F436328

General Info

Members Datasets Scaffolds Average Seq Length
406 204 813 130

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0583577|Ga0501048_0583577_148_588
Length 146
Sequence MRANGAAFAPVRESLMAQQPVELILIRQWASYLTMPIFVIGADGQLAYYNEPAEALLGRTFDEAGEMPLQELSTIFEITDEVGGPIELSNFPLGIAWMEHRPAHGRVRYRALDGPWRLVDVTAIPIEGHDEQHLGAVAIFWEANSH

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
187 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.42
Rhizosphere 93.6
Stem 0
Stem Tuber 0
Unclassified 27.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_0583577 3300049582 Unclassified 802
2 SwRhRL3b_contig_2920679 2162886006 Bacteria 2006
3 SwRhRL2b_contig_2936518 2162886007 Bacteria 6653
4 SwRhRL2b_contig_967995 2162886007 Bacteria 2673
5 rootH1_10135823 3300003316 Bacteria 2385
6 rootH1_10135823 3300003323 Bacteria 3628
7 rootH2_10043786 3300003320 Bacteria 1768
8 rootL2_10023774 3300003322 Bacteria 3329
9 rootH1_10142958 3300003323 Bacteria 2392
10 JGI25407J50210_10033900 3300003373 Unclassified 1318
11 JGI25407J50210_10089861 3300003373 Unclassified 760
12 JGI25407J50210_10149386 3300003373 Bacteria 575
13 Ga0065704_10000294 3300005289 Bacteria 47445
14 Ga0065704_10349761 3300005289 Bacteria 811
15 Ga0065712_10553467 3300005290 Unclassified 616
16 Ga0065715_10215258 3300005293 Unclassified 1296
17 Ga0065707_10000503 3300005295 Bacteria 28730
18 Ga0065707_10018371 3300005295 Bacteria 1986
19 Ga0065707_10087080 3300005295 Bacteria 5158
20 Ga0065707_10087921 3300005295 Unclassified 4842
21 Ga0070683_100128000 3300005329 Bacteria 2401
22 Ga0070690_101460174 3300005330 Unclassified 551
23 Ga0068869_100338411 3300005334 Bacteria 1224
24 Ga0070680_100390885 3300005336 Bacteria 1185
25 Ga0070680_101584964 3300005336 Unclassified 567
26 Ga0070682_100439862 3300005337 Bacteria 996
27 Ga0068868_100032254 3300005338 Bacteria 4029
28 Ga0070689_100002705 3300005340 Bacteria 11607
29 Ga0070689_100185385 3300005340 Unclassified 1692
30 Ga0070689_100795840 3300005340 Unclassified 831
31 Ga0070687_100019368 3300005343 Bacteria 3164
32 Ga0070661_100417303 3300005344 Bacteria 1063
33 Ga0070692_10133304 3300005345 Bacteria 1398
34 Ga0070692_10561460 3300005345 Unclassified 749
35 Ga0070668_101065767 3300005347 Unclassified 728
36 Ga0070669_100053618 3300005353 Bacteria 2952
37 Ga0070669_100738413 3300005353 Unclassified 833
38 Ga0070669_100797565 3300005353 Bacteria 802
39 Ga0070675_100026606 3300005354 Bacteria 4643
40 Ga0070688_100085642 3300005365 Bacteria 2049
41 Ga0070701_10001602 3300005438 Bacteria 8428
42 Ga0070700_100045157 3300005441 Bacteria 2717
43 Ga0070700_101145282 3300005441 Bacteria 647
44 Ga0070694_100078370 3300005444 Unclassified 2292
45 Ga0070694_100195726 3300005444 Bacteria 1504
46 Ga0070694_101242751 3300005444 Bacteria 625
47 Ga0070663_100188070 3300005455 Bacteria 1606
48 Ga0070678_100240402 3300005456 Bacteria 1514
49 Ga0070662_100450317 3300005457 Bacteria 1068
50 Ga0070662_100630464 3300005457 Unclassified 903
51 Ga0070662_101042014 3300005457 Bacteria 701
52 Ga0068867_100012831 3300005459 Bacteria 5930
53 Ga0068867_102084274 3300005459 Unclassified 537
54 Ga0070685_10014218 3300005466 Bacteria 4211
55 Ga0070706_100078564 3300005467 Unclassified 3055
56 Ga0070706_101314198 3300005467 Unclassified 663
57 Ga0070698_100183396 3300005471 Bacteria 2031
58 Ga0074259_11369290 3300005507 Unclassified 523
59 Ga0070684_100111753 3300005535 Bacteria 2450
60 Ga0070697_101214227 3300005536 Bacteria 672
61 Ga0068853_100684826 3300005539 Bacteria 977
62 Ga0070672_100010181 3300005543 Bacteria 6513
63 Ga0070672_100295495 3300005543 Bacteria 1372
64 Ga0070686_100003777 3300005544 Bacteria 8329
65 Ga0070686_100031784 3300005544 Bacteria 3231
66 Ga0070693_100007495 3300005547 Bacteria 5335
67 Ga0070704_100188421 3300005549 Bacteria 1656
68 Ga0070704_100234048 3300005549 Unclassified 1500
69 Ga0070704_100302612 3300005549 Bacteria 1333
