F436203

General Info

Members Datasets Scaffolds Average Seq Length
406 241 812 159

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10529588|Ga0157372_105295884
Length 191
Sequence MGVMKRCVAISPPLGPENDYVRKPRASFVAKKDDSLMSKAYGTVSADRRKEMSGLEFVQGLVEGTLPLNTIAQTLGYDVSEVTSGRVVVTACPSDRHLNPAGTVHGGFAATLLDSCMGLAVQSTLEKGVGQTTLEFKISLVRPITTETGTITAEGVVLSRGRRVGTAEGRITDSKGRLLAHGTTTCLIFQN

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
227 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
228 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
236 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
237 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
238 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.49
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.32
Nodule 0.25
Rhizoplane 4.43
Rhizosphere 77.83
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10529588 3300013307 Bacteria 1373
2 JGI25153J46596_10002918 3300003215 Bacteria 9676
3 rootH1_10086191 3300003323 Bacteria 1279
4 JGI25405J52794_10065035 3300003911 Bacteria 792
5 Ga0070683_100090485 3300005329 Bacteria 2873
6 Ga0070670_100539520 3300005331 Bacteria 1040
7 Ga0070680_100086824 3300005336 Bacteria 2586
8 Ga0070680_100308217 3300005336 Bacteria 1343
9 Ga0070680_100584341 3300005336 Unclassified 958
10 Ga0070689_100808596 3300005340 Bacteria 825
11 Ga0070691_10044103 3300005341 Bacteria 2114
12 Ga0070659_100267682 3300005366 Bacteria 1419
13 Ga0070709_10001551 3300005434 Bacteria 12408
14 Ga0070709_10005702 3300005434 Bacteria 6752
15 Ga0070709_10027845 3300005434 Bacteria 3365
16 Ga0070709_10510796 3300005434 Bacteria 914
17 Ga0070714_100081713 3300005435 Bacteria 2814
18 Ga0070714_100182218 3300005435 Unclassified 1911
19 Ga0070714_100472838 3300005435 Bacteria 1193
20 Ga0070714_100512528 3300005435 Bacteria 1145
21 Ga0070713_100063244 3300005436 Bacteria 3102
22 Ga0070713_100131219 3300005436 Bacteria 2210
23 Ga0070713_100440852 3300005436 Bacteria 1222
24 Ga0070713_100672732 3300005436 Bacteria 987
25 Ga0070713_101210714 3300005436 Bacteria 731
26 Ga0070713_101433216 3300005436 Bacteria 670
27 Ga0070711_100003376 3300005439 Bacteria 9305
28 Ga0070711_100022480 3300005439 Bacteria 4088
29 Ga0070711_100514481 3300005439 Bacteria 988
30 Ga0070711_101274633 3300005439 Bacteria 637
31 Ga0070694_100468832 3300005444 Unclassified 997
32 Ga0070708_100979425 3300005445 Bacteria 793
33 Ga0070708_101170898 3300005445 Unclassified 719
34 Ga0070681_10037625 3300005458 Bacteria 4855
35 Ga0070681_10049738 3300005458 Bacteria 4185
36 Ga0070681_10123764 3300005458 Unclassified 2519
37 Ga0070681_10123790 3300005458 Bacteria 2518
38 Ga0070707_100201385 3300005468 Unclassified 1941
39 Ga0070707_100531272 3300005468 Unclassified 1138
40 Ga0070698_100020145 3300005471 Bacteria 6993
41 Ga0070698_100662637 3300005471 Bacteria 985
42 Ga0070679_100036543 3300005530 Bacteria 4874
43 Ga0070679_100376870 3300005530 Bacteria 1366
44 Ga0070679_101175907 3300005530 Unclassified 712
45 Ga0070684_100022914 3300005535 Bacteria 5215
46 Ga0070697_100020257 3300005536 Bacteria 5261
47 Ga0068853_100478500 3300005539 Bacteria 1174
48 Ga0070695_100061728 3300005545 Unclassified 2432
49 Ga0070693_100515064 3300005547 Bacteria 851
50 Ga0070665_100052907 3300005548 Bacteria 4072
51 Ga0070665_102179342 3300005548 Bacteria 558
52 Ga0068855_100131898 3300005563 Bacteria 2853
53 Ga0068855_100283765 3300005563 Bacteria 1838
54 Ga0068855_100620144 3300005563 Bacteria 1165
55 Ga0068855_100800094 3300005563 Bacteria 1002
56 Ga0068857_100048859 3300005577 Bacteria 3754
57 Ga0068857_100442074 3300005577 Bacteria 1215
58 Ga0068854_100044261 3300005578 Bacteria 3159
59 Ga0068854_100130207 3300005578 Bacteria 1920
60 Ga0068856_100000427 3300005614 Bacteria 46259
61 Ga0068856_100512241 3300005614 Bacteria 1221
62 Ga0068852_100654018 3300005616 Bacteria 1059
