metagRoot

F436195

General Info

Members	Datasets	Scaffolds	Average Seq Length
406	263	366	351

Family's Representative Sequence

Representative Sequence	3300013100\|Ga0157373_10001909\|Ga0157373_100019092
Length	419
Sequence	MSDDIYCRKPSNLTRTADEQRCREYSQTCHTLRPDLNDRTLTFSAARLSLIAVTDTFWLTIEDRKMIKTYSYAAQKPTDKLAPFQIERRDPGADDVQIDILFCGVCHSDLHTARNEWNNTLYPSVPGHEIVGKVTAVGANVKNFKVGDLAGVGCMVDSCQHCASCAEGEEQYCESGFTGTYNGPVFGGENTYGGYSDKIVVKEKFVLKISHSDNLAAVAPLLCAGITTYSPLHHWKVGPGKKVGVVGLGGLGHMAVKIAHAMGAHVVLFTTSPNKREDGLRLGADEVVVSKDPKEMATQTNKLDFILNTVAAPHDLDAFLNLLKRDGTMTLVGAPDSPHPSPSVFNLIFKRRSLAGSLIGGVKETQEMLDFCAKHGIVSDIEMIHMKDINEAYERMVKGDVKYRFVIDMATLKEQASAA

Samples

	Sample ID	Description	Type	Environment
1	2162886011	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
2	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
3	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
4	2599185359	Sphingomonas sp. NFR04	Isolate	Rhizoplane
5	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
6	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
7	2643221681	Aeromicrobium sp. Root472D3	Isolate	Unclassified
8	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
9	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
10	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
11	2806310673	Serratia quinivorans NCTC 13189	Isolate	Rhizosphere
12	2808606373	Pseudomonas sp. SLBN-2	Isolate	Unclassified
13	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
14	2818991457	Xanthomonas translucens 569	Isolate	Unclassified
15	2818991466	Sphingomonas trueperi 1152a	Isolate	Unclassified
16	2826581358	Pseudomonas viridiflava CDRTc14	Isolate	Unclassified
17	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
18	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
19	2848297114	Croceibacterium ferulae EGI 63111	Isolate	Unclassified
20	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
21	2896344016	Sphingobacterium sp. SGL-16	Isolate	Rhizosphere
22	2910245624	Adhaeribacter radiodurans KUDC8001	Isolate	Rhizosphere
23	2912723979	Streptomyces sp. NEAU-sy36	Isolate	Rhizosphere
24	2914759650	Rhizosphaericola mali	Isolate	Rhizosphere
25	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
26	2928526807	Sphingomonas trueperi 1770	Isolate	Rhizosphere
27	2928968154	Sphingomonas trueperi 1075	Isolate	Unclassified
28	2929177148	Chitinophaga sp. R-72269 Hybrid assembly	Isolate	Unclassified
29	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
30	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
31	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
32	2945977869	Chitinophaga sp. W2I13	Isolate	Rhizosphere
33	2946013367	Chitinophaga sp. W3I9	Isolate	Rhizosphere
34	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
35	2977264416	Microbacterium testaceum SORGH_AS 594	Isolate	Unclassified
36	3007252601	Pseudomonas punonensis D1-6	Isolate	Unclassified
37	3007315729	Pseudomonas argentinensis SA190	Isolate	Unclassified
38	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
39	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
40	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
41	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
42	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
43	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
44	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
45	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
46	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
47	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
48	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
49	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
50	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
51	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
52	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
53	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
54	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
55	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
56	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
57	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
58	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
59	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
60	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
61	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
62	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
63	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
64	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
65	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
66	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
67	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
68	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
69	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
70	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
71	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
72	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
73	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
74	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
75	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
76	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
77	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
79	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
81	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
82	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
83	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
84	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
85	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
86	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
87	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
