
55 3300031727 Ga0316576_10215957 Ga0316576_102159572 143
56 3300031727 Ga0316576_10524532 Ga0316576_105245322 143
57 3300031727 Ga0316576_10755572 Ga0316576_107555721 143
58 3300031733 Ga0316577_10331073 Ga0316577_103310732 143
59 3300032139 Ga0316580_10096741 Ga0316580_100967412 143
60 3300035398 Ga0316574_0079477 Ga0316574_0079477_866_1318 143
61 3300036647 Ga0316582_0412322 Ga0316582_0412322_206_658 143
62 3300036647 Ga0316582_0660438 Ga0316582_0660438_249_701 143
63 3300036712 Ga0316584_0202763 Ga0316584_0202763_633_1085 143
64 3300039062 Ga0400483_028483 Ga0400483_028483_105098_105541 143
65 3300039062 Ga0400483_029989 Ga0400483_029989_13915_14364 143
66 3300039062 Ga0400483_077867 Ga0400483_077867_1366_1812 143
67 3300039062 Ga0400483_151143 Ga0400483_151143_75576_76019 143
68 3300039062 Ga0400483_242281 Ga0400483_242281_24816_25265 143
69 3300046517 Ga0495630_0277749 Ga0495630_0277749_585_1031 143
70 3300046616 Ga0495668_0491986 Ga0495668_0491986_175_621 143
71 3300046642 Ga0495634_0336190 Ga0495634_0336190_16_462 143
72 3300002073 JGI24745J21846_1029860 JGI24745J21846_10298601 144
73 3300003320 rootH2_10303568 rootH2_103035684 144
74 3300003323 rootH1_10001451 rootH1_100014517 144
75 3300003323 rootH1_10025242 rootH1_100252425 144
76 3300005293 Ga0065715_10531600 Ga0065715_105316002 144
77 3300005327 Ga0070658_10912298 Ga0070658_109122981 144
78 3300005328 Ga0070676_10003255 Ga0070676_100032557 144
79 3300005328 Ga0070676_10027589 Ga0070676_100275893 144
80 3300005328 Ga0070676_10171819 Ga0070676_101718192 144
81 3300005330 Ga0070690_100066757 Ga0070690_1000667572 144
82 3300005331 Ga0070670_100001861 Ga0070670_1000018614 144
83 3300005331 Ga0070670_100733218 Ga0070670_1007332182 144
84 3300005334 Ga0068869_100000108 Ga0068869_10000010810 144
85 3300005334 Ga0068869_100488478 Ga0068869_1004884782 144
86 3300005335 Ga0070666_10064193 Ga0070666_100641933 144
87 3300005335 Ga0070666_10267564 Ga0070666_102675641 144
88 3300005335 Ga0070666_10465956 Ga0070666_104659562 144
89 3300005337 Ga0070682_100942328 Ga0070682_1009423281 144
90 3300005337 Ga0070682_101361434 Ga0070682_1013614341 144
91 3300005338 Ga0068868_100077515 Ga0068868_1000775154 144
92 3300005338 Ga0068868_100330914 Ga0068868_1003309142 144
93 3300005338 Ga0068868_101472790 Ga0068868_1014727901 144
94 3300005339 Ga0070660_100005400 Ga0070660_1000054007 144
95 3300005339 Ga0070660_100096411 Ga0070660_1000964112 144
96 3300005340 Ga0070689_100759530 Ga0070689_1007595301 144
97 3300005343 Ga0070687_100039944 Ga0070687_1000399442 144
98 3300005344 Ga0070661_100001790 Ga0070661_10000179015 144
99 3300005344 Ga0070661_100056801 Ga0070661_1000568014 144
100 3300005347 Ga0070668_100012924 Ga0070668_1000129244 144
101 3300005353 Ga0070669_100002544 Ga0070669_1000025447 144
102 3300005353 Ga0070669_100241247 Ga0070669_1002412473 144
103 3300005353 Ga0070669_100249411 Ga0070669_1002494112 144
104 3300005354 Ga0070675_100182286 Ga0070675_1001822862 144
105 3300005354 Ga0070675_100770247 Ga0070675_1007702472 144
106 3300005355 Ga0070671_100000025 Ga0070671_10000002533 144
107 3300005355 Ga0070671_100000582 Ga0070671_10000058223 144
108 3300005355 Ga0070671_100108840 Ga0070671_1001088402 144