63 Ga0068859_100337302 3300005617 Bacteria 1602
64 Ga0068870_10506611 3300005840 Bacteria 805
65 Ga0068862_100298756 3300005844 Bacteria 1481
66 Ga0081455_10001893 3300005937 Bacteria 25166
67 Ga0081455_10001908 3300005937 Bacteria 25029
68 Ga0081455_10276973 3300005937 Bacteria 1214
69 Ga0070717_10016230 3300006028 Bacteria 5770
70 Ga0070717_10175654 3300006028 Bacteria 1865
71 Ga0070717_10404931 3300006028 Bacteria 1226
72 Ga0070717_11131232 3300006028 Bacteria 713
73 Ga0075363_100038414 3300006048 Bacteria 2518
74 Ga0075363_100054769 3300006048 Unclassified 2135
75 Ga0070715_10444813 3300006163 Bacteria 730
76 Ga0070716_100216939 3300006173 Bacteria 1283
77 Ga0070716_100245272 3300006173 Bacteria 1217
78 Ga0070716_100363901 3300006173 Bacteria 1028
79 Ga0070712_100015858 3300006175 Bacteria 4857
80 Ga0070712_100452649 3300006175 Bacteria 1069
81 Ga0070712_101201758 3300006175 Unclassified 659
82 Ga0075362_10021044 3300006177 Bacteria 2732
83 Ga0075362_10085334 3300006177 Bacteria 1460
84 Ga0075362_10223430 3300006177 Bacteria 921
85 Ga0075362_10246025 3300006177 Bacteria 879
86 Ga0075367_10052125 3300006178 Bacteria 2421
87 Ga0075367_10233031 3300006178 Bacteria 1153
88 Ga0075369_10214369 3300006186 Bacteria 890
89 Ga0075369_10393232 3300006186 Bacteria 653
90 Ga0097621_100712181 3300006237 Bacteria 925
91 Ga0075370_10609234 3300006353 Bacteria 662
92 Ga0068871_100185247 3300006358 Bacteria 1791
93 Ga0075428_101799921 3300006844 Unclassified 638
94 Ga0075431_100150676 3300006847 Bacteria 2395
95 Ga0075433_10114209 3300006852 Bacteria 2396
96 Ga0075433_10559086 3300006852 Bacteria 1005
97 Ga0075434_100183426 3300006871 Bacteria 2113
98 Ga0097620_100337310 3300006931 Bacteria 1602
99 Ga0099794_10014202 3300007265 Bacteria 3484
100 Ga0099795_10125532 3300007788 Bacteria 1030
101 Ga0105245_11758830 3300009098 Bacteria 672
102 Ga0105247_10033477 3300009101 Bacteria 3126
103 Ga0105247_10382390 3300009101 Bacteria 998
104 Ga0105247_10648237 3300009101 Bacteria 789
105 Ga0105241_10217635 3300009174 Bacteria 1603
106 Ga0105237_11045082 3300009545 Bacteria 824
107 Ga0105238_10264908 3300009551 Bacteria 1698
108 Ga0105238_10325328 3300009551 Bacteria 1524
109 Ga0105238_10645361 3300009551 Bacteria 1068
110 Ga0105249_10523860 3300009553 Bacteria 1233
111 Ga0105239_10169078 3300010375 Bacteria 2444
112 Ga0157373_10384388 3300013100 Bacteria 1004
113 Ga0157370_10270002 3300013104 Bacteria 1571
114 Ga0157369_10124453 3300013105 Bacteria 2734
115 Ga0157369_10487154 3300013105 Bacteria 1276
116 Ga0157374_10595671 3300013296 Bacteria 1115
117 Ga0157374_11970701 3300013296 Bacteria 610
118 Ga0157372_10053219 3300013307 Bacteria 4511
119 Ga0157375_12116376 3300013308 Unclassified 670
120 Ga0163163_10278472 3300014325 Bacteria 1724
121 Ga0213876_10003517 3300021384 Bacteria 8943
122 Ga0213876_10015742 3300021384 Bacteria 4003
123 Ga0224712_10183728 3300022467 Unclassified 943
124 Ga0209233_1037525 3300025261 Unclassified 1076
125 Ga0209758_1000171 3300025297 Bacteria 148854
126 Ga0207692_10062703 3300025898 Bacteria 1930
127 Ga0207685_10049115 3300025905 Bacteria 1619
128 Ga0207699_10013052 3300025906 Bacteria 4239
129 Ga0207699_10087136 3300025906 Bacteria 1951
130 Ga0207699_10207747 3300025906 Bacteria 1330
131 Ga0207699_10358916 3300025906 Unclassified 1030
132 Ga0207643_10489967 3300025908 Bacteria 785
133 Ga0207654_10042042 3300025911 Bacteria 2584
134 Ga0207707_10016335 3300025912 Bacteria 6475
135 Ga0207707_10039165 3300025912 Bacteria 4144
136 Ga0207707_10046512 3300025912 Bacteria 3780
137 Ga0207707_10614021 3300025912 Unclassified 919
138 Ga0207695_10450281 3300025913 Bacteria 1170
139 Ga0207671_10871471 3300025914 Bacteria 712
140 Ga0207693_10011182 3300025915 Bacteria 7265
141 Ga0207693_10032329 3300025915 Bacteria 4130
142 Ga0207693_10374787 3300025915 Bacteria 1113
143 Ga0207663_10291160 3300025916 Bacteria 1216