88	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
89	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
90	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
91	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
92	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
96	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
97	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
98	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
99	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
100	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
101	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
102	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
120	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
123	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
124	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
125	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
126	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
127	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
128	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
129	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
130	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
131	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
132	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
133	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
134	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
135	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
136	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
137	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
138	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
139	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
140	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
141	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
142	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
143	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
144	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
145	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
146	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
147	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
148	3300042118	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156	Metagenome	Rhizosphere
149	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
150	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
151	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
152	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
153	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
154	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
155	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
156	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
157	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
158	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
159	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
160	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
161	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
162	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
163	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
164	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
165	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
166	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
167	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
168	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
169	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
170	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
171	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
172	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
173	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
174	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
175	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
176	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
177	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
178	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
179	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
180	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
181	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
182	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
183	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
184	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
185	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
186	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
187	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
188	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
189	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
190	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
191	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
192	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
193	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
194	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
195	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
196	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
197	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
198	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
199	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
200	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
201	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
202	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
203	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
204	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
205	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
206	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
207	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
208	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
209	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
210	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
211	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
212	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
213	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
214	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
215	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
216	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
217	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
218	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
219	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
220	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
221	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
222	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
223	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
224	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
225	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
226	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
227	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
228	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
229	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
230	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
231	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
232	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
233	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
235	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
236	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
238	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
239	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
240	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
241	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
242	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
243	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
244	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
245	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
248	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
249	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
250	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
251	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
252	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
253	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
254	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
255	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
256	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
257	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
258	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
259	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
260	8021626552	Xanthomonas sp. LMG12460	Isolate	Rhizosphere
261	8021648035	Xanthomonas sp. LMG 12461	Isolate	Rhizosphere
262	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
263	8056148874	Pseudomonas khavaziana SWRI124	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	90.15
Metatranscriptomes	0
Isolates	9.85

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.67
Nodule	0.74
Rhizoplane	4.43
Rhizosphere	76.85
Stem	0
Stem Tuber	0
Unclassified	12.32

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MRS1b_contig_3205798	2162886011	Bacteria	1897
2	JGI24739J22299_10006744	3300001989	Bacteria	4323
3	JGI25153J46596_10014905	3300003215	Bacteria	3200
4	JGI25160J50197_1016662	3300003354	Bacteria	2358
5	Ga0055528_1000901	3300003790	Bacteria	20035
6	Ga0055531_10000003	3300003794	Bacteria	274424
7	Ga0055543_1009805	3300004625	Bacteria	2037
8	Ga0065165_1000012	3300005262	Bacteria	303241
9	Ga0065714_10002453	3300005288	Bacteria	27201
10	Ga0065714_10064455	3300005288	Bacteria	72722
11	Ga0065714_10065523	3300005288	Bacteria	9615
12	Ga0065712_10067896	3300005290	Bacteria	22138
13	Ga0070658_10256601	3300005327	Bacteria	1484
14	Ga0070676_10005277	3300005328	Bacteria	6870
15	Ga0070683_100136431	3300005329	Bacteria	2324
16	Ga0070670_100026041	3300005331	Bacteria	5034
17	Ga0070666_10009122	3300005335	Bacteria	6186
18	Ga0070661_100000831	3300005344	Bacteria	22200
19	Ga0070692_10003555	3300005345	Bacteria	6343
20	Ga0070674_100010731	3300005356	Bacteria	5553
21	Ga0070674_100214478	3300005356	Bacteria	1494
22	Ga0070694_100000350	3300005444	Bacteria	24736
23	Ga0070694_100026590	3300005444	Bacteria	3752
24	Ga0070681_10000322	3300005458	Bacteria	39028
25	Ga0068867_100425111	3300005459	Bacteria	1126
26	Ga0070685_10003442	3300005466	Bacteria	8051
27	Ga0070706_100000292	3300005467	Bacteria	60823
28	Ga0070684_100040603	3300005535	Bacteria	4008
29	Ga0070665_100000866	3300005548	Bacteria	39221
30	Ga0070704_100002191	3300005549	Bacteria	10881
31	Ga0068855_100096790	3300005563	Bacteria	3400
32	Ga0070664_100000996	3300005564	Bacteria	22200
33	Ga0070664_100043153	3300005564	Bacteria	3805
34	Ga0068854_100067438	3300005578	Bacteria	2607
35	Ga0068854_100083678	3300005578	Bacteria	2359
36	Ga0068859_100047273	3300005617	Bacteria	4323
37	Ga0075428_100063455	3300006844	Bacteria	4044
38	Ga0075428_100102605	3300006844	Bacteria	3119
39	Ga0075430_100009980	3300006846	Bacteria	8034
40	Ga0075431_100068240	3300006847	Bacteria	3669
41	Ga0075434_100215251	3300006871	Bacteria	1941
42	Ga0075429_100093410	3300006880	Bacteria	2624
43	Ga0079104_1004040	3300006946	Bacteria	6482
44	Ga0105251_10000003	3300009011	Bacteria	311814
45	Ga0105251_10000633	3300009011	Bacteria	32276
46	Ga0105251_10020142	3300009011	Bacteria	3509
47	Ga0105244_10006756	3300009036	Bacteria	7378
48	Ga0105250_10000281	3300009092	Bacteria	41386
49	Ga0105240_10001116	3300009093	Bacteria	47225