109 3300005355 Ga0070671_100313538 Ga0070671_1003135382 144
110 3300005356 Ga0070674_100038687 Ga0070674_1000386872 144
111 3300005356 Ga0070674_100289869 Ga0070674_1002898692 144
112 3300005356 Ga0070674_100292402 Ga0070674_1002924023 144
113 3300005364 Ga0070673_100002656 Ga0070673_10000265610 144
114 3300005364 Ga0070673_100033668 Ga0070673_1000336685 144
115 3300005364 Ga0070673_100552846 Ga0070673_1005528462 144
116 3300005366 Ga0070659_100001088 Ga0070659_10000108810 144
117 3300005367 Ga0070667_100000095 Ga0070667_10000009585 144
118 3300005367 Ga0070667_100003815 Ga0070667_1000038156 144
119 3300005367 Ga0070667_100020231 Ga0070667_1000202312 144
120 3300005367 Ga0070667_100076944 Ga0070667_1000769442 144
121 3300005367 Ga0070667_100542432 Ga0070667_1005424322 144
122 3300005367 Ga0070667_101788584 Ga0070667_1017885841 144
123 3300005406 Ga0070703_10135093 Ga0070703_101350932 144
124 3300005434 Ga0070709_10590261 Ga0070709_105902612 144
125 3300005455 Ga0070663_100020141 Ga0070663_1000201415 144
126 3300005455 Ga0070663_100045794 Ga0070663_1000457942 144
127 3300005455 Ga0070663_100147587 Ga0070663_1001475873 144
128 3300005455 Ga0070663_100312807 Ga0070663_1003128072 144
129 3300005456 Ga0070678_100161469 Ga0070678_1001614693 144
130 3300005456 Ga0070678_100456748 Ga0070678_1004567482 144
131 3300005456 Ga0070678_100644690 Ga0070678_1006446902 144
132 3300005457 Ga0070662_100000134 Ga0070662_10000013433 144
133 3300005457 Ga0070662_100389002 Ga0070662_1003890022 144
134 3300005457 Ga0070662_100406587 Ga0070662_1004065872 144
135 3300005457 Ga0070662_100588545 Ga0070662_1005885451 144
136 3300005459 Ga0068867_100006428 Ga0068867_1000064284 144
137 3300005459 Ga0068867_100478434 Ga0068867_1004784342 144
138 3300005466 Ga0070685_10000005 Ga0070685_1000000575 144
139 3300005530 Ga0070679_100548302 Ga0070679_1005483022 144
140 3300005539 Ga0068853_100000458 Ga0068853_10000045820 144
141 3300005543 Ga0070672_100029477 Ga0070672_1000294774 144
142 3300005543 Ga0070672_100148790 Ga0070672_1001487902 144
143 3300005543 Ga0070672_100261819 Ga0070672_1002618191 144
144 3300005545 Ga0070695_100074482 Ga0070695_1000744823 144
145 3300005547 Ga0070693_100950793 Ga0070693_1009507932 144
146 3300005548 Ga0070665_100002661 Ga0070665_10000266117 144
147 3300005548 Ga0070665_100003568 Ga0070665_1000035684 144
148 3300005548 Ga0070665_100737748 Ga0070665_1007377482 144
149 3300005549 Ga0070704_100685936 Ga0070704_1006859362 144
150 3300005563 Ga0068855_100001419 Ga0068855_10000141910 144
151 3300005563 Ga0068855_100126098 Ga0068855_1001260984 144
152 3300005564 Ga0070664_100100214 Ga0070664_1001002143 144
153 3300005564 Ga0070664_100284539 Ga0070664_1002845392 144
154 3300005564 Ga0070664_100391043 Ga0070664_1003910433 144
155 3300005577 Ga0068857_100015058 Ga0068857_1000150589 144
156 3300005577 Ga0068857_101119150 Ga0068857_1011191501 144
157 3300005577 Ga0068857_101434926 Ga0068857_1014349262 144
158 3300005578 Ga0068854_100114115 Ga0068854_1001141153 144
159 3300005578 Ga0068854_100279425 Ga0068854_1002794252 144
160 3300005578 Ga0068854_100516605 Ga0068854_1005166052 144
161 3300005614 Ga0068856_100000265 Ga0068856_10000026524 144