70 Ga0068857_100338569 3300005577 Bacteria 1392
71 Ga0068854_100224992 3300005578 Bacteria 1486
72 Ga0068854_100293882 3300005578 Bacteria 1312
73 Ga0068854_100849041 3300005578 Bacteria 799
74 Ga0068854_100946648 3300005578 Bacteria 759
75 Ga0068856_102146444 3300005614 Unclassified 568
76 Ga0068852_100039842 3300005616 Bacteria 3959
77 Ga0068859_100125116 3300005617 Bacteria 2639
78 Ga0068859_100233467 3300005617 Unclassified 1928
79 Ga0068859_100253668 3300005617 Bacteria 1850
80 Ga0068859_100542610 3300005617 Bacteria 1257
81 Ga0068864_100168858 3300005618 Bacteria 1993
82 Ga0068864_100449553 3300005618 Bacteria 1232
83 Ga0068864_100560512 3300005618 Unclassified 1105
84 Ga0068866_10688910 3300005718 Bacteria 700
85 Ga0068866_10860977 3300005718 Unclassified 634
86 Ga0068861_100272453 3300005719 Bacteria 1454
87 Ga0068851_10416292 3300005834 Bacteria 793
88 Ga0068870_10108223 3300005840 Bacteria 1582
89 Ga0068870_10995816 3300005840 Unclassified 597
90 Ga0068863_100395461 3300005841 Unclassified 1351
91 Ga0068863_100564979 3300005841 Bacteria 1124
92 Ga0068858_100022194 3300005842 Bacteria 5928
93 Ga0068860_100018853 3300005843 Bacteria 6704
94 Ga0068860_100691874 3300005843 Bacteria 1029
95 Ga0068862_100370770 3300005844 Bacteria 1333
96 Ga0068862_100475405 3300005844 Bacteria 1182
97 Ga0068862_101004307 3300005844 Bacteria 825
98 Ga0068862_101097331 3300005844 Unclassified 791
99 Ga0081455_10035098 3300005937 Bacteria 4486
100 Ga0081538_10007347 3300005981 Bacteria 9542
101 Ga0081538_10017555 3300005981 Bacteria 5424
102 Ga0081538_10017567 3300005981 Bacteria 5422
103 Ga0081538_10049900 3300005981 Unclassified 2534
104 Ga0081538_10050597 3300005981 Bacteria 2506
105 Ga0081538_10082072 3300005981 Unclassified 1712
106 Ga0081540_1017393 3300005983 Bacteria 4453
107 Ga0081539_10009416 3300005985 Bacteria 8170
108 Ga0075427_10000135 3300006194 Bacteria 6709
109 Ga0075428_100051588 3300006844 Unclassified 4511
110 Ga0075428_100055038 3300006844 Bacteria 4360
111 Ga0075428_100076223 3300006844 Bacteria 3661
112 Ga0075428_100302770 3300006844 Unclassified 1719
113 Ga0075430_100108915 3300006846 Bacteria 2311
114 Ga0075430_100395699 3300006846 Bacteria 1140
115 Ga0075430_101305000 3300006846 Unclassified 597
116 Ga0075431_100020455 3300006847 Bacteria 6761
117 Ga0075431_100118466 3300006847 Bacteria 2732
118 Ga0075431_100119299 3300006847 Bacteria 2722
119 Ga0075431_100120003 3300006847 Bacteria 2713
120 Ga0075431_100308172 3300006847 Unclassified 1599
121 Ga0075431_100409012 3300006847 Bacteria 1357
122 Ga0075431_101303874 3300006847 Unclassified 687
123 Ga0075431_101765941 3300006847 Unclassified 575
124 Ga0075433_10246339 3300006852 Unclassified 1586
125 Ga0075433_10506987 3300006852 Bacteria 1062
126 Ga0075433_10519679 3300006852 Bacteria 1047
127 Ga0075433_11824840 3300006852 Unclassified 522
128 Ga0075434_100515787 3300006871 Unclassified 1216
129 Ga0075434_100894726 3300006871 Bacteria 903
130 Ga0075429_100033518 3300006880 Unclassified 4463
131 Ga0075429_100285308 3300006880 Bacteria 1446
132 Ga0075429_100718243 3300006880 Bacteria 875
133 Ga0068865_100304557 3300006881 Bacteria 1276
134 Ga0097620_100125119 3300006931 Bacteria 2639
135 Ga0097620_100233472 3300006931 Unclassified 1928
136 Ga0097620_100253666 3300006931 Bacteria 1850
137 Ga0097620_100542597 3300006931 Bacteria 1257
138 Ga0075435_100534369 3300007076 Bacteria 1015
139 Ga0075435_101011418 3300007076 Unclassified 726
140 Ga0111539_10011500 3300009094 Bacteria 11105
141 Ga0111539_10023542 3300009094 Bacteria 7566
142 Ga0111539_12293234 3300009094 Bacteria 626
143 Ga0111539_12758895 3300009094 Unclassified 569
144 Ga0105245_10016224 3300009098 Bacteria 6493
145 Ga0105245_10165593 3300009098 Bacteria 2101
146 Ga0105245_10517486 3300009098 Unclassified 1211
147 Ga0105245_12292433 3300009098 Unclassified 594
148 Ga0114129_10000013 3300009147 Bacteria 134059
149 Ga0114129_10003070 3300009147 Bacteria 23421