144 Ga0207663_10295524 3300025916 Bacteria 1208
145 Ga0207660_10008336 3300025917 Bacteria 6700
146 Ga0207660_10214000 3300025917 Bacteria 1510
147 Ga0207660_10434229 3300025917 Bacteria 1060
148 Ga0207652_10066163 3300025921 Bacteria 3131
149 Ga0207652_10106559 3300025921 Bacteria 2481
150 Ga0207652_10554227 3300025921 Bacteria 1033
151 Ga0207646_10267406 3300025922 Unclassified 1545
152 Ga0207646_10498849 3300025922 Unclassified 1097
153 Ga0207694_10134663 3300025924 Bacteria 1983
154 Ga0207700_10012326 3300025928 Bacteria 5507
155 Ga0207700_10018779 3300025928 Bacteria 4655
156 Ga0207700_10044055 3300025928 Bacteria 3282
157 Ga0207700_10387944 3300025928 Bacteria 1222
158 Ga0207700_10591061 3300025928 Bacteria 987
159 Ga0207700_11005089 3300025928 Bacteria 746
160 Ga0207700_11411929 3300025928 Unclassified 619
161 Ga0207664_10177206 3300025929 Bacteria 1828
162 Ga0207664_10256504 3300025929 Bacteria 1528
163 Ga0207664_10671501 3300025929 Bacteria 932
164 Ga0207690_10747187 3300025932 Bacteria 806
165 Ga0207670_10066739 3300025936 Bacteria 2473
166 Ga0207670_10499397 3300025936 Bacteria 987
167 Ga0207665_10016256 3300025939 Bacteria 4885
168 Ga0207665_10076096 3300025939 Bacteria 2301
169 Ga0207661_10029039 3300025944 Bacteria 4243
170 Ga0207661_10393913 3300025944 Bacteria 1255
171 Ga0207667_10103859 3300025949 Bacteria 2930
172 Ga0207667_10452901 3300025949 Bacteria 1304
173 Ga0207667_10501502 3300025949 Bacteria 1231
174 Ga0207667_10975301 3300025949 Bacteria 836
175 Ga0207667_11425180 3300025949 Bacteria 666
176 Ga0207668_10463792 3300025972 Bacteria 1084
177 Ga0207640_10030435 3300025981 Bacteria 3324
178 Ga0207640_10033197 3300025981 Bacteria 3209
179 Ga0207639_10396480 3300026041 Bacteria 1243
180 Ga0207678_10018474 3300026067 Bacteria 6123
181 Ga0207702_10002818 3300026078 Bacteria 16258
182 Ga0207702_11001610 3300026078 Bacteria 829
183 Ga0207674_10149055 3300026116 Bacteria 2297
184 Ga0207675_100814508 3300026118 Bacteria 948
185 Ga0209813_10082574 3300027866 Bacteria 1065
186 Ga0268266_10113553 3300028379 Bacteria 2402
187 Ga0268266_11185464 3300028379 Bacteria 739
188 Ga0268265_10268300 3300028380 Bacteria 1521
189 Ga0265334_10183395 3300028573 Bacteria 730
190 Ga0265338_10014112 3300028800 Bacteria 8935
191 Ga0265330_10077306 3300031235 Bacteria 1436
192 Ga0265332_10196827 3300031238 Bacteria 838
193 Ga0265325_10002122 3300031241 Bacteria 13536
194 Ga0265325_10022256 3300031241 Bacteria 3475
195 Ga0265340_10033361 3300031247 Bacteria 2563
196 Ga0265340_10180053 3300031247 Bacteria 956
197 Ga0265339_10000151 3300031249 Bacteria 57152
198 Ga0265339_10043704 3300031249 Bacteria 2476
199 Ga0265331_10022997 3300031250 Bacteria 3173
200 Ga0307513_10058162 3300031456 Bacteria 4112
201 Ga0307513_10153773 3300031456 Bacteria 2204
202 Ga0307408_100352257 3300031548 Bacteria 1250
203 Ga0265313_10000366 3300031595 Bacteria 49088
204 Ga0265314_10059839 3300031711 Bacteria 2603
205 Ga0265342_10002139 3300031712 Bacteria 17433
206 Ga0307409_102180071 3300031995 Bacteria 584
207 Ga0307416_101568399 3300032002 Bacteria 764
208 Ga0307507_10045887 3300033179 Bacteria 4292
209 Ga0307510_10186774 3300033180 Bacteria 1626
210 Ga0373926_0045838 3300035083 Bacteria 1568
211 Ga0373934_0028305 3300035086 Bacteria 2183
212 Ga0373934_0134357 3300035086 Bacteria 1010
213 Ga0373944_0050734 3300035089 Bacteria 1307
214 Ga0373923_0041252 3300035111 Bacteria 1902
215 Ga0373932_0081103 3300035112 Bacteria 1025
216 Ga0373936_0026561 3300035113 Bacteria 2267
217 Ga0373945_0028373 3300035116 Bacteria 1961
218 Ga0373953_0053727 3300035117 Bacteria 1633
219 Ga0373954_0034288 3300035118 Bacteria 2351
220 Ga0373956_0008265 3300035119 Bacteria 4212
221 Ga0373946_0067524 3300035171 Unclassified 1536
222 Ga0373946_0105972 3300035171 Bacteria 1266
223 Ga0373946_0152124 3300035171 Bacteria 1080