50	Ga0105240_10024394	3300009093	Bacteria	7971
51	Ga0111539_10002540	3300009094	Bacteria	24163
52	Ga0105245_10133299	3300009098	Bacteria	2332
53	Ga0114129_10658272	3300009147	Bacteria	1351
54	Ga0105243_10266064	3300009148	Bacteria	1537
55	Ga0105242_10190370	3300009176	Bacteria	1816
56	Ga0105248_10264332	3300009177	Bacteria	1937
57	Ga0105237_10077218	3300009545	Bacteria	3321
58	Ga0105237_10329909	3300009545	Bacteria	1530
59	Ga0105238_10301119	3300009551	Bacteria	1587
60	Ga0105239_10000546	3300010375	Bacteria	53959
61	Ga0105246_10026878	3300011119	Bacteria	3766
62	Ga0157373_10001909	3300013100	Bacteria	15810
63	Ga0157373_10005223	3300013100	Bacteria	9751
64	Ga0157371_10003733	3300013102	Bacteria	13644
65	Ga0157371_10024363	3300013102	Bacteria	4420
66	Ga0157370_10019128	3300013104	Bacteria	6885
67	Ga0157370_10175054	3300013104	Bacteria	1994
68	Ga0157374_10161166	3300013296	Bacteria	2185
69	Ga0163162_10050443	3300013306	Bacteria	4173
70	Ga0163162_10104311	3300013306	Bacteria	2930
71	Ga0163162_10178445	3300013306	Bacteria	2250
72	Ga0157372_10084956	3300013307	Bacteria	3589
73	Ga0157375_10042919	3300013308	Bacteria	4381
74	Ga0157375_10124226	3300013308	Bacteria	2694
75	Ga0163163_10138953	3300014325	Bacteria	2471
76	Ga0182006_1002849	3300015261	Bacteria	9213
77	Ga0182006_1004430	3300015261	Bacteria	6932
78	Ga0163161_10006813	3300017792	Bacteria	7901
79	Ga0163161_10030139	3300017792	Bacteria	3859
80	Ga0213876_10017544	3300021384	Bacteria	3779
81	Ga0209673_1000016	3300025273	Bacteria	506202
82	Ga0209673_1000111	3300025273	Bacteria	180094
83	Ga0209564_1002602	3300025295	Bacteria	13826
84	Ga0209564_1005327	3300025295	Bacteria	7405
85	Ga0209758_1005142	3300025297	Bacteria	10325
86	Ga0209758_1005828	3300025297	Bacteria	9207
87	Ga0207426_1003382	3300025302	Bacteria	8751
88	Ga0209257_1000008	3300025304	Bacteria	1294570
89	Ga0207696_1000109	3300025711	Bacteria	156361
90	Ga0207655_1007673	3300025728	Bacteria	6963
91	Ga0207713_1000009	3300025735	Bacteria	551314
92	Ga0207713_1001214	3300025735	Bacteria	21569
93	Ga0207645_10033046	3300025907	Bacteria	3326
94	Ga0207705_10171872	3300025909	Bacteria	1632
95	Ga0207684_10000347	3300025910	Bacteria	64001
96	Ga0207707_10000252	3300025912	Bacteria	58932
97	Ga0207695_10000288	3300025913	Bacteria	125085
98	Ga0207695_10042302	3300025913	Bacteria	4868
99	Ga0207671_10002884	3300025914	Bacteria	17804
100	Ga0207671_10107760	3300025914	Bacteria	2117
101	Ga0207671_10235061	3300025914	Bacteria	1438
102	Ga0207649_10000088	3300025920	Bacteria	77105
103	Ga0207650_10000357	3300025925	Bacteria	44045
104	Ga0207669_10002025	3300025937	Bacteria	8599
105	Ga0207665_10080390	3300025939	Bacteria	2242
106	Ga0207661_10118176	3300025944	Bacteria	2253
107	Ga0207679_10000034	3300025945	Bacteria	147162
108	Ga0207679_10297694	3300025945	Bacteria	1389
109	Ga0207640_10034241	3300025981	Bacteria	3168
110	Ga0209281_1002776	3300027111	Bacteria	6488
111	Ga0209371_1000135	3300027312	Bacteria	121718
112	Ga0268266_10005944	3300028379	Bacteria	11283
113	Ga0265326_10008154	3300028558	Bacteria	3171
114	Ga0265334_10000006	3300028573	Bacteria	235168
115	Ga0265336_10034881	3300028666	Bacteria	1553
116	Ga0307517_10000963	3300028786	Bacteria	48832
117	Ga0268256_1000148	3300030500	Bacteria	94347
118	Ga0316183_1086246	3300030742	Bacteria	40321
119	Ga0316181_1280322	3300030744	Bacteria	32733
120	Ga0265328_10010456	3300031239	Bacteria	3734
121	Ga0265313_10000194	3300031595	Bacteria	65054
122	Ga0265313_10000521	3300031595	Bacteria	40290
123	Ga0307405_10215103	3300031731	Bacteria	1406
124	Ga0307412_10009315	3300031911	Bacteria	5629
125	Ga0307412_10132316	3300031911	Bacteria	1814
126	Ga0307409_100017736	3300031995	Bacteria	4757
127	Ga0307409_100099199	3300031995	Bacteria	2411
128	Ga0307416_100048666	3300032002	Bacteria	3365
129	Ga0307416_100074508	3300032002	Bacteria	2836
130	Ga0307414_10032477	3300032004	Bacteria	3437
131	Ga0373936_0000058	3300035113	Bacteria	53674
132	Ga0373939_0040357	3300035114	Bacteria	1401
133	Ga0373961_0002270	3300035241	Bacteria	5033
134	Ga0373961_0004595	3300035241	Bacteria	3332
135	Ga0316574_0045123	3300035398	Bacteria	2729
136	Ga0373931_0036469	3300035691	Bacteria	2563
137	Ga0395899_0131629	3300037312	Bacteria	1785
138	Ga0395900_0175166	3300037418	Bacteria	2182
139	Ga0395898_0306959	3300037466	Bacteria	1513
140	Ga0395905_0001835	3300037471	Bacteria	24545
141	Ga0395901_0580591	3300038443	Bacteria	1132
142	Ga0436365_0231409	3300039437	Bacteria	26477
143	Ga0450911_000020	3300042115	Bacteria	101786
144	Ga0450914_001859	3300042118	Bacteria	1414
145	Ga0450904_000377	3300042139	Bacteria	9286
146	Ga0450916_000237	3300042530	Bacteria	4300
147	Ga0451577_0000236	3300042876	Bacteria	109530
148	Ga0451577_0030053	3300042876	Bacteria	4909
149	Ga0451577_0082900	3300042876	Bacteria	2860
150	Ga0466972_0025860	3300044658	Bacteria	2908
151	Ga0453684_0001354	3300044712	Bacteria	71546
152	Ga0453684_0100105	3300044712	Bacteria	3548
153	Ga0453684_0133755	3300044712	Bacteria	2972
154	Ga0466960_0197765	3300044901	Bacteria	1097
155	Ga0466959_0087942	3300045049	Bacteria	2234
156	Ga0451576_0032835	3300045051	Bacteria	5520
157	Ga0451576_0115568	3300045051	Bacteria	2793
158	Ga0495627_000371	3300046453	Bacteria	41727
159	Ga0495627_016951	3300046453	Bacteria	2485
160	Ga0495603_0002423	3300046455	Bacteria	10965
161	Ga0495590_0051353	3300046457	Bacteria	1440
162	Ga0495591_000358	3300046458	Bacteria	39879
163	Ga0495591_000501	3300046458	Bacteria	30925
164	Ga0495591_000913	3300046458	Bacteria	20472
165	Ga0495591_008807	3300046458	Bacteria	4085
166	Ga0495591_016313	3300046458	Bacteria	2591
167	Ga0495638_0000125	3300046460	Bacteria	125288
168	Ga0495650_0000308	3300046471	Bacteria	88853
169	Ga0495650_0003234	3300046471	Bacteria	12085