150 Ga0114129_10009793 3300009147 Bacteria 13669
151 Ga0114129_10012378 3300009147 Bacteria 12144
152 Ga0114129_10061809 3300009147 Bacteria 5234
153 Ga0114129_10170475 3300009147 Bacteria 2968
154 Ga0105243_10001933 3300009148 Bacteria 17647
155 Ga0105243_10191141 3300009148 Unclassified 1788
156 Ga0105243_10410464 3300009148 Unclassified 1260
157 Ga0105243_11267025 3300009148 Bacteria 753
158 Ga0105241_10184219 3300009174 Unclassified 1734
159 Ga0105241_10572887 3300009174 Unclassified 1017
160 Ga0105242_10055519 3300009176 Bacteria 3240
161 Ga0105242_11057675 3300009176 Bacteria 823
162 Ga0105242_12123584 3300009176 Unclassified 606
163 Ga0105248_10032325 3300009177 Bacteria 5849
164 Ga0105237_10246666 3300009545 Bacteria 1788
165 Ga0105237_11896751 3300009545 Unclassified 604
166 Ga0105238_10893323 3300009551 Bacteria 907
167 Ga0105238_11849295 3300009551 Unclassified 636
168 Ga0105249_10034127 3300009553 Bacteria 4608
169 Ga0105249_10084323 3300009553 Bacteria 2959
170 Ga0105249_10111662 3300009553 Bacteria 2585
171 Ga0105249_10448244 3300009553 Bacteria 1329
172 Ga0105249_11422345 3300009553 Bacteria 765
173 Ga0105239_10007610 3300010375 Bacteria 12413
174 Ga0105239_10084447 3300010375 Bacteria 3497
175 Ga0105239_10424433 3300010375 Bacteria 1507
176 Ga0105246_10013931 3300011119 Bacteria 5048
177 Ga0105246_10031701 3300011119 Unclassified 3499
178 Ga0105246_10407942 3300011119 Bacteria 1130
179 Ga0157369_11255439 3300013105 Unclassified 756
180 Ga0157374_10173005 3300013296 Unclassified 2107
181 Ga0157374_10504698 3300013296 Unclassified 1214
182 Ga0157378_10029499 3300013297 Bacteria 4843
183 Ga0157378_10250430 3300013297 Bacteria 1695
184 Ga0157378_10912201 3300013297 Bacteria 910
185 Ga0163162_10399740 3300013306 Unclassified 1506
186 Ga0163162_10709239 3300013306 Bacteria 1127
187 Ga0163162_10871978 3300013306 Bacteria 1014
188 Ga0163162_10930283 3300013306 Bacteria 981
189 Ga0163162_11764740 3300013306 Bacteria 707
190 Ga0157375_10016331 3300013308 Bacteria 6665
191 Ga0157375_10130590 3300013308 Bacteria 2631
192 Ga0157375_10197628 3300013308 Bacteria 2166
193 Ga0163163_10155446 3300014325 Bacteria 2331
194 Ga0163163_10847296 3300014325 Unclassified 977
195 Ga0157380_10509236 3300014326 Bacteria 1171
196 Ga0157380_11545072 3300014326 Unclassified 718
197 Ga0157377_10008058 3300014745 Bacteria 5123
198 Ga0157377_11264056 3300014745 Bacteria 575
199 Ga0157379_10052840 3300014968 Bacteria 3629
200 Ga0157379_10720733 3300014968 Bacteria 937
201 Ga0157379_11815597 3300014968 Bacteria 599
202 Ga0157376_10137588 3300014969 Bacteria 2187
203 Ga0163161_10072032 3300017792 Bacteria 2530
204 Ga0207642_10040352 3300025899 Bacteria 2036
205 Ga0207642_10733396 3300025899 Unclassified 625
206 Ga0207688_10005160 3300025901 Bacteria 7099
207 Ga0207645_10374691 3300025907 Bacteria 955
208 Ga0207643_10004432 3300025908 Bacteria 7548
209 Ga0207654_10617716 3300025911 Unclassified 774
210 Ga0207671_10462718 3300025914 Bacteria 1011
211 Ga0207660_10694130 3300025917 Bacteria 830
212 Ga0207662_10000235 3300025918 Bacteria 25730
213 Ga0207662_10324953 3300025918 Unclassified 1028
214 Ga0207649_10673428 3300025920 Bacteria 801
215 Ga0207681_10790592 3300025923 Bacteria 792
216 Ga0207681_11781598 3300025923 Unclassified 514
217 Ga0207694_10357527 3300025924 Bacteria 1210
218 Ga0207650_10219550 3300025925 Bacteria 1529
219 Ga0207650_10654556 3300025925 Bacteria 886
220 Ga0207659_10152303 3300025926 Unclassified 1807
221 Ga0207659_10186327 3300025926 Bacteria 1648
222 Ga0207687_10053930 3300025927 Bacteria 2811
223 Ga0207687_10079199 3300025927 Bacteria 2368
224 Ga0207687_10126184 3300025927 Bacteria 1921
225 Ga0207687_10863515 3300025927 Unclassified 773
226 Ga0207664_11251513 3300025929 Unclassified 661
227 Ga0207690_10233521 3300025932 Bacteria 1413
228 Ga0207690_10370572 3300025932 Unclassified 1136
229 Ga0207706_10499462 3300025933 Bacteria 1050
230 Ga0207686_11058255 3300025934 Bacteria 660