224 Ga0373955_0082383 3300035172 Bacteria 1820
225 Ga0373955_0094746 3300035172 Bacteria 1706
226 Ga0373924_0109959 3300035410 Bacteria 1190
227 Ga0373935_0112928 3300035692 Bacteria 1805
228 Ga0373935_0214072 3300035692 Bacteria 1336
229 Ga0373935_0307717 3300035692 Unclassified 1121
230 Ga0373927_0030262 3300035695 Bacteria 3533
231 Ga0373927_0128142 3300035695 Bacteria 1657
232 Ga0373927_0201393 3300035695 Bacteria 1307
233 Ga0373933_0001954 3300035724 Bacteria 11880
234 Ga0373933_0536942 3300035724 Bacteria 767
235 Ga0373947_0015330 3300035725 Bacteria 4399
236 Ga0373947_0406230 3300035725 Bacteria 919
237 Ga0373937_0004885 3300036401 Bacteria 11394
238 Ga0373937_0291894 3300036401 Bacteria 1541
239 Ga0373937_0317661 3300036401 Bacteria 1473
240 Ga0373937_1190644 3300036401 Bacteria 710
241 Ga0372808_010703 3300036459 Bacteria 1293
242 Ga0373925_0075735 3300037068 Bacteria 2550
243 Ga0373925_0155062 3300037068 Bacteria 1800
244 Ga0373925_0246487 3300037068 Bacteria 1432
245 Ga0373925_0341430 3300037068 Unclassified 1215
246 Ga0373925_1091946 3300037068 Bacteria 656
247 Ga0436364_1153537 3300037853 Bacteria 1656
248 Ga0436365_0814399 3300039437 Bacteria 20968
249 Ga0436365_1541401 3300039437 Bacteria 3922
250 Ga0436360_1121976 3300039438 Bacteria 4609
251 Ga0436361_0762103 3300039447 Bacteria 1990
252 Ga0436362_0354082 3300039453 Bacteria 728
253 Ga0439465_0041555 3300041413 Bacteria 1489
254 Ga0451787_582603 3300041441 Bacteria 652
255 Ga0466967_0566839 3300045976 Bacteria 1118
256 Ga0495592_0030917 3300046454 Bacteria 4050
257 Ga0495629_0162878 3300046459 Bacteria 1549
258 Ga0495629_0215635 3300046459 Bacteria 1325
259 Ga0495629_0565494 3300046459 Bacteria 762
260 Ga0495638_0008891 3300046460 Bacteria 7084
261 Ga0495641_0056305 3300046461 Bacteria 1783
262 Ga0495651_0001859 3300046462 Bacteria 16335
263 Ga0495651_0297442 3300046462 Bacteria 1084
264 Ga0495653_0006728 3300046463 Bacteria 9437
265 Ga0495650_0025055 3300046471 Bacteria 2805
266 Ga0495580_0022889 3300046472 Bacteria 4593
267 Ga0495580_0479676 3300046472 Bacteria 832
268 Ga0495582_0050237 3300046473 Bacteria 2298
269 Ga0495582_0080516 3300046473 Bacteria 1808
270 Ga0495582_0548238 3300046473 Unclassified 669
271 Ga0495639_0034135 3300046475 Bacteria 2274
272 Ga0495664_0039862 3300046477 Bacteria 2775
273 Ga0495664_0057924 3300046477 Bacteria 2305
274 Ga0495664_0209139 3300046477 Bacteria 1182
275 Ga0495608_0005946 3300046511 Bacteria 8679
276 Ga0495608_0171294 3300046511 Bacteria 1377
277 Ga0495608_0544402 3300046511 Bacteria 700
278 Ga0495618_0008798 3300046514 Bacteria 6096
279 Ga0495618_0057550 3300046514 Bacteria 2462
280 Ga0495628_0025914 3300046516 Bacteria 4788
281 Ga0495628_0085134 3300046516 Bacteria 2453
282 Ga0495630_0023513 3300046517 Bacteria 4556
283 Ga0495666_0066259 3300046526 Bacteria 1722
284 Ga0495666_0108067 3300046526 Bacteria 1308
285 Ga0495652_0020610 3300046529 Bacteria 5859
286 Ga0495665_0014521 3300046531 Bacteria 4248
287 Ga0495665_0225497 3300046531 Bacteria 968
288 Ga0495640_0004302 3300046533 Bacteria 11370
289 Ga0495640_0026271 3300046533 Bacteria 4210
290 Ga0495640_0041244 3300046533 Bacteria 3226
291 Ga0495586_0014002 3300046535 Bacteria 4258
292 Ga0495587_0000568 3300046536 Bacteria 25456
293 Ga0495667_0002917 3300046559 Bacteria 11483
294 Ga0495667_0126719 3300046559 Bacteria 1647
295 Ga0495667_0286157 3300046559 Bacteria 1046
296 Ga0495634_0112137 3300046642 Bacteria 1753
297 Ga0495635_0002478 3300046663 Bacteria 12600
298 Ga0495635_0056564 3300046663 Bacteria 2700
299 Ga0495657_0050178 3300046675 Bacteria 2806
300 Ga0495657_0429776 3300046675 Bacteria 775
301 Ga0495599_0097777 3300046678 Bacteria 1830
302 Ga0495646_0001677 3300046680 Bacteria 13260
303 Ga0495646_0182566 3300046680 Bacteria 1151
304 Ga0495647_0018529 3300046681 Bacteria 2480
305 Ga0495658_0087971 3300046683 Bacteria 1835