162 3300005615 Ga0070702_100736703 Ga0070702_1007367032 144
163 3300005615 Ga0070702_100836032 Ga0070702_1008360321 144
164 3300005616 Ga0068852_100043384 Ga0068852_1000433843 144
165 3300005616 Ga0068852_100050497 Ga0068852_1000504975 144
166 3300005617 Ga0068859_100000217 Ga0068859_10000021747 144
167 3300005617 Ga0068859_100006607 Ga0068859_10000660710 144
168 3300005618 Ga0068864_100000073 Ga0068864_10000007385 144
169 3300005618 Ga0068864_100001680 Ga0068864_10000168011 144
170 3300005618 Ga0068864_101669508 Ga0068864_1016695082 144
171 3300005719 Ga0068861_100004666 Ga0068861_1000046664 144
172 3300005719 Ga0068861_100093225 Ga0068861_1000932252 144
173 3300005834 Ga0068851_10015435 Ga0068851_100154354 144
174 3300005834 Ga0068851_10621126 Ga0068851_106211262 144
175 3300005840 Ga0068870_10005304 Ga0068870_100053043 144
176 3300005841 Ga0068863_100003558 Ga0068863_1000035589 144
177 3300005841 Ga0068863_100528474 Ga0068863_1005284742 144
178 3300005842 Ga0068858_100030245 Ga0068858_1000302456 144
179 3300005842 Ga0068858_100213453 Ga0068858_1002134532 144
180 3300005843 Ga0068860_100000326 Ga0068860_1000003267 144
181 3300005843 Ga0068860_100006779 Ga0068860_10000677910 144
182 3300005843 Ga0068860_101836976 Ga0068860_1018369762 144
183 3300005844 Ga0068862_100002886 Ga0068862_1000028867 144
184 3300005844 Ga0068862_100026056 Ga0068862_1000260566 144
185 3300005844 Ga0068862_101401844 Ga0068862_1014018441 144
186 3300006358 Ga0068871_101056690 Ga0068871_1010566901 144
187 3300006844 Ga0075428_100853361 Ga0075428_1008533612 144
188 3300006871 Ga0075434_100292389 Ga0075434_1002923892 144
189 3300006880 Ga0075429_100294484 Ga0075429_1002944842 144
190 3300006881 Ga0068865_100298701 Ga0068865_1002987012 144
191 3300006931 Ga0097620_100000217 Ga0097620_1000002179 144
192 3300006931 Ga0097620_100006607 Ga0097620_10000660710 144
193 3300007076 Ga0075435_100250427 Ga0075435_1002504272 144
194 3300009101 Ga0105247_10028802 Ga0105247_100288023 144
195 3300009148 Ga0105243_10218135 Ga0105243_102181352 144
196 3300009177 Ga0105248_10160606 Ga0105248_101606061 144
197 3300009545 Ga0105237_10692743 Ga0105237_106927432 144
198 3300009553 Ga0105249_10077855 Ga0105249_100778551 144
199 3300009553 Ga0105249_10282214 Ga0105249_102822142 144
200 3300009553 Ga0105249_10586229 Ga0105249_105862292 144
201 3300011119 Ga0105246_11443008 Ga0105246_114430081 144
202 3300013100 Ga0157373_10000321 Ga0157373_1000032131 144
203 3300013102 Ga0157371_10000470 Ga0157371_1000047043 144
204 3300013102 Ga0157371_10273615 Ga0157371_102736153 144
205 3300013105 Ga0157369_10147643 Ga0157369_101476432 144
206 3300013296 Ga0157374_11407578 Ga0157374_114075782 144
207 3300013306 Ga0163162_10030012 Ga0163162_100300123 144
208 3300013306 Ga0163162_10077697 Ga0163162_100776974 144
209 3300013307 Ga0157372_10002397 Ga0157372_1000239713 144
210 3300013307 Ga0157372_10576586 Ga0157372_105765862 144
211 3300013308 Ga0157375_10024696 Ga0157375_100246963 144
212 3300013308 Ga0157375_11026341 Ga0157375_110263412 144
213 3300014325 Ga0163163_10000230 Ga0163163_1000023037 144
214 3300014326 Ga0157380_10185578 Ga0157380_101855783 144
215 3300014745 Ga0157377_10994578 Ga0157377_109945782 144