231 Ga0207709_10106478 3300025935 Unclassified 1865
232 Ga0207670_10133905 3300025936 Bacteria 1820
233 Ga0207670_10217145 3300025936 Unclassified 1462
234 Ga0207670_11212673 3300025936 Unclassified 639
235 Ga0207669_10003428 3300025937 Bacteria 6858
236 Ga0207691_10574920 3300025940 Bacteria 955
237 Ga0207691_11205357 3300025940 Unclassified 627
238 Ga0207689_10020345 3300025942 Bacteria 5588
239 Ga0207679_10172031 3300025945 Bacteria 1784
240 Ga0207712_10058139 3300025961 Unclassified 2731
241 Ga0207712_11053702 3300025961 Bacteria 723
242 Ga0207640_10206788 3300025981 Bacteria 1492
243 Ga0207640_10385921 3300025981 Bacteria 1136
244 Ga0207640_10806002 3300025981 Bacteria 814
245 Ga0207677_10083879 3300026023 Bacteria 2295
246 Ga0207639_10279902 3300026041 Bacteria 1467
247 Ga0207708_10003096 3300026075 Bacteria 12243
248 Ga0207708_11558836 3300026075 Unclassified 580
249 Ga0207641_11568653 3300026088 Bacteria 660
250 Ga0207648_10005704 3300026089 Bacteria 12479
251 Ga0207676_10538331 3300026095 Unclassified 1114
252 Ga0207674_10013889 3300026116 Bacteria 8911
253 Ga0207674_10199639 3300026116 Bacteria 1949
254 Ga0207675_100177423 3300026118 Bacteria 2039
255 Ga0207675_100364814 3300026118 Bacteria 1418
256 Ga0207683_10003546 3300026121 Bacteria 13608
257 Ga0207698_10106184 3300026142 Bacteria 2341
258 Ga0209983_1111679 3300027665 Unclassified 621
259 Ga0207428_10019385 3300027907 Bacteria 5801
260 Ga0207428_10095670 3300027907 Bacteria 2301
261 Ga0268265_10065697 3300028380 Bacteria 2801
262 Ga0268265_10448544 3300028380 Bacteria 1204
263 Ga0268265_11940858 3300028380 Unclassified 596
264 Ga0316576_10010655 3300031727 Bacteria 5987
265 Ga0316576_10016585 3300031727 Bacteria 4981
266 Ga0316578_10782315 3300031728 Unclassified 553
267 Ga0316577_10253315 3300031733 Unclassified 996
268 Ga0307412_11077322 3300031911 Bacteria 714
269 Ga0307415_101680726 3300032126 Unclassified 612
270 Ga0373962_0155524 3300035242 Bacteria 751
271 Ga0316574_0019894 3300035398 Bacteria 3968
272 Ga0316574_0177576 3300035398 Unclassified 1370
273 Ga0316574_0530519 3300035398 Bacteria 732
274 Ga0373931_0040868 3300035691 Bacteria 2435
275 Ga0373931_0212211 3300035691 Unclassified 1162
276 Ga0316584_0101614 3300036712 Bacteria 2153
277 Ga0316584_0412004 3300036712 Bacteria 961
278 Ga0439435_0044526 3300042436 Bacteria 1251
279 Ga0439460_0180041 3300042461 Unclassified 714
280 Ga0451577_0203430 3300042876 Unclassified 1787
281 Ga0451577_1358365 3300042876 Bacteria 631
282 Ga0453683_0323722 3300044673 Unclassified 988
283 Ga0453683_0466810 3300044673 Bacteria 817
284 Ga0453683_0521570 3300044673 Bacteria 772
285 Ga0453684_0166439 3300044712 Bacteria 2602
286 Ga0453684_0216874 3300044712 Unclassified 2219
287 Ga0453684_0451476 3300044712 Bacteria 1431
288 Ga0453684_1081308 3300044712 Unclassified 848
289 Ga0453684_1402359 3300044712 Unclassified 724
290 Ga0453684_2146285 3300044712 Unclassified 559
291 Ga0451576_0040285 3300045051 Unclassified 4946
292 Ga0451576_0053610 3300045051 Bacteria 4223
293 Ga0451576_0306933 3300045051 Unclassified 1660
294 Ga0451576_0663587 3300045051 Bacteria 1096
295 Ga0451576_1004948 3300045051 Bacteria 874
296 Ga0495676_0943836 3300047321 Unclassified 552
297 Ga0496101_0058347 3300048904 Bacteria 2795
298 Ga0496101_0453623 3300048904 Bacteria 1012
299 Ga0496102_0028802 3300048905 Bacteria 4965
300 Ga0496102_1228481 3300048905 Bacteria 669
301 Ga0496104_1614136 3300048907 Unclassified 551
302 Ga0496105_0376202 3300048908 Bacteria 1131
303 Ga0496105_0579808 3300048908 Bacteria 873
304 Ga0496106_0253785 3300048909 Bacteria 1406
305 Ga0496106_1520346 3300048909 Unclassified 514
306 Ga0496107_0061016 3300048910 Bacteria 2730
307 Ga0496108_0053344 3300048911 Bacteria 3390
308 Ga0496108_0253782 3300048911 Unclassified 1530
309 Ga0496108_0937728 3300048911 Unclassified 742
310 Ga0496109_0244661 3300048912 Bacteria 1689