306 Ga0495613_0273155 3300046689 Bacteria 1175
307 Ga0495624_0046663 3300046690 Bacteria 2754
308 Ga0495624_0199900 3300046690 Bacteria 1214
309 Ga0495600_0004215 3300046809 Bacteria 8584
310 Ga0495581_0058485 3300047315 Bacteria 2226
311 Ga0495604_0003105 3300047317 Bacteria 13273
312 Ga0495604_0210185 3300047317 Bacteria 1345
313 Ga0495674_0005538 3300047319 Bacteria 12114
314 Ga0495674_0047768 3300047319 Bacteria 3792
315 Ga0495674_0112441 3300047319 Bacteria 2307
316 Ga0495676_0084494 3300047321 Bacteria 2395
317 Ga0495680_0000415 3300047322 Bacteria 47694
318 Ga0495675_0004717 3300047444 Bacteria 8278
319 Ga0495684_0011703 3300047471 Bacteria 6773
320 Ga0495684_0044296 3300047471 Bacteria 3406
321 Ga0495593_0040051 3300047673 Bacteria 2524
322 Ga0495593_0176988 3300047673 Bacteria 1074
323 Ga0495602_0001302 3300048088 Bacteria 24603
324 Ga0495602_0960335 3300048088 Bacteria 566
325 Ga0495602_1118712 3300048088 Bacteria 516
326 Ga0496100_0286139 3300048903 Bacteria 1230
327 Ga0496101_0278345 3300048904 Bacteria 1307
328 Ga0496102_0245008 3300048905 Bacteria 1690
329 Ga0496104_0013029 3300048907 Bacteria 7488
330 Ga0496105_0030200 3300048908 Bacteria 4441
331 Ga0496105_0160845 3300048908 Bacteria 1843
332 Ga0496106_0383052 3300048909 Bacteria 1130
333 Ga0496108_0993256 3300048911 Bacteria 717
334 Ga0496112_0105422 3300048915 Bacteria 2789
335 Ga0496113_0062650 3300048916 Bacteria 2809
336 Ga0496113_0256985 3300048916 Bacteria 1395
337 Ga0496113_1044753 3300048916 Bacteria 642
338 Ga0496114_0744939 3300048917 Bacteria 857
339 Ga0496115_0057416 3300048918 Bacteria 3131
340 Ga0496115_0101895 3300048918 Bacteria 2354
341 Ga0496115_0188121 3300048918 Bacteria 1706
342 Ga0496115_1234262 3300048918 Bacteria 560
343 Ga0496117_0103024 3300048920 Bacteria 1800
344 Ga0496118_0007984 3300048921 Bacteria 11063
345 Ga0496121_0017933 3300048924 Bacteria 7181
346 Ga0496121_0034859 3300048924 Bacteria 4520
347 Ga0496121_0295238 3300048924 Bacteria 1102
348 Ga0496121_0632318 3300048924 Bacteria 655
349 Ga0496122_0020869 3300048925 Bacteria 5892
350 Ga0496126_0040728 3300048929 Bacteria 4305
351 Ga0496126_0055313 3300048929 Bacteria 3591
352 Ga0496126_0090067 3300048929 Bacteria 2699
353 Ga0501047_0280920 3300049581 Bacteria 1509
354 Ga0501069_0610482 3300049585 Bacteria 655
355 Ga0501080_0006035 3300049742 Bacteria 10855
356 Ga0501044_0024098 3300049823 Bacteria 6466
357 nmdc:mga03683_225864_c1 3300050489 Bacteria 865
358 nmdc:mga03683_24150_c1 3300050489 Bacteria 2376
359 nmdc:mga03683_43316_c1 3300050489 Bacteria 1856
360 nmdc:mga03683_6002_c1 3300050489 Bacteria 1590
361 nmdc:mga03n38_22326_c1 3300050490 Bacteria 2559
362 nmdc:mga03n38_62309_c1 3300050490 Unclassified 1701
363 nmdc:mga0yw44_137760_c1 3300050492 Unclassified 1584
364 nmdc:mga0k408_13543_c2 3300050493 Bacteria 4109
365 nmdc:mga06z11_418583_c1 3300050494 Bacteria 807
366 nmdc:mga06z11_55657_c1 3300050494 Bacteria 2043
367 nmdc:mga04h51_170463_c1 3300050495 Bacteria 842
368 nmdc:mga04h51_97885_c1 3300050495 Bacteria 1065
369 nmdc:mga07m45_292047_c1 3300050496 Bacteria 948
370 nmdc:mga07m45_431478_c1 3300050496 Bacteria 764
371 nmdc:mga06r32_1592274_c1 3300050510 Unclassified 592
372 nmdc:mga0n895_155262_c1 3300050512 Bacteria 2319
373 nmdc:mga0n895_715509_c1 3300050512 Bacteria 996
374 nmdc:mga0rr50_17450_c1 3300050513 Bacteria 4794
375 nmdc:mga0a205_484409_c1 3300050515 Bacteria 1095
376 nmdc:mga0sz30_140002_c1 3300050516 Bacteria 1068
377 Ga0495601_0002107 3300053077 Bacteria 11187
378 Ga0495612_0002657 3300053078 Bacteria 7372
379 Ga0495612_0067462 3300053078 Bacteria 1488
380 Ga0500635_0150652 3300053080 Bacteria 887
381 Ga0500635_0260309 3300053080 Bacteria 681
382 Ga0495595_0000265 3300053084 Bacteria 20703
383 Ga0495595_0214831 3300053084 Bacteria 959
384 Ga0495619_0001718 3300053085 Bacteria 14528
385 Ga0495619_0333828 3300053085 Bacteria 1049