170	Ga0495605_0000025	3300046474	Bacteria	223594
171	Ga0495605_0000200	3300046474	Bacteria	73721
172	Ga0495605_0000357	3300046474	Bacteria	43995
173	Ga0495585_0026491	3300046492	Bacteria	3311
174	Ga0495594_0001845	3300046499	Bacteria	11022
175	Ga0495596_0018960	3300046500	Bacteria	2831
176	Ga0495607_0000338	3300046501	Bacteria	48436
177	Ga0495607_0000846	3300046501	Bacteria	28944
178	Ga0495607_0003610	3300046501	Bacteria	11754
179	Ga0495607_0018496	3300046501	Bacteria	4442
180	Ga0495607_0051567	3300046501	Bacteria	2388
181	Ga0495607_0082288	3300046501	Bacteria	1766
182	Ga0495583_0000070	3300046506	Bacteria	185226
183	Ga0495583_0000229	3300046506	Bacteria	93162
184	Ga0495583_0001421	3300046506	Bacteria	24384
185	Ga0495583_0002411	3300046506	Bacteria	16070
186	Ga0495583_0002532	3300046506	Bacteria	15464
187	Ga0495583_0003647	3300046506	Bacteria	11494
188	Ga0495606_0000028	3300046507	Bacteria	251032
189	Ga0495606_0000800	3300046507	Bacteria	47968
190	Ga0495606_0001660	3300046507	Bacteria	28914
191	Ga0495606_0177947	3300046507	Bacteria	1229
192	Ga0495608_0011151	3300046511	Bacteria	6256
193	Ga0495610_0012113	3300046512	Bacteria	5214
194	Ga0495616_0010909	3300046513	Bacteria	5232
195	Ga0495616_0020853	3300046513	Bacteria	3558
196	Ga0495620_0000009	3300046515	Bacteria	174473
197	Ga0495620_0000481	3300046515	Bacteria	25963
198	Ga0495620_0000590	3300046515	Bacteria	22734
199	Ga0495628_0025969	3300046516	Bacteria	4782
200	Ga0495632_0001102	3300046519	Bacteria	23124
201	Ga0495632_0042408	3300046519	Bacteria	2280
202	Ga0495637_0000070	3300046520	Bacteria	83331
203	Ga0495637_0000322	3300046520	Bacteria	37199
204	Ga0495637_0002468	3300046520	Bacteria	10217
205	Ga0495637_0025001	3300046520	Bacteria	2697
206	Ga0495643_0018110	3300046522	Bacteria	4101
207	Ga0495643_0041300	3300046522	Bacteria	2515
208	Ga0495648_0007867	3300046524	Bacteria	8473
209	Ga0495654_0000234	3300046530	Bacteria	52006
210	Ga0495654_0001028	3300046530	Bacteria	20448
211	Ga0495654_0005358	3300046530	Bacteria	7470
212	Ga0495654_0050371	3300046530	Bacteria	2035
213	Ga0495609_0000074	3300046538	Bacteria	123121
214	Ga0495609_0000203	3300046538	Bacteria	59251
215	Ga0495609_0000256	3300046538	Bacteria	50491
216	Ga0495597_0000605	3300046542	Bacteria	29435
217	Ga0495597_0002100	3300046542	Bacteria	13237
218	Ga0495622_0026408	3300046557	Bacteria	2712
219	Ga0495633_0000010	3300046558	Bacteria	280844
220	Ga0495668_0004273	3300046616	Bacteria	10253
221	Ga0495668_0143580	3300046616	Bacteria	1306
222	Ga0495611_0001584	3300046648	Bacteria	11131
223	Ga0495611_0005779	3300046648	Bacteria	5278
224	Ga0495611_0019065	3300046648	Bacteria	2946
225	Ga0495625_0000302	3300046660	Bacteria	76059
226	Ga0495661_0000008	3300046665	Bacteria	317971
227	Ga0495661_0000136	3300046665	Bacteria	86706
228	Ga0495661_0000169	3300046665	Bacteria	77846
229	Ga0495661_0000376	3300046665	Bacteria	48234
230	Ga0495661_0003598	3300046665	Bacteria	11410
231	Ga0495661_0037212	3300046665	Bacteria	3040
232	Ga0495661_0082311	3300046665	Bacteria	1853
233	Ga0495657_0128033	3300046675	Bacteria	1593
234	Ga0495671_0003452	3300046692	Bacteria	9704
235	Ga0495671_0048065	3300046692	Bacteria	2129
236	Ga0495649_0000021	3300046694	Bacteria	180395
237	Ga0495649_0029001	3300046694	Bacteria	3065
238	Ga0495589_0001007	3300046794	Bacteria	17087
239	Ga0495660_0004370	3300046810	Bacteria	8559
240	Ga0495660_0012129	3300046810	Bacteria	5000
241	Ga0495672_0006043	3300047320	Bacteria	9459
242	Ga0495672_0009864	3300047320	Bacteria	6869
243	Ga0495676_0000003	3300047321	Bacteria	318463
244	Ga0495676_0010167	3300047321	Bacteria	8545
245	Ga0495683_0000002	3300047323	Bacteria	638279
246	Ga0495683_0000184	3300047323	Bacteria	61386
247	Ga0495683_0000244	3300047323	Bacteria	48899
248	Ga0495679_000027	3300047446	Bacteria	193794
249	Ga0495679_000034	3300047446	Bacteria	164878
250	Ga0495673_0000328	3300047469	Bacteria	61350
251	Ga0495673_0001088	3300047469	Bacteria	23720
252	Ga0495673_0008397	3300047469	Bacteria	5821
253	Ga0495673_0061705	3300047469	Bacteria	1603
254	Ga0495681_0001430	3300047470	Bacteria	17946
255	Ga0495686_0000059	3300047472	Bacteria	239388
256	Ga0495686_0005222	3300047472	Bacteria	10315
257	Ga0495626_0000245	3300048091	Bacteria	63067
258	Ga0496104_0000287	3300048907	Bacteria	44415
259	Ga0496104_0118999	3300048907	Bacteria	2536
260	Ga0496104_0154924	3300048907	Bacteria	2199
261	Ga0496104_0312377	3300048907	Unclassified	1485
262	Ga0496105_0000627	3300048908	Bacteria	23647
263	Ga0496109_0287593	3300048912	Bacteria	1549
264	Ga0496110_0080453	3300048913	Bacteria	2903
265	Ga0496110_0091380	3300048913	Bacteria	2723
266	Ga0496111_0035494	3300048914	Bacteria	3564
267	Ga0496112_0022999	3300048915	Bacteria	5947
268	Ga0496113_0055820	3300048916	Bacteria	2962
269	Ga0496113_0076835	3300048916	Bacteria	2552
270	Ga0496114_0249839	3300048917	Bacteria	1560
271	Ga0496114_0270077	3300048917	Bacteria	1498
272	Ga0496115_0314217	3300048918	Bacteria	1283
273	Ga0496117_0000790	3300048920	Bacteria	49640
274	Ga0496118_0024837	3300048921	Bacteria	5160
275	Ga0496118_0058626	3300048921	Bacteria	2875
276	Ga0496120_0007221	3300048923	Bacteria	8317
277	Ga0496121_0003873	3300048924	Bacteria	20798
278	Ga0496121_0006553	3300048924	Bacteria	14382
279	Ga0496121_0017924	3300048924	Bacteria	7183
280	Ga0496121_0048111	3300048924	Bacteria	3631
281	Ga0496122_0000242	3300048925	Bacteria	122779
282	Ga0496122_0007734	3300048925	Bacteria	11828
283	Ga0496122_0087641	3300048925	Bacteria	2137
284	Ga0496123_0000269	3300048926	Bacteria	103907
285	Ga0496123_0012121	3300048926	Bacteria	7385
286	Ga0496123_0050545	3300048926	Bacteria	2776
287	Ga0496123_0080972	3300048926	Bacteria	1976
288	Ga0496123_0091544	3300048926	Bacteria	1803