311 Ga0496109_0356683 3300048912 Bacteria 1381
312 Ga0496109_0476714 3300048912 Unclassified 1178
313 Ga0496110_0027525 3300048913 Bacteria 4875
314 Ga0496110_0105086 3300048913 Bacteria 2533
315 Ga0496111_0151999 3300048914 Bacteria 1717
316 Ga0496112_0731709 3300048915 Bacteria 916
317 Ga0496114_0356500 3300048917 Bacteria 1294
318 Ga0496114_1187681 3300048917 Bacteria 649
319 Ga0501031_0009705 3300049568 Bacteria 6265
320 Ga0501032_0140947 3300049569 Bacteria 1587
321 Ga0501033_0020664 3300049570 Bacteria 4974
322 Ga0501036_0011823 3300049572 Bacteria 7235
323 Ga0501036_0961905 3300049572 Bacteria 700
324 Ga0501037_0078981 3300049573 Bacteria 2388
325 Ga0501038_0001818 3300049574 Bacteria 19759
326 Ga0501039_0002021 3300049575 Bacteria 15018
327 Ga0501039_0162582 3300049575 Bacteria 1755
328 Ga0501039_0553425 3300049575 Unclassified 903
329 Ga0501040_0029458 3300049576 Bacteria 3705
330 Ga0501040_0775335 3300049576 Unclassified 694
331 Ga0501041_0003716 3300049577 Bacteria 8772
332 Ga0501042_0003959 3300049578 Bacteria 9373
333 Ga0501043_0018459 3300049579 Bacteria 5470
334 Ga0501046_0019203 3300049580 Bacteria 5669
335 Ga0501046_0161143 3300049580 Unclassified 1687
336 Ga0501048_0000545 3300049582 Bacteria 26523
337 Ga0501067_0024137 3300049583 Bacteria 3371
338 Ga0501068_0002156 3300049584 Bacteria 10487
339 Ga0501069_0011263 3300049585 Bacteria 4742
340 Ga0501070_0028257 3300049586 Bacteria 4703
341 Ga0501071_0002436 3300049587 Bacteria 11286
342 Ga0501071_0183265 3300049587 Unclassified 1569
343 Ga0501072_0001771 3300049588 Bacteria 16052
344 Ga0501072_0800560 3300049588 Unclassified 738
345 Ga0501072_0815045 3300049588 Bacteria 731
346 Ga0501073_0290014 3300049589 Bacteria 1129
347 Ga0501074_0005274 3300049590 Bacteria 9306
348 Ga0501075_0003367 3300049591 Bacteria 10688
349 Ga0501075_0313846 3300049591 Unclassified 1195
350 Ga0501075_1396467 3300049591 Unclassified 530
351 Ga0501076_0001700 3300049592 Bacteria 14855
352 Ga0501076_0210452 3300049592 Bacteria 1589
353 Ga0501076_0960487 3300049592 Bacteria 704
354 Ga0501077_0000323 3300049593 Bacteria 28647
355 Ga0501077_0765020 3300049593 Unclassified 621
356 Ga0501251_040293 3300049681 Unclassified 704
357 Ga0501245_143425 3300049708 Bacteria 522
358 Ga0501079_0001853 3300049741 Bacteria 15153
359 Ga0501079_0012579 3300049741 Bacteria 6463
360 Ga0501079_0764253 3300049741 Bacteria 761
361 Ga0501080_0016022 3300049742 Bacteria 6917
362 Ga0501080_0229852 3300049742 Bacteria 1695
363 Ga0501081_0003830 3300049743 Bacteria 9637
364 Ga0501081_0130380 3300049743 Bacteria 1796
365 Ga0501081_0836759 3300049743 Unclassified 693
366 Ga0501083_0035363 3300049744 Bacteria 3413
367 Ga0501035_0045832 3300049822 Bacteria 3933
368 Ga0501045_0002822 3300049824 Bacteria 11860
369 Ga0501045_0608629 3300049824 Bacteria 809
370 nmdc:mga05p37_146155_c1 3300050507 Bacteria 2895
371 nmdc:mga05p37_16261_c1 3300050507 Bacteria 8958
372 nmdc:mga05p37_1666_c1 3300050507 Bacteria 25812
373 nmdc:mga05p37_17897_c1 3300050507 Bacteria 8553
374 nmdc:mga05p37_197761_c1 3300050507 Bacteria 2437
375 nmdc:mga05p37_22949_c1 3300050507 Bacteria 7569
376 nmdc:mga05p37_43702_c1 3300050507 Bacteria 5513
377 nmdc:mga09592_186238_c1 3300050508 Bacteria 1796
378 nmdc:mga09592_67541_c1 3300050508 Unclassified 3033
379 nmdc:mga09592_973870_c1 3300050508 Bacteria 710
380 nmdc:mga0qj67_112868_c1 3300050509 Bacteria 2194
381 nmdc:mga0qj67_435201_c1 3300050509 Unclassified 1057
382 nmdc:mga0qj67_49456_c1 3300050509 Bacteria 3323
383 nmdc:mga06r32_142891_c1 3300050510 Bacteria 2370
384 nmdc:mga06r32_181451_c1 3300050510 Bacteria 2091
385 nmdc:mga06r32_341126_c1 3300050510 Bacteria 1483
386 nmdc:mga06r32_384806_c1 3300050510 Unclassified 1385
387 nmdc:mga06r32_67858_c1 3300050510 Bacteria 3444
388 nmdc:mga08y16_1134367_c1 3300050511 Unclassified 755
389 nmdc:mga08y16_8392_c1 3300050511 Bacteria 10809
390 nmdc:mga08y16_89750_c1 3300050511 Bacteria 3203