386 Ga0495619_0471365 3300053085 Bacteria 865
387 Ga0500583_0139345 3300053092 Bacteria 1205
388 Ga0500554_002890 3300053102 Bacteria 3437
389 Ga0500572_001728 3300053111 Bacteria 5671
390 Ga0500595_129860 3300053119 Bacteria 709
391 Ga0500642_0126747 3300053130 Bacteria 1196
392 Ga0500658_0107999 3300053134 Bacteria 1222
393 Ga0500559_0280438 3300053136 Bacteria 784
394 Ga0500568_0004163 3300053139 Bacteria 7811
395 Ga0500568_0016643 3300053139 Bacteria 3262
396 Ga0500568_0111696 3300053139 Bacteria 1021
397 Ga0500577_0026118 3300053142 Bacteria 1985
398 Ga0500590_046818 3300053148 Bacteria 2209
399 Ga0500603_001337 3300053150 Bacteria 5656
400 Ga0500620_069910 3300053155 Bacteria 1206
401 Ga0500638_011579 3300053162 Bacteria 3919
402 Ga0500639_188732 3300053163 Bacteria 901
403 Ga0500636_0000346 3300053177 Bacteria 25557
404 Ga0500636_0125446 3300053177 Bacteria 1436
405 Ga0501082_0001642 3300060353 Bacteria 19713
406 2513639680 2513237094 Bacteria 8789602
407 Ga0157372_10529588
408 JGI25153J46596_10002918
409 rootH1_10086191
410 JGI25405J52794_10065035
411 Ga0070683_100090485
412 Ga0070670_100539520
413 Ga0070680_100086824
414 Ga0070680_100308217
415 Ga0070680_100584341
416 Ga0070689_100808596
417 Ga0070691_10044103
418 Ga0070659_100267682
419 Ga0070709_10001551
420 Ga0070709_10005702
421 Ga0070709_10027845
422 Ga0070709_10510796
423 Ga0070714_100081713
424 Ga0070714_100182218
425 Ga0070714_100472838
426 Ga0070714_100512528
427 Ga0070713_100063244
428 Ga0070713_100131219
429 Ga0070713_100440852
430 Ga0070713_100672732
431 Ga0070713_101210714
432 Ga0070713_101433216
433 Ga0070711_100003376
434 Ga0070711_100022480
435 Ga0070711_100514481
436 Ga0070711_101274633
437 Ga0070694_100468832
438 Ga0070708_100979425
439 Ga0070708_101170898
440 Ga0070681_10037625
441 Ga0070681_10049738
442 Ga0070681_10123764
443 Ga0070681_10123790
444 Ga0070707_100201385
445 Ga0070707_100531272
446 Ga0070698_100020145
447 Ga0070698_100662637
448 Ga0070679_100036543
449 Ga0070679_100376870
450 Ga0070679_101175907
451 Ga0070684_100022914
452 Ga0070697_100020257
453 Ga0068853_100478500
454 Ga0070695_100061728
455 Ga0070693_100515064
456 Ga0070665_100052907
457 Ga0070665_102179342
458 Ga0068855_100131898
459 Ga0068855_100283765
460 Ga0068855_100620144
461 Ga0068855_100800094
462 Ga0068857_100048859
463 Ga0068857_100442074
464 Ga0068854_100044261
465 Ga0068854_100130207
466 Ga0068856_100000427
467 Ga0068856_100512241
468 Ga0068852_100654018
469 Ga0068859_100337302
470 Ga0068870_10506611
471 Ga0068862_100298756
472 Ga0081455_10001893
473 Ga0081455_10001908
474 Ga0081455_10276973
475 Ga0070717_10016230
476 Ga0070717_10175654
477 Ga0070717_10404931
478 Ga0070717_11131232
479 Ga0075363_100038414
480 Ga0075363_100054769
481 Ga0070715_10444813
482 Ga0070716_100216939
483 Ga0070716_100245272
484 Ga0070716_100363901
485 Ga0070712_100015858
486 Ga0070712_100452649
487 Ga0070712_101201758
488 Ga0075362_10021044
489 Ga0075362_10085334
490 Ga0075362_10223430
491 Ga0075362_10246025
492 Ga0075367_10052125
493 Ga0075367_10233031
494 Ga0075369_10214369
495 Ga0075369_10393232
496 Ga0097621_100712181
497 Ga0075370_10609234
498 Ga0068871_100185247
499 Ga0075428_101799921
500 Ga0075431_100150676
501 Ga0075433_10114209
502 Ga0075433_10559086
503 Ga0075434_100183426
504 Ga0097620_100337310
505 Ga0099794_10014202
506 Ga0099795_10125532
507 Ga0105245_11758830
508 Ga0105247_10033477
509 Ga0105247_10382390
510 Ga0105247_10648237
511 Ga0105241_10217635
512 Ga0105237_11045082
513 Ga0105238_10264908
514 Ga0105238_10325328
515 Ga0105238_10645361
516 Ga0105249_10523860
517 Ga0105239_10169078
518 Ga0157373_10384388
519 Ga0157370_10270002
520 Ga0157369_10124453
521 Ga0157369_10487154
522 Ga0157374_10595671
523 Ga0157374_11970701
524 Ga0157372_10053219
525 Ga0157375_12116376
526 Ga0163163_10278472
527 Ga0213876_10003517
528 Ga0213876_10015742