289	Ga0496124_0000118	3300048927	Bacteria	164259
290	Ga0496124_0000944	3300048927	Bacteria	46593
291	Ga0496124_0002751	3300048927	Bacteria	22421
292	Ga0496124_0007123	3300048927	Bacteria	11972
293	Ga0496124_0040080	3300048927	Bacteria	4054
294	Ga0496124_0080943	3300048927	Bacteria	2671
295	Ga0496124_0111486	3300048927	Bacteria	2201
296	Ga0496124_0113648	3300048927	Bacteria	2175
297	Ga0496125_0005972	3300048928	Bacteria	13327
298	Ga0496125_0025389	3300048928	Bacteria	5425
299	Ga0496125_0068140	3300048928	Bacteria	2801
300	Ga0496125_0122934	3300048928	Bacteria	1846
301	Ga0496126_0181703	3300048929	Bacteria	1786
302	Ga0495678_000005	3300049459	Bacteria	522958
303	Ga0495678_000654	3300049459	Bacteria	31760
304	Ga0495682_0000393	3300049460	Bacteria	31581
305	Ga0495682_0000721	3300049460	Bacteria	21462
306	Ga0501031_0000827	3300049568	Bacteria	18631
307	Ga0501032_0028002	3300049569	Bacteria	3872
308	Ga0501032_0171664	3300049569	Bacteria	1422
309	Ga0501033_0000627	3300049570	Bacteria	32716
310	Ga0501033_0001054	3300049570	Bacteria	25186
311	Ga0501033_0001244	3300049570	Bacteria	22880
312	Ga0501033_0016212	3300049570	Bacteria	5642
313	Ga0501034_0090378	3300049571	Bacteria	3060
314	Ga0501034_0170394	3300049571	Bacteria	2144
315	Ga0501036_0003582	3300049572	Bacteria	12418
316	Ga0501036_0006417	3300049572	Bacteria	9547
317	Ga0501037_0002989	3300049573	Bacteria	12283
318	Ga0501037_0112616	3300049573	Bacteria	1959
319	Ga0501037_0160959	3300049573	Unclassified	1600
320	Ga0501038_0004801	3300049574	Bacteria	12554
321	Ga0501039_0016817	3300049575	Bacteria	5606
322	Ga0501040_0023460	3300049576	Bacteria	4138
323	Ga0501042_0032207	3300049578	Bacteria	3712
324	Ga0501043_0004154	3300049579	Bacteria	11834
325	Ga0501043_0033715	3300049579	Bacteria	4029
326	Ga0501046_0007343	3300049580	Bacteria	9696
327	Ga0501046_0130243	3300049580	Bacteria	1908
328	Ga0501047_0008191	3300049581	Bacteria	9875
329	Ga0501047_0058250	3300049581	Bacteria	3732
330	Ga0501048_0000958	3300049582	Bacteria	21338
331	Ga0501048_0020817	3300049582	Bacteria	4806
332	Ga0501067_0017271	3300049583	Bacteria	3988
333	Ga0501068_0002182	3300049584	Bacteria	10432
334	Ga0501069_0075764	3300049585	Bacteria	1890
335	Ga0501069_0189612	3300049585	Bacteria	1189
336	Ga0501070_0005819	3300049586	Bacteria	10519
337	Ga0501076_0019955	3300049592	Bacteria	5128
338	Ga0501225_0005365	3300049705	Bacteria	3766
339	Ga0501079_0003422	3300049741	Bacteria	11651
340	Ga0501079_0053107	3300049741	Bacteria	3126
341	Ga0501080_0006063	3300049742	Bacteria	10836
342	Ga0501080_0223484	3300049742	Bacteria	1722
343	Ga0501080_0301730	3300049742	Bacteria	1452
344	Ga0501083_0004334	3300049744	Bacteria	9995
345	Ga0501035_0029228	3300049822	Bacteria	5026
346	Ga0501035_0039623	3300049822	Bacteria	4262
347	Ga0501035_0298100	3300049822	Bacteria	1359
348	Ga0501044_0011310	3300049823	Bacteria	9672
349	Ga0501044_0012469	3300049823	Bacteria	9205
350	Ga0501044_0196350	3300049823	Bacteria	1978
351	Ga0501045_0033199	3300049824	Bacteria	3742
352	Ga0501226_000012	3300049853	Bacteria	175419
353	nmdc:mga06r32_87757_c1	3300050510	Bacteria	3036
354	nmdc:mga08y16_232051_c1	3300050511	Bacteria	1909
355	nmdc:mga0n895_120688_c1	3300050512	Bacteria	2642
356	nmdc:mga0n895_211662_c1	3300050512	Bacteria	1969
357	Ga0500562_002077	3300053108	Bacteria	4999
358	Ga0500607_002655	3300053121	Bacteria	14119
359	Ga0500618_000867	3300053125	Bacteria	16175
360	Ga0500618_001696	3300053125	Bacteria	9424
361	Ga0500559_0001375	3300053136	Bacteria	13921
362	Ga0500590_023924	3300053148	Bacteria	3170
363	Ga0500637_0050416	3300053178	Bacteria	2371
364	Ga0500645_010139	3300053730	Bacteria	3131
365	Ga0501084_0027063	3300054114	Bacteria	4791
366	Ga0500661_003715	3300055283	Bacteria	2866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048916	Ga0496113_0055820	Ga0496113_0055820_11_892	271
2	3300035241	Ga0373961_0004595	Ga0373961_0004595_25_921	275
3	3300009093	Ga0105240_10001116	Ga0105240_1000111641	308
4	3300009094	Ga0111539_10002540	Ga0111539_1000254010	308
5	3300009551	Ga0105238_10301119	Ga0105238_103011191	308
6	3300010375	Ga0105239_10000546	Ga0105239_1000054655	308
7	3300025913	Ga0207695_10000288	Ga0207695_10000288110	308
8	3300048921	Ga0496118_0058626	Ga0496118_0058626_1414_2469	308
9	3300048924	Ga0496121_0048111	Ga0496121_0048111_777_1832	308
10	3300050511	nmdc:mga08y16_232051_c1	nmdc:mga08y16_232051_c1_128_1132	308
11	3300047472	Ga0495686_0005222	Ga0495686_0005222_5782_6885	313
12	3300037418	Ga0395900_0175166	Ga0395900_0175166_855_1910	314
13	3300044901	Ga0466960_0197765	Ga0466960_0197765_24_1082	317
14	iso_pu_bacteria	2912723979	2912729910	321
15	3300003215	JGI25153J46596_10014905	JGI25153J46596_100149053	322
16	3300025297	Ga0209758_1005142	Ga0209758_10051427	322
17	iso_pu_bacteria	2599185359	2600228823	322
18	iso_pu_bacteria	2808606373	2808906890	322
19	iso_pu_bacteria	2818991466	2819714650	322
20	iso_pu_bacteria	2928526807	2928529156	322
21	iso_pu_bacteria	2928968154	2928968697	322
22	3300005467	Ga0070706_100000292	Ga0070706_1000002928	323
23	3300025910	Ga0207684_10000347	Ga0207684_1000034711	323
24	iso_pu_bacteria	2643221681	2644455555	323
25	iso_pu_bacteria	2848297114	2848300222	323
26	iso_pu_bacteria	2977264416	2977264487	323
27	3300001989	JGI24739J22299_10006744	JGI24739J22299_100067446	324
28	3300005329	Ga0070683_100136431	Ga0070683_1001364312	324
29	3300005535	Ga0070684_100040603	Ga0070684_1000406033	324
30	3300013104	Ga0157370_10175054	Ga0157370_101750541	324
31	3300013296	Ga0157374_10161166	Ga0157374_101611662	324
32	3300013306	Ga0163162_10178445	Ga0163162_101784452	324
33	3300013308	Ga0157375_10124226	Ga0157375_101242262	324
34	3300025295	Ga0209564_1005327	Ga0209564_10053274	324
35	3300025302	Ga0207426_1003382	Ga0207426_10033825	324