391 nmdc:mga0n895_203816_c1 3300050512 Bacteria 2008
392 nmdc:mga0rr50_759650_c1 3300050513 Bacteria 827
393 nmdc:mga0a205_179193_c1 3300050515 Bacteria 2013
394 nmdc:mga0a205_241458_c1 3300050515 Bacteria 1687
395 nmdc:mga0a205_413480_c1 3300050515 Unclassified 1211
396 Ga0501084_0002527 3300054114 Bacteria 14735
397 Ga0501084_0020705 3300054114 Bacteria 5486
398 Ga0501084_0165382 3300054114 Bacteria 1867
399 Ga0501084_0461984 3300054114 Bacteria 1073
400 Ga0501084_1193217 3300054114 Unclassified 638
401 Ga0501082_0002597 3300060353 Bacteria 15800
402 Ga0501082_0109263 3300060353 Bacteria 2394
403 Ga0501082_1490699 3300060353 Bacteria 591
404 Ga0501082_1670889 3300060353 Bacteria 556
405 Ga0530510_0012019 3300061734 Bacteria 6072
406 Ga0530510_0056536 3300061734 Bacteria 2834
407 Ga0530510_0074606 3300061734 Unclassified 2463
408 Ga0501048_0583577
409 SwRhRL3b_contig_2920679
410 SwRhRL2b_contig_2936518
411 SwRhRL2b_contig_967995
412 rootH1_10135823
413 rootH2_10043786
414 rootL2_10023774
415 rootH1_10142958
416 JGI25407J50210_10033900
417 JGI25407J50210_10089861
418 JGI25407J50210_10149386
419 Ga0065704_10000294
420 Ga0065704_10349761
421 Ga0065712_10553467
422 Ga0065715_10215258
423 Ga0065707_10000503
424 Ga0065707_10018371
425 Ga0065707_10087080
426 Ga0065707_10087921
427 Ga0070683_100128000
428 Ga0070690_101460174
429 Ga0068869_100338411
430 Ga0070680_100390885
431 Ga0070680_101584964
432 Ga0070682_100439862
433 Ga0068868_100032254
434 Ga0070689_100002705
435 Ga0070689_100185385
436 Ga0070689_100795840
437 Ga0070687_100019368
438 Ga0070661_100417303
439 Ga0070692_10133304
440 Ga0070692_10561460
441 Ga0070668_101065767
442 Ga0070669_100053618
443 Ga0070669_100738413
444 Ga0070669_100797565
445 Ga0070675_100026606
446 Ga0070688_100085642
447 Ga0070701_10001602
448 Ga0070700_100045157
449 Ga0070700_101145282
450 Ga0070694_100078370
451 Ga0070694_100195726
452 Ga0070694_101242751
453 Ga0070663_100188070
454 Ga0070678_100240402
455 Ga0070662_100450317
456 Ga0070662_100630464
457 Ga0070662_101042014
458 Ga0068867_100012831
459 Ga0068867_102084274
460 Ga0070685_10014218
461 Ga0070706_100078564
462 Ga0070706_101314198
463 Ga0070698_100183396
464 Ga0074259_11369290
465 Ga0070684_100111753
466 Ga0070697_101214227
467 Ga0068853_100684826
468 Ga0070672_100010181
469 Ga0070672_100295495
470 Ga0070686_100003777
471 Ga0070686_100031784
472 Ga0070693_100007495
473 Ga0070704_100188421
474 Ga0070704_100234048
475 Ga0070704_100302612
476 Ga0068857_100338569
477 Ga0068854_100224992
478 Ga0068854_100293882
479 Ga0068854_100849041
480 Ga0068854_100946648
481 Ga0068856_102146444
482 Ga0068852_100039842
483 Ga0068859_100125116
484 Ga0068859_100233467
485 Ga0068859_100253668
486 Ga0068859_100542610
487 Ga0068864_100168858
488 Ga0068864_100449553
489 Ga0068864_100560512
490 Ga0068866_10688910
491 Ga0068866_10860977
492 Ga0068861_100272453
493 Ga0068851_10416292
494 Ga0068870_10108223
495 Ga0068870_10995816
496 Ga0068863_100395461
497 Ga0068863_100564979
498 Ga0068858_100022194
499 Ga0068860_100018853
500 Ga0068860_100691874
501 Ga0068862_100370770
502 Ga0068862_100475405
503 Ga0068862_101004307
504 Ga0068862_101097331
505 Ga0081455_10035098
506 Ga0081538_10007347
507 Ga0081538_10017555
508 Ga0081538_10017567
509 Ga0081538_10049900
510 Ga0081538_10050597
511 Ga0081538_10082072
512 Ga0081540_1017393
513 Ga0081539_10009416
514 Ga0075427_10000135
515 Ga0075428_100051588
516 Ga0075428_100055038
517 Ga0075428_100076223
518 Ga0075428_100302770
519 Ga0075430_100108915
520 Ga0075430_100395699
521 Ga0075430_101305000
522 Ga0075431_100020455
523 Ga0075431_100118466
524 Ga0075431_100119299
525 Ga0075431_100120003
526 Ga0075431_100308172
527 Ga0075431_100409012
528 Ga0075431_101303874
529 Ga0075431_101765941
530 Ga0075433_10246339
531 Ga0075433_10506987
532 Ga0075433_10519679
533 Ga0075433_11824840
534 Ga0075434_100515787
535 Ga0075434_100894726
536 Ga0075429_100033518
537 Ga0075429_100285308
538 Ga0075429_100718243