529 Ga0224712_10183728
530 Ga0209233_1037525
531 Ga0209758_1000171
532 Ga0207692_10062703
533 Ga0207685_10049115
534 Ga0207699_10013052
535 Ga0207699_10087136
536 Ga0207699_10207747
537 Ga0207699_10358916
538 Ga0207643_10489967
539 Ga0207654_10042042
540 Ga0207707_10016335
541 Ga0207707_10039165
542 Ga0207707_10046512
543 Ga0207707_10614021
544 Ga0207695_10450281
545 Ga0207671_10871471
546 Ga0207693_10011182
547 Ga0207693_10032329
548 Ga0207693_10374787
549 Ga0207663_10291160
550 Ga0207663_10295524
551 Ga0207660_10008336
552 Ga0207660_10214000
553 Ga0207660_10434229
554 Ga0207652_10066163
555 Ga0207652_10106559
556 Ga0207652_10554227
557 Ga0207646_10267406
558 Ga0207646_10498849
559 Ga0207694_10134663
560 Ga0207700_10012326
561 Ga0207700_10018779
562 Ga0207700_10044055
563 Ga0207700_10387944
564 Ga0207700_10591061
565 Ga0207700_11005089
566 Ga0207700_11411929
567 Ga0207664_10177206
568 Ga0207664_10256504
569 Ga0207664_10671501
570 Ga0207690_10747187
571 Ga0207670_10066739
572 Ga0207670_10499397
573 Ga0207665_10016256
574 Ga0207665_10076096
575 Ga0207661_10029039
576 Ga0207661_10393913
577 Ga0207667_10103859
578 Ga0207667_10452901
579 Ga0207667_10501502
580 Ga0207667_10975301
581 Ga0207667_11425180
582 Ga0207668_10463792
583 Ga0207640_10030435
584 Ga0207640_10033197
585 Ga0207639_10396480
586 Ga0207678_10018474
587 Ga0207702_10002818
588 Ga0207702_11001610
589 Ga0207674_10149055
590 Ga0207675_100814508
591 Ga0209813_10082574
592 Ga0268266_10113553
593 Ga0268266_11185464
594 Ga0268265_10268300
595 Ga0265334_10183395
596 Ga0265338_10014112
597 Ga0265330_10077306
598 Ga0265332_10196827
599 Ga0265325_10002122
600 Ga0265325_10022256
601 Ga0265340_10033361
602 Ga0265340_10180053
603 Ga0265339_10000151
604 Ga0265339_10043704
605 Ga0265331_10022997
606 Ga0307513_10058162
607 Ga0307513_10153773
608 Ga0307408_100352257
609 Ga0265313_10000366
610 Ga0265314_10059839
611 Ga0265342_10002139
612 Ga0307409_102180071
613 Ga0307416_101568399
614 Ga0307507_10045887
615 Ga0307510_10186774
616 Ga0373926_0045838
617 Ga0373934_0028305
618 Ga0373934_0134357
619 Ga0373944_0050734
620 Ga0373923_0041252
621 Ga0373932_0081103
622 Ga0373936_0026561
623 Ga0373945_0028373
624 Ga0373953_0053727
625 Ga0373954_0034288
626 Ga0373956_0008265
627 Ga0373946_0067524
628 Ga0373946_0105972
629 Ga0373946_0152124
630 Ga0373955_0082383
631 Ga0373955_0094746
632 Ga0373924_0109959
633 Ga0373935_0112928
634 Ga0373935_0214072
635 Ga0373935_0307717
636 Ga0373927_0030262
637 Ga0373927_0128142
638 Ga0373927_0201393
639 Ga0373933_0001954
640 Ga0373933_0536942
641 Ga0373947_0015330
642 Ga0373947_0406230
643 Ga0373937_0004885
644 Ga0373937_0291894
645 Ga0373937_0317661
646 Ga0373937_1190644
647 Ga0372808_010703
648 Ga0373925_0075735
649 Ga0373925_0155062
650 Ga0373925_0246487
651 Ga0373925_0341430
652 Ga0373925_1091946
653 Ga0436364_1153537
654 Ga0436365_0814399
655 Ga0436365_1541401
656 Ga0436360_1121976
657 Ga0436361_0762103
658 Ga0436362_0354082
659 Ga0439465_0041555
660 Ga0451787_582603
661 Ga0466967_0566839
662 Ga0495592_0030917
663 Ga0495629_0162878
664 Ga0495629_0215635
665 Ga0495629_0565494
666 Ga0495638_0008891
667 Ga0495641_0056305
668 Ga0495651_0001859
669 Ga0495651_0297442
670 Ga0495653_0006728
671 Ga0495650_0025055
672 Ga0495580_0022889
673 Ga0495580_0479676
674 Ga0495582_0050237
675 Ga0495582_0080516
676 Ga0495582_0548238
677 Ga0495639_0034135
678 Ga0495664_0039862
679 Ga0495664_0057924
680 Ga0495664_0209139
681 Ga0495608_0005946
682 Ga0495608_0171294
683 Ga0495608_0544402
684 Ga0495618_0008798
685 Ga0495618_0057550
686 Ga0495628_0025914
687 Ga0495628_0085134
688 Ga0495630_0023513
689 Ga0495666_0066259
690 Ga0495666_0108067
691 Ga0495652_0020610
692 Ga0495665_0014521
693 Ga0495665_0225497
694 Ga0495640_0004302
695 Ga0495640_0026271
696 Ga0495640_0041244
697 Ga0495586_0014002
698 Ga0495587_0000568
699 Ga0495667_0002917
700 Ga0495667_0126719