36	3300025944	Ga0207661_10118176	Ga0207661_101181762	324
37	3300048907	Ga0496104_0312377	Ga0496104_0312377_156_1196	324
38	3300048916	Ga0496113_0076835	Ga0496113_0076835_97_1134	324
39	3300048917	Ga0496114_0270077	Ga0496114_0270077_14_1051	324
40	iso_pu_bacteria	2508501071	2508854439	324
41	iso_pu_bacteria	2806310673	2807176953	324
42	3300009148	Ga0105243_10266064	Ga0105243_102660642	325
43	3300013308	Ga0157375_10042919	Ga0157375_100429194	325
44	3300021384	Ga0213876_10017544	Ga0213876_100175442	325
45	3300031239	Ga0265328_10010456	Ga0265328_100104561	325
46	3300031731	Ga0307405_10215103	Ga0307405_102151032	325
47	3300031911	Ga0307412_10132316	Ga0307412_101323162	325
48	3300031995	Ga0307409_100017736	Ga0307409_1000177361	325
49	3300032002	Ga0307416_100048666	Ga0307416_1000486662	325
50	3300032002	Ga0307416_100074508	Ga0307416_1000745081	325
51	3300039437	Ga0436365_0231409	Ga0436365_0231409_21159_22202	325
52	3300047472	Ga0495686_0000059	Ga0495686_0000059_27485_28531	325
53	3300048907	Ga0496104_0118999	Ga0496104_0118999_1154_2194	325
54	3300048912	Ga0496109_0287593	Ga0496109_0287593_10_1050	325
55	3300048913	Ga0496110_0080453	Ga0496110_0080453_1037_2077	325
56	3300048914	Ga0496111_0035494	Ga0496111_0035494_2210_3250	325
57	3300048917	Ga0496114_0249839	Ga0496114_0249839_95_1135	325
58	3300049570	Ga0501033_0001054	Ga0501033_0001054_9161_10207	325
59	3300049571	Ga0501034_0090378	Ga0501034_0090378_1499_2545	325
60	3300049573	Ga0501037_0160959	Ga0501037_0160959_207_1250	325
61	3300049823	Ga0501044_0011310	Ga0501044_0011310_6458_7501	325
62	iso_pu_bacteria	2775507049	2776912828	325
63	iso_pu_bacteria	2910245624	2910248351	325
64	3300003790	Ga0055528_1000901	Ga0055528_100090120	326
65	3300003794	Ga0055531_10000003	Ga0055531_1000000393	326
66	3300004625	Ga0055543_1009805	Ga0055543_10098053	326
67	3300005262	Ga0065165_1000012	Ga0065165_1000012146	326
68	3300005578	Ga0068854_100067438	Ga0068854_1000674382	326
69	3300005617	Ga0068859_100047273	Ga0068859_1000472735	326
70	3300014325	Ga0163163_10138953	Ga0163163_101389533	326
71	3300025273	Ga0209673_1000016	Ga0209673_1000016424	326
72	3300025273	Ga0209673_1000111	Ga0209673_100011120	326
73	3300025295	Ga0209564_1002602	Ga0209564_10026026	326
74	3300025297	Ga0209758_1005828	Ga0209758_10058283	326
75	3300025304	Ga0209257_1000008	Ga0209257_1000008305	326
76	3300025914	Ga0207671_10107760	Ga0207671_101077603	326
77	3300028786	Ga0307517_10000963	Ga0307517_1000096331	326
78	3300035691	Ga0373931_0036469	Ga0373931_0036469_952_2001	326
79	3300042876	Ga0451577_0030053	Ga0451577_0030053_359_1408	326
80	3300048926	Ga0496123_0050545	Ga0496123_0050545_976_2025	326
81	3300048927	Ga0496124_0007123	Ga0496124_0007123_1860_2909	326
82	3300048927	Ga0496124_0113648	Ga0496124_0113648_960_2009	326
83	3300050512	nmdc:mga0n895_120688_c1	nmdc:mga0n895_120688_c1_268_1323	326
84	3300055283	Ga0500661_003715	Ga0500661_003715_337_1386	326
85	iso_pu_bacteria	2914759650	2914761103	326
86	3300005459	Ga0068867_100425111	Ga0068867_1004251111	327
87	3300025939	Ga0207665_10080390	Ga0207665_100803902	327
88	3300030742	Ga0316183_1086246	Ga0316183_108624629	327
89	3300030744	Ga0316181_1280322	Ga0316181_128032219	327
90	3300031595	Ga0265313_10000194	Ga0265313_1000019425	327
91	3300045051	Ga0451576_0032835	Ga0451576_0032835_4266_5315	327
92	3300046511	Ga0495608_0011151	Ga0495608_0011151_1610_2662	327
93	3300046516	Ga0495628_0025969	Ga0495628_0025969_3212_4261	327
94	3300046675	Ga0495657_0128033	Ga0495657_0128033_20_1072	327
95	3300048927	Ga0496124_0111486	Ga0496124_0111486_313_1359	327
96	3300048928	Ga0496125_0122934	Ga0496125_0122934_686_1738	327
97	3300053108	Ga0500562_002077	Ga0500562_002077_2578_3630	327
98	3300053121	Ga0500607_002655	Ga0500607_002655_1991_3043	327
99	3300053136	Ga0500559_0001375	Ga0500559_0001375_10874_11926	327
100	3300053148	Ga0500590_023924	Ga0500590_023924_891_1943	327
101	3300053178	Ga0500637_0050416	Ga0500637_0050416_121_1173	327
102	3300053730	Ga0500645_010139	Ga0500645_010139_1304_2356	327
103	iso_pu_bacteria	2896344016	2896346357	327
104	iso_pu_bacteria	2929177148	2929180599	327
105	iso_pu_bacteria	2945977869	2945982997	327
106	iso_pu_bacteria	2946013367	2946017607	327
107	3300005327	Ga0070658_10256601	Ga0070658_102566012	328
108	3300005563	Ga0068855_100096790	Ga0068855_1000967902	328
109	3300005578	Ga0068854_100083678	Ga0068854_1000836782	328
110	3300006946	Ga0079104_1004040	Ga0079104_10040404	328
111	3300009093	Ga0105240_10024394	Ga0105240_100243942	328
112	3300009098	Ga0105245_10133299	Ga0105245_101332992	328
113	3300009177	Ga0105248_10264332	Ga0105248_102643322	328
114	3300009545	Ga0105237_10077218	Ga0105237_100772183	328
115	3300009545	Ga0105237_10329909	Ga0105237_103299091	328
116	3300013306	Ga0163162_10050443	Ga0163162_100504435	328
117	3300025909	Ga0207705_10171872	Ga0207705_101718721	328
118	3300025913	Ga0207695_10042302	Ga0207695_100423024	328
119	3300025914	Ga0207671_10002884	Ga0207671_100028844	328
120	3300025914	Ga0207671_10235061	Ga0207671_102350611	328
121	3300025981	Ga0207640_10034241	Ga0207640_100342413	328
122	3300027111	Ga0209281_1002776	Ga0209281_10027764	328
123	3300028558	Ga0265326_10008154	Ga0265326_100081542	328
124	3300028573	Ga0265334_10000006	Ga0265334_1000000663	328
125	3300031595	Ga0265313_10000521	Ga0265313_100005217	328
126	3300031911	Ga0307412_10009315	Ga0307412_100093155	328
127	3300042118	Ga0450914_001859	Ga0450914_001859_117_1172	328
128	3300042139	Ga0450904_000377	Ga0450904_000377_7760_8815	328
129	3300042530	Ga0450916_000237	Ga0450916_000237_1685_2740	328
130	3300046520	Ga0495637_0002468	Ga0495637_0002468_9141_10196	328
131	3300048907	Ga0496104_0000287	Ga0496104_0000287_12337_13392	328