539 Ga0068865_100304557
540 Ga0097620_100125119
541 Ga0097620_100233472
542 Ga0097620_100253666
543 Ga0097620_100542597
544 Ga0075435_100534369
545 Ga0075435_101011418
546 Ga0111539_10011500
547 Ga0111539_10023542
548 Ga0111539_12293234
549 Ga0111539_12758895
550 Ga0105245_10016224
551 Ga0105245_10165593
552 Ga0105245_10517486
553 Ga0105245_12292433
554 Ga0114129_10000013
555 Ga0114129_10003070
556 Ga0114129_10009793
557 Ga0114129_10012378
558 Ga0114129_10061809
559 Ga0114129_10170475
560 Ga0105243_10001933
561 Ga0105243_10191141
562 Ga0105243_10410464
563 Ga0105243_11267025
564 Ga0105241_10184219
565 Ga0105241_10572887
566 Ga0105242_10055519
567 Ga0105242_11057675
568 Ga0105242_12123584
569 Ga0105248_10032325
570 Ga0105237_10246666
571 Ga0105237_11896751
572 Ga0105238_10893323
573 Ga0105238_11849295
574 Ga0105249_10034127
575 Ga0105249_10084323
576 Ga0105249_10111662
577 Ga0105249_10448244
578 Ga0105249_11422345
579 Ga0105239_10007610
580 Ga0105239_10084447
581 Ga0105239_10424433
582 Ga0105246_10013931
583 Ga0105246_10031701
584 Ga0105246_10407942
585 Ga0157369_11255439
586 Ga0157374_10173005
587 Ga0157374_10504698
588 Ga0157378_10029499
589 Ga0157378_10250430
590 Ga0157378_10912201
591 Ga0163162_10399740
592 Ga0163162_10709239
593 Ga0163162_10871978
594 Ga0163162_10930283
595 Ga0163162_11764740
596 Ga0157375_10016331
597 Ga0157375_10130590
598 Ga0157375_10197628
599 Ga0163163_10155446
600 Ga0163163_10847296
601 Ga0157380_10509236
602 Ga0157380_11545072
603 Ga0157377_10008058
604 Ga0157377_11264056
605 Ga0157379_10052840
606 Ga0157379_10720733
607 Ga0157379_11815597
608 Ga0157376_10137588
609 Ga0163161_10072032
610 Ga0207642_10040352
611 Ga0207642_10733396
612 Ga0207688_10005160
613 Ga0207645_10374691
614 Ga0207643_10004432
615 Ga0207654_10617716
616 Ga0207671_10462718
617 Ga0207660_10694130
618 Ga0207662_10000235
619 Ga0207662_10324953
620 Ga0207649_10673428
621 Ga0207681_10790592
622 Ga0207681_11781598
623 Ga0207694_10357527
624 Ga0207650_10219550
625 Ga0207650_10654556
626 Ga0207659_10152303
627 Ga0207659_10186327
628 Ga0207687_10053930
629 Ga0207687_10079199
630 Ga0207687_10126184
631 Ga0207687_10863515
632 Ga0207664_11251513
633 Ga0207690_10233521
634 Ga0207690_10370572
635 Ga0207706_10499462
636 Ga0207686_11058255
637 Ga0207709_10106478
638 Ga0207670_10133905
639 Ga0207670_10217145
640 Ga0207670_11212673
641 Ga0207669_10003428
642 Ga0207691_10574920
643 Ga0207691_11205357
644 Ga0207689_10020345
645 Ga0207679_10172031
646 Ga0207712_10058139
647 Ga0207712_11053702
648 Ga0207640_10206788
649 Ga0207640_10385921
650 Ga0207640_10806002
651 Ga0207677_10083879
652 Ga0207639_10279902
653 Ga0207708_10003096
654 Ga0207708_11558836
655 Ga0207641_11568653
656 Ga0207648_10005704
657 Ga0207676_10538331
658 Ga0207674_10013889
659 Ga0207674_10199639
660 Ga0207675_100177423
661 Ga0207675_100364814
662 Ga0207683_10003546
663 Ga0207698_10106184
664 Ga0209983_1111679
665 Ga0207428_10019385
666 Ga0207428_10095670
667 Ga0268265_10065697
668 Ga0268265_10448544
669 Ga0268265_11940858
670 Ga0316576_10010655
671 Ga0316576_10016585
672 Ga0316578_10782315
673 Ga0316577_10253315
674 Ga0307412_11077322
675 Ga0307415_101680726
676 Ga0373962_0155524
677 Ga0316574_0019894
678 Ga0316574_0177576
679 Ga0316574_0530519
680 Ga0373931_0040868
681 Ga0373931_0212211
682 Ga0316584_0101614
683 Ga0316584_0412004
684 Ga0439435_0044526
685 Ga0439460_0180041
686 Ga0451577_0203430
687 Ga0451577_1358365
688 Ga0453683_0323722
689 Ga0453683_0466810
690 Ga0453683_0521570
691 Ga0453684_0166439
692 Ga0453684_0216874
693 Ga0453684_0451476
694 Ga0453684_1081308
695 Ga0453684_1402359
696 Ga0453684_2146285
697 Ga0451576_0040285
698 Ga0451576_0053610
699 Ga0451576_0306933
700 Ga0451576_0663587
701 Ga0451576_1004948
702 Ga0495676_0943836
703 Ga0496101_0058347
704 Ga0496101_0453623
705 Ga0496102_0028802
706 Ga0496102_1228481
707 Ga0496104_1614136
708 Ga0496105_0376202
709 Ga0496105_0579808