216 3300014968 Ga0157379_10044181 Ga0157379_100441815 144
217 3300014968 Ga0157379_10501261 Ga0157379_105012613 144
218 3300014969 Ga0157376_10250795 Ga0157376_102507953 144
219 3300014969 Ga0157376_10652847 Ga0157376_106528472 144
220 3300017792 Ga0163161_10131233 Ga0163161_101312332 144
221 3300021384 Ga0213876_10451564 Ga0213876_104515641 144
222 3300025315 Ga0207697_10167008 Ga0207697_101670082 144
223 3300025321 Ga0207656_10012668 Ga0207656_100126684 144
224 3300025885 Ga0207653_10216066 Ga0207653_102160662 144
225 3300025893 Ga0207682_10121292 Ga0207682_101212923 144
226 3300025893 Ga0207682_10132702 Ga0207682_101327021 144
227 3300025899 Ga0207642_10280723 Ga0207642_102807231 144
228 3300025899 Ga0207642_10281908 Ga0207642_102819082 144
229 3300025900 Ga0207710_10040533 Ga0207710_100405333 144
230 3300025901 Ga0207688_10032849 Ga0207688_100328492 144
231 3300025901 Ga0207688_10464825 Ga0207688_104648251 144
232 3300025901 Ga0207688_10490315 Ga0207688_104903152 144
233 3300025903 Ga0207680_10038805 Ga0207680_100388053 144
234 3300025903 Ga0207680_10158146 Ga0207680_101581462 144
235 3300025903 Ga0207680_10356208 Ga0207680_103562082 144
236 3300025903 Ga0207680_10591565 Ga0207680_105915651 144
237 3300025906 Ga0207699_10423002 Ga0207699_104230022 144
238 3300025907 Ga0207645_10007023 Ga0207645_100070239 144
239 3300025907 Ga0207645_10036113 Ga0207645_100361134 144
240 3300025908 Ga0207643_10009039 Ga0207643_100090393 144
241 3300025918 Ga0207662_10273032 Ga0207662_102730322 144
242 3300025919 Ga0207657_10008703 Ga0207657_100087034 144
243 3300025919 Ga0207657_10082465 Ga0207657_100824653 144
244 3300025920 Ga0207649_10130943 Ga0207649_101309431 144
245 3300025921 Ga0207652_10123760 Ga0207652_101237603 144
246 3300025923 Ga0207681_10000156 Ga0207681_100001568 144
247 3300025923 Ga0207681_10013098 Ga0207681_100130984 144
248 3300025923 Ga0207681_10200969 Ga0207681_102009693 144
249 3300025923 Ga0207681_10239049 Ga0207681_102390492 144
250 3300025925 Ga0207650_10000106 Ga0207650_1000010616 144
251 3300025925 Ga0207650_10003583 Ga0207650_1000358310 144
252 3300025925 Ga0207650_10658782 Ga0207650_106587822 144
253 3300025925 Ga0207650_10679100 Ga0207650_106791002 144
254 3300025926 Ga0207659_10021820 Ga0207659_100218202 144
255 3300025927 Ga0207687_10140861 Ga0207687_101408613 144
256 3300025931 Ga0207644_10000049 Ga0207644_100000496 144
257 3300025931 Ga0207644_10003130 Ga0207644_100031309 144
258 3300025931 Ga0207644_10250135 Ga0207644_102501352 144
259 3300025932 Ga0207690_10000395 Ga0207690_100003959 144
260 3300025933 Ga0207706_10000002 Ga0207706_1000000267 144
261 3300025933 Ga0207706_10142290 Ga0207706_101422903 144
262 3300025933 Ga0207706_10222933 Ga0207706_102229332 144
263 3300025934 Ga0207686_10486652 Ga0207686_104866522 144
264 3300025936 Ga0207670_10173467 Ga0207670_101734673 144
265 3300025937 Ga0207669_10005777 Ga0207669_100057775 144
266 3300025937 Ga0207669_10051451 Ga0207669_100514512 144
267 3300025937 Ga0207669_10275576 Ga0207669_102755762 144
268 3300025938 Ga0207704_10170566 Ga0207704_101705662 144
269 3300025938 Ga0207704_10682079 Ga0207704_106820792 144
270 3300025940 Ga0207691_10039009 Ga0207691_100390092 144