701 Ga0495667_0286157
702 Ga0495634_0112137
703 Ga0495635_0002478
704 Ga0495635_0056564
705 Ga0495657_0050178
706 Ga0495657_0429776
707 Ga0495599_0097777
708 Ga0495646_0001677
709 Ga0495646_0182566
710 Ga0495647_0018529
711 Ga0495658_0087971
712 Ga0495613_0273155
713 Ga0495624_0046663
714 Ga0495624_0199900
715 Ga0495600_0004215
716 Ga0495581_0058485
717 Ga0495604_0003105
718 Ga0495604_0210185
719 Ga0495674_0005538
720 Ga0495674_0047768
721 Ga0495674_0112441
722 Ga0495676_0084494
723 Ga0495680_0000415
724 Ga0495675_0004717
725 Ga0495684_0011703
726 Ga0495684_0044296
727 Ga0495593_0040051
728 Ga0495593_0176988
729 Ga0495602_0001302
730 Ga0495602_0960335
731 Ga0495602_1118712
732 Ga0496100_0286139
733 Ga0496101_0278345
734 Ga0496102_0245008
735 Ga0496104_0013029
736 Ga0496105_0030200
737 Ga0496105_0160845
738 Ga0496106_0383052
739 Ga0496108_0993256
740 Ga0496112_0105422
741 Ga0496113_0062650
742 Ga0496113_0256985
743 Ga0496113_1044753
744 Ga0496114_0744939
745 Ga0496115_0057416
746 Ga0496115_0101895
747 Ga0496115_0188121
748 Ga0496115_1234262
749 Ga0496117_0103024
750 Ga0496118_0007984
751 Ga0496121_0017933
752 Ga0496121_0034859
753 Ga0496121_0295238
754 Ga0496121_0632318
755 Ga0496122_0020869
756 Ga0496126_0040728
757 Ga0496126_0055313
758 Ga0496126_0090067
759 Ga0501047_0280920
760 Ga0501069_0610482
761 Ga0501080_0006035
762 Ga0501044_0024098
763 nmdc:mga03683_225864_c1
764 nmdc:mga03683_24150_c1
765 nmdc:mga03683_43316_c1
766 nmdc:mga03683_6002_c1
767 nmdc:mga03n38_22326_c1
768 nmdc:mga03n38_62309_c1
769 nmdc:mga0yw44_137760_c1
770 nmdc:mga0k408_13543_c2
771 nmdc:mga06z11_418583_c1
772 nmdc:mga06z11_55657_c1
773 nmdc:mga04h51_170463_c1
774 nmdc:mga04h51_97885_c1
775 nmdc:mga07m45_292047_c1
776 nmdc:mga07m45_431478_c1
777 nmdc:mga06r32_1592274_c1
778 nmdc:mga0n895_155262_c1
779 nmdc:mga0n895_715509_c1
780 nmdc:mga0rr50_17450_c1
781 nmdc:mga0a205_484409_c1
782 nmdc:mga0sz30_140002_c1
783 Ga0495601_0002107
784 Ga0495612_0002657
785 Ga0495612_0067462
786 Ga0500635_0150652
787 Ga0500635_0260309
788 Ga0495595_0000265
789 Ga0495595_0214831
790 Ga0495619_0001718
791 Ga0495619_0333828
792 Ga0495619_0471365
793 Ga0500583_0139345
794 Ga0500554_002890
795 Ga0500572_001728
796 Ga0500595_129860
797 Ga0500642_0126747
798 Ga0500658_0107999
799 Ga0500559_0280438
800 Ga0500568_0004163
801 Ga0500568_0016643
802 Ga0500568_0111696
803 Ga0500577_0026118
804 Ga0500590_046818
805 Ga0500603_001337
806 Ga0500620_069910
807 Ga0500638_011579
808 Ga0500639_188732
809 Ga0500636_0000346
810 Ga0500636_0125446
811 Ga0501082_0001642
812 2513639680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

101

180

0.96

PF14539

DUF4442

Domain of unknown function (DUF4442)

66

188

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.9598 36 154
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9587 36 156
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9522 35 152
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9512 35 152
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9392 35 154
ID Description Score Start End Superfamily
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9512 35 152 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9448 36 154 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9337 35 156 3.10.129.10
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9317 38 154 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9302 36 155 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7Y6T364-F1-model_v4 deleted 1.003 3 156
AF-A0A537Q684-F1-model_v4 PaaI family thioesterase 1.002 3 156 GO:0047617
AF-A0A1H8Y1B6-F1-model_v4 Uncharacterized domain 1-containing protein 1.001 3 156 GO:0047617
AF-A0A1F4BJ79-F1-model_v4 Thioesterase domain-containing protein 0.9987 43 154 GO:0005829
GO:0061522
AF-A0A5B0BCF2-F1-model_v4 PaaI family thioesterase 0.9983 31 156 GO:0005829
GO:0061522

Map