710 Ga0496106_0253785
711 Ga0496106_1520346
712 Ga0496107_0061016
713 Ga0496108_0053344
714 Ga0496108_0253782
715 Ga0496108_0937728
716 Ga0496109_0244661
717 Ga0496109_0356683
718 Ga0496109_0476714
719 Ga0496110_0027525
720 Ga0496110_0105086
721 Ga0496111_0151999
722 Ga0496112_0731709
723 Ga0496114_0356500
724 Ga0496114_1187681
725 Ga0501031_0009705
726 Ga0501032_0140947
727 Ga0501033_0020664
728 Ga0501036_0011823
729 Ga0501036_0961905
730 Ga0501037_0078981
731 Ga0501038_0001818
732 Ga0501039_0002021
733 Ga0501039_0162582
734 Ga0501039_0553425
735 Ga0501040_0029458
736 Ga0501040_0775335
737 Ga0501041_0003716
738 Ga0501042_0003959
739 Ga0501043_0018459
740 Ga0501046_0019203
741 Ga0501046_0161143
742 Ga0501048_0000545
743 Ga0501067_0024137
744 Ga0501068_0002156
745 Ga0501069_0011263
746 Ga0501070_0028257
747 Ga0501071_0002436
748 Ga0501071_0183265
749 Ga0501072_0001771
750 Ga0501072_0800560
751 Ga0501072_0815045
752 Ga0501073_0290014
753 Ga0501074_0005274
754 Ga0501075_0003367
755 Ga0501075_0313846
756 Ga0501075_1396467
757 Ga0501076_0001700
758 Ga0501076_0210452
759 Ga0501076_0960487
760 Ga0501077_0000323
761 Ga0501077_0765020
762 Ga0501251_040293
763 Ga0501245_143425
764 Ga0501079_0001853
765 Ga0501079_0012579
766 Ga0501079_0764253
767 Ga0501080_0016022
768 Ga0501080_0229852
769 Ga0501081_0003830
770 Ga0501081_0130380
771 Ga0501081_0836759
772 Ga0501083_0035363
773 Ga0501035_0045832
774 Ga0501045_0002822
775 Ga0501045_0608629
776 nmdc:mga05p37_146155_c1
777 nmdc:mga05p37_16261_c1
778 nmdc:mga05p37_1666_c1
779 nmdc:mga05p37_17897_c1
780 nmdc:mga05p37_197761_c1
781 nmdc:mga05p37_22949_c1
782 nmdc:mga05p37_43702_c1
783 nmdc:mga09592_186238_c1
784 nmdc:mga09592_67541_c1
785 nmdc:mga09592_973870_c1
786 nmdc:mga0qj67_112868_c1
787 nmdc:mga0qj67_435201_c1
788 nmdc:mga0qj67_49456_c1
789 nmdc:mga06r32_142891_c1
790 nmdc:mga06r32_181451_c1
791 nmdc:mga06r32_341126_c1
792 nmdc:mga06r32_384806_c1
793 nmdc:mga06r32_67858_c1
794 nmdc:mga08y16_1134367_c1
795 nmdc:mga08y16_8392_c1
796 nmdc:mga08y16_89750_c1
797 nmdc:mga0n895_203816_c1
798 nmdc:mga0rr50_759650_c1
799 nmdc:mga0a205_179193_c1
800 nmdc:mga0a205_241458_c1
801 nmdc:mga0a205_413480_c1
802 Ga0501084_0002527
803 Ga0501084_0020705
804 Ga0501084_0165382
805 Ga0501084_0461984
806 Ga0501084_1193217
807 Ga0501082_0002597
808 Ga0501082_0109263
809 Ga0501082_1490699
810 Ga0501082_1670889
811 Ga0530510_0012019
812 Ga0530510_0056536
813 Ga0530510_0074606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pm1-assembly1.cif.gz_B structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) variant i52v a85q 0.8188 20 127
7tbn-assembly2.cif.gz_B lov2-darpin fusion : d11 0.8184 16 130
6zj8-assembly4.cif.gz_D structure of the pas domain from bordetella pertussis bvgs 0.816 7 130
6ywr-assembly1.cif.gz_B structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) q148h variant (space group c2) 0.8157 20 130
6ywi-assembly1.cif.gz_B structure of chloroflexus aggregans flavin based fluorescent protein (cagfbfp) q148e variant 0.8144 20 127
ID Description Score Start End Superfamily
af_A0A1D6KQ74_449_555_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9217 81 127 3.30.450.20
af_Q06067_265_373_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8567 13 127 3.30.450.20
af_Q06067_265_373_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.814 13 127 3.30.450.20
af_P50466_15_144_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8049 19 130 3.30.450.20
af_O82754_88_232_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8026 11 127 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A7W1C6J8-F1-model_v4 PAS domain-containing protein 0.9862 2 128 GO:0006355
AF-A0A537IG20-F1-model_v4 PAS domain-containing protein 0.9817 1 130
AF-A0A537IG20-F1-model_v4 PAS domain-containing protein 0.9743 1 130
AF-A0A7W0YHT7-F1-model_v4 PAS domain-containing protein 0.9732 1 130
AF-A0A538JQ69-F1-model_v4 PAS domain-containing protein 0.9711 1 130

Map