271 3300025940 Ga0207691_10077169 Ga0207691_100771692 144
272 3300025940 Ga0207691_10116273 Ga0207691_101162732 144
273 3300025940 Ga0207691_10268973 Ga0207691_102689733 144
274 3300025940 Ga0207691_10400183 Ga0207691_104001833 144
275 3300025941 Ga0207711_10001196 Ga0207711_1000119617 144
276 3300025941 Ga0207711_10016430 Ga0207711_100164305 144
277 3300025942 Ga0207689_10000030 Ga0207689_1000003013 144
278 3300025945 Ga0207679_10001203 Ga0207679_100012038 144
279 3300025945 Ga0207679_10046161 Ga0207679_100461613 144
280 3300025945 Ga0207679_10491869 Ga0207679_104918692 144
281 3300025949 Ga0207667_10002263 Ga0207667_1000226312 144
282 3300025949 Ga0207667_10113627 Ga0207667_101136272 144
283 3300025960 Ga0207651_10000744 Ga0207651_1000074412 144
284 3300025960 Ga0207651_10014965 Ga0207651_100149655 144
285 3300025960 Ga0207651_10542833 Ga0207651_105428332 144
286 3300025961 Ga0207712_10052270 Ga0207712_100522701 144
287 3300025961 Ga0207712_10118546 Ga0207712_101185461 144
288 3300025972 Ga0207668_10014281 Ga0207668_100142817 144
289 3300025972 Ga0207668_10225941 Ga0207668_102259412 144
290 3300025972 Ga0207668_10338942 Ga0207668_103389423 144
291 3300025972 Ga0207668_10398488 Ga0207668_103984882 144
292 3300025981 Ga0207640_10010032 Ga0207640_100100327 144
293 3300025981 Ga0207640_10126682 Ga0207640_101266822 144
294 3300025986 Ga0207658_10000073 Ga0207658_1000007316 144
295 3300025986 Ga0207658_10067229 Ga0207658_100672293 144
296 3300025986 Ga0207658_10184701 Ga0207658_101847013 144
297 3300025986 Ga0207658_10291982 Ga0207658_102919822 144
298 3300025986 Ga0207658_10376451 Ga0207658_103764512 144
299 3300026023 Ga0207677_10061755 Ga0207677_100617554 144
300 3300026023 Ga0207677_10707715 Ga0207677_107077151 144
301 3300026035 Ga0207703_10002181 Ga0207703_1000218111 144
302 3300026035 Ga0207703_10080975 Ga0207703_100809753 144
303 3300026035 Ga0207703_10441012 Ga0207703_104410123 144
304 3300026041 Ga0207639_10001640 Ga0207639_1000164011 144
305 3300026067 Ga0207678_10003781 Ga0207678_100037819 144
306 3300026067 Ga0207678_10213759 Ga0207678_102137593 144
307 3300026067 Ga0207678_10354007 Ga0207678_103540073 144
308 3300026067 Ga0207678_10452064 Ga0207678_104520642 144
309 3300026075 Ga0207708_11400925 Ga0207708_114009251 144
310 3300026078 Ga0207702_10000810 Ga0207702_100008103 144
311 3300026088 Ga0207641_10007204 Ga0207641_100072049 144
312 3300026088 Ga0207641_10022040 Ga0207641_100220403 144
313 3300026088 Ga0207641_10242640 Ga0207641_102426403 144
314 3300026089 Ga0207648_10011609 Ga0207648_100116097 144
315 3300026089 Ga0207648_10029102 Ga0207648_100291023 144
316 3300026089 Ga0207648_10130265 Ga0207648_101302652 144
317 3300026095 Ga0207676_10000010 Ga0207676_1000001016 144
318 3300026116 Ga0207674_10264169 Ga0207674_102641692 144
319 3300026116 Ga0207674_11304059 Ga0207674_113040592 144
320 3300026118 Ga0207675_100000852 Ga0207675_10000085223 144
321 3300026118 Ga0207675_100104516 Ga0207675_1001045162 144
322 3300026118 Ga0207675_100433709 Ga0207675_1004337092 144
323 3300026121 Ga0207683_10038714 Ga0207683_100387142 144
324 3300026121 Ga0207683_10252029 Ga0207683_102520293 144
325 3300026121 Ga0207683_10455426 Ga0207683_104554262 144
326 3300026142 Ga0207698_10042011 Ga0207698_100420115 144
327 3300026142 Ga0207698_10572340 Ga0207698_105723401 144
328 3300027111 Ga0209281_1018539 Ga0209281_10185392 144
329 3300027665 Ga0209983_1005806 Ga0209983_10058062 144
330 3300027876 Ga0209974_10021246 Ga0209974_100212462 144
331 3300027907 Ga0207428_10356015 Ga0207428_103560152 144
332 3300028379 Ga0268266_10022816 Ga0268266_100228163 144
333 3300028379 Ga0268266_11166705 Ga0268266_111667051 144
334 3300028379 Ga0268266_11745085 Ga0268266_117450852 144
335 3300028380 Ga0268265_10003355 Ga0268265_1000335510 144
336 3300028380 Ga0268265_10042309 Ga0268265_100423093 144
337 3300028381 Ga0268264_10000123 Ga0268264_10000123107 144
338 3300028381 Ga0268264_10025783 Ga0268264_100257836 144
339 3300028381 Ga0268264_11289102 Ga0268264_112891022 144
340 3300031238 Ga0265332_10327927 Ga0265332_103279271 144
341 3300031250 Ga0265331_10169709 Ga0265331_101697092 144
342 3300031251 Ga0265327_10000094 Ga0265327_1000009464 144
343 3300031456 Ga0307513_10558015 Ga0307513_105580152 144
344 3300031548 Ga0307408_100000192 Ga0307408_10000019210 144
345 3300031548 Ga0307408_100015800 Ga0307408_1000158002 144
346 3300031731 Ga0307405_10002481 Ga0307405_100024815 144
347 3300031731 Ga0307405_10768660 Ga0307405_107686602 144
348 3300031824 Ga0307413_10005033 Ga0307413_100050337 144
349 3300031824 Ga0307413_10069433 Ga0307413_100694332 144
350 3300031824 Ga0307413_10095738 Ga0307413_100957383 144
351 3300031852 Ga0307410_10007305 Ga0307410_100073055 144
352 3300031852 Ga0307410_10136031 Ga0307410_101360313 144
353 3300031901 Ga0307406_10001571 Ga0307406_100015717 144
354 3300031901 Ga0307406_10017922 Ga0307406_100179223 144
355 3300031901 Ga0307406_10088287 Ga0307406_100882873 144
356 3300031903 Ga0307407_10000698 Ga0307407_100006982 144
357 3300031903 Ga0307407_10191206 Ga0307407_101912061 144
358 3300031903 Ga0307407_11205757 Ga0307407_112057572 144
359 3300031911 Ga0307412_10021547 Ga0307412_100215472 144
360 3300031995 Ga0307409_100005474 Ga0307409_1000054745 144
361 3300031995 Ga0307409_100019629 Ga0307409_1000196293 144
362 3300031995 Ga0307409_100159059 Ga0307409_1001590592 144
363 3300031995 Ga0307409_100184609 Ga0307409_1001846092 144
364 3300032002 Ga0307416_100013567 Ga0307416_1000135672 144
365 3300032002 Ga0307416_100232235 Ga0307416_1002322352 144
366 3300032002 Ga0307416_102980361 Ga0307416_1029803611 144
367 3300032004 Ga0307414_10080652 Ga0307414_100806523 144
368 3300032005 Ga0307411_10000867 Ga0307411_100008677 144
369 3300032005 Ga0307411_10720312 Ga0307411_107203121 144
370 3300032126 Ga0307415_100009857 Ga0307415_1000098575 144
371 3300032126 Ga0307415_100099231 Ga0307415_1000992312 144
372 3300032137 Ga0316585_10266538 Ga0316585_102665381 144
373 3300032139 Ga0316580_10105252 Ga0316580_101052522 144
374 3300035172 Ga0373955_0681664 Ga0373955_0681664_142_591 144
375 3300035241 Ga0373961_0212617 Ga0373961_0212617_15_458 144
376 3300035691 Ga0373931_0531206 Ga0373931_0531206_125_568 144
377 3300036401 Ga0373937_0266350 Ga0373937_0266350_744_1208 144
378 3300036647 Ga0316582_0072515 Ga0316582_0072515_762_1235 144
379 3300036647 Ga0316582_0181438 Ga0316582_0181438_936_1409 144
380 3300036647 Ga0316582_0418514 Ga0316582_0418514_428_901 144
381 3300036712 Ga0316584_0016769 Ga0316584_0016769_54_527 144
382 3300036712 Ga0316584_0060045 Ga0316584_0060045_334_807 144
383 3300036712 Ga0316584_0075231 Ga0316584_0075231_990_1463 144
384 3300037418 Ga0395900_1001327 Ga0395900_1001327_162_602 144
385 3300037588 Ga0316581_0002317 Ga0316581_0002317_2440_2913 144
386 3300041507 Ga0451851_0565157 Ga0451851_0565157_52_501 144
387 3300042006 Ga0439432_133216 Ga0439432_133216_139_600 144
388 3300042118 Ga0450914_000785 Ga0450914_000785_862_1305 144
389 3300042876 Ga0451577_0111952 Ga0451577_0111952_922_1392 144
390 3300044712 Ga0453684_0373300 Ga0453684_0373300_247_717 144
391 3300046536 Ga0495587_0562797 Ga0495587_0562797_106_561 144
392 3300046537 Ga0495598_0116272 Ga0495598_0116272_55_528 144
393 3300046539 Ga0495621_0027977 Ga0495621_0027977_840_1313 144
394 3300048904 Ga0496101_0045751 Ga0496101_0045751_866_1309 144
395 3300048905 Ga0496102_0001905 Ga0496102_0001905_15099_15542 144
396 3300048906 Ga0496103_0250998 Ga0496103_0250998_493_936 144
397 3300048909 Ga0496106_0000553 Ga0496106_0000553_24485_24928 144
398 3300048910 Ga0496107_0007756 Ga0496107_0007756_768_1211 144
399 3300048912 Ga0496109_0595386 Ga0496109_0595386_530_967 144
400 3300048916 Ga0496113_0594655 Ga0496113_0594655_22_465 144
401 3300048928 Ga0496125_0050172 Ga0496125_0050172_811_1263 144
402 3300049571 Ga0501034_0942433 Ga0501034_0942433_173_646 144
403 3300050512 nmdc:mga0n895_173694_c1 nmdc:mga0n895_173694_c1_1132_1569 144
404 3300050513 nmdc:mga0rr50_323023_c1 nmdc:mga0rr50_323023_c1_638_1075 144
405 3300053119 Ga0500595_013196 Ga0500595_013196_707_1159 144
406 3300055283 Ga0500661_046302 Ga0500661_046302_128_670 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

43

168

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.949 5 137
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9467 4 137
5lm7-assembly2.cif.gz_D crystal structure of the lambda n-nus factor complex 0.9284 6 129
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9201 4 137
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.9095 5 137
ID Description Score Start End Superfamily
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9593 1 137 1.10.940.10
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9394 1 137 1.10.940.10
5lm7D00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9284 6 129 1.10.940.10
af_Q8VYC4_72_208_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8961 50 132 1.10.940.10
4eyaA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8733 1 130 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A358JMK5-F1-model_v4 deleted 0.99 9 142
AF-A0A536TZI2-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.989 5 143 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-Q2YD50-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9865 2 141 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A7V8BGB7-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9861 5 138 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A328ZJA4-F1-model_v4 deleted 0.9851 2 141

Feature Viewer

pLDDT pTM Quality
94.88 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map