132	3300048907	Ga0496104_0154924	Ga0496104_0154924_1130_2185	328
133	3300048908	Ga0496105_0000627	Ga0496105_0000627_9492_10547	328
134	3300048924	Ga0496121_0006553	Ga0496121_0006553_11540_12595	328
135	3300048929	Ga0496126_0181703	Ga0496126_0181703_700_1755	328
136	3300049568	Ga0501031_0000827	Ga0501031_0000827_3847_5097	328
137	3300049570	Ga0501033_0000627	Ga0501033_0000627_30206_31261	328
138	3300049571	Ga0501034_0170394	Ga0501034_0170394_435_1490	328
139	3300049572	Ga0501036_0006417	Ga0501036_0006417_531_1586	328
140	3300049576	Ga0501040_0023460	Ga0501040_0023460_172_1227	328
141	3300049578	Ga0501042_0032207	Ga0501042_0032207_88_1143	328
142	3300049579	Ga0501043_0004154	Ga0501043_0004154_7753_8808	328
143	3300049580	Ga0501046_0007343	Ga0501046_0007343_7497_8552	328
144	3300049581	Ga0501047_0008191	Ga0501047_0008191_8451_9506	328
145	3300049582	Ga0501048_0000958	Ga0501048_0000958_7962_9017	328
146	3300049583	Ga0501067_0017271	Ga0501067_0017271_716_1771	328
147	3300049584	Ga0501068_0002182	Ga0501068_0002182_9018_10073	328
148	3300049585	Ga0501069_0075764	Ga0501069_0075764_580_1635	328
149	3300049586	Ga0501070_0005819	Ga0501070_0005819_941_1996	328
150	3300049741	Ga0501079_0003422	Ga0501079_0003422_3302_4357	328
151	3300049742	Ga0501080_0006063	Ga0501080_0006063_8619_9674	328
152	3300049823	Ga0501044_0012469	Ga0501044_0012469_270_1325	328
153	3300049824	Ga0501045_0033199	Ga0501045_0033199_1525_2580	328
154	3300005328	Ga0070676_10005277	Ga0070676_100052772	329
155	3300005335	Ga0070666_10009122	Ga0070666_100091222	329
156	3300025907	Ga0207645_10033046	Ga0207645_100330463	329
157	3300032004	Ga0307414_10032477	Ga0307414_100324771	329
158	3300035398	Ga0316574_0045123	Ga0316574_0045123_299_1354	329
159	3300048915	Ga0496112_0022999	Ga0496112_0022999_3536_4591	329
160	3300048918	Ga0496115_0314217	Ga0496115_0314217_189_1244	329
161	3300048928	Ga0496125_0068140	Ga0496125_0068140_1602_2657	329
162	3300049569	Ga0501032_0028002	Ga0501032_0028002_363_1418	329
163	3300049570	Ga0501033_0001244	Ga0501033_0001244_2405_3460	329
164	3300049572	Ga0501036_0003582	Ga0501036_0003582_3827_4882	329
165	3300049573	Ga0501037_0002989	Ga0501037_0002989_4346_5401	329
166	3300049573	Ga0501037_0112616	Ga0501037_0112616_535_1590	329
167	3300049574	Ga0501038_0004801	Ga0501038_0004801_11265_12320	329
168	3300049575	Ga0501039_0016817	Ga0501039_0016817_1672_2727	329
169	3300049579	Ga0501043_0033715	Ga0501043_0033715_2948_4003	329
170	3300049582	Ga0501048_0020817	Ga0501048_0020817_2199_3254	329
171	3300049585	Ga0501069_0189612	Ga0501069_0189612_122_1177	329
172	3300049592	Ga0501076_0019955	Ga0501076_0019955_526_1581	329
173	3300049741	Ga0501079_0053107	Ga0501079_0053107_154_1209	329
174	3300049742	Ga0501080_0301730	Ga0501080_0301730_244_1299	329
175	3300049744	Ga0501083_0004334	Ga0501083_0004334_6228_7283	329
176	3300049822	Ga0501035_0039623	Ga0501035_0039623_2327_3382	329
177	3300049823	Ga0501044_0196350	Ga0501044_0196350_611_1666	329
178	3300054114	Ga0501084_0027063	Ga0501084_0027063_3106_4161	329
179	iso_pu_bacteria	2599185155	2599329798	329
180	iso_pu_bacteria	2600255283	2601623941	329
181	iso_pu_bacteria	2643221571	2643871725	329
182	iso_pu_bacteria	2738541271	2738691177	329
183	iso_pu_bacteria	2738543016	2739266951	329
184	iso_pu_bacteria	2808606445	2809215399	329
185	iso_pu_bacteria	2818991457	2819664096	329
186	iso_pu_bacteria	2826581358	2826586573	329
187	iso_pu_bacteria	2842815866	2842815986	329
188	iso_pu_bacteria	2842849001	2842851208	329
189	iso_pu_bacteria	2860867994	2860870175	329
190	iso_pu_bacteria	2919125081	2919126639	329
191	iso_pu_bacteria	2929189879	2929192089	329
192	iso_pu_bacteria	2945928738	2945933977	329
193	iso_pu_bacteria	2945961074	2945962854	329
194	iso_pu_bacteria	2947233263	2947237304	329
195	iso_pu_bacteria	3007252601	3007256279	329
196	iso_pu_bacteria	3007315729	3007319496	329
197	iso_pu_bacteria	8021626552	8021628063	329
198	iso_pu_bacteria	8021648035	8021648974	329
199	iso_pu_bacteria	8054285046	8054287878	329
200	iso_pu_bacteria	8056148874	8056154163	329
201	3300005288	Ga0065714_10064455	Ga0065714_1006445543	330
202	3300005444	Ga0070694_100026590	Ga0070694_1000265903	330
203	3300005466	Ga0070685_10003442	Ga0070685_100034423	330
204	3300005548	Ga0070665_100000866	Ga0070665_1000008668	330
205	3300006844	Ga0075428_100063455	Ga0075428_1000634553	330
206	3300006844	Ga0075428_100102605	Ga0075428_1001026054	330
207	3300006846	Ga0075430_100009980	Ga0075430_1000099805	330
208	3300006880	Ga0075429_100093410	Ga0075429_1000934102	330
209	3300017792	Ga0163161_10006813	Ga0163161_100068134	330
210	3300028379	Ga0268266_10005944	Ga0268266_100059448	330
211	3300035114	Ga0373939_0040357	Ga0373939_0040357_305_1363	330
212	3300037312	Ga0395899_0131629	Ga0395899_0131629_262_1320	330
213	3300038443	Ga0395901_0580591	Ga0395901_0580591_35_1093	330
214	3300042876	Ga0451577_0082900	Ga0451577_0082900_1193_2251	330
215	3300044712	Ga0453684_0100105	Ga0453684_0100105_2187_3245	330
216	3300044712	Ga0453684_0133755	Ga0453684_0133755_1391_2449	330
217	3300045051	Ga0451576_0115568	Ga0451576_0115568_681_1739	330
218	3300005288	Ga0065714_10002453	Ga0065714_1000245316	331
219	3300005356	Ga0070674_100010731	Ga0070674_1000107313	331
220	3300005356	Ga0070674_100214478	Ga0070674_1002144782	331
221	3300005564	Ga0070664_100043153	Ga0070664_1000431531	331
222	3300013102	Ga0157371_10003733	Ga0157371_100037337	331
223	3300013104	Ga0157370_10019128	Ga0157370_100191281	331
224	3300015261	Ga0182006_1004430	Ga0182006_10044308	331
225	3300025937	Ga0207669_10002025	Ga0207669_100020258	331
226	3300025945	Ga0207679_10297694	Ga0207679_102976942	331
227	3300028666	Ga0265336_10034881	Ga0265336_100348812	331
228	3300042876	Ga0451577_0000236	Ga0451577_0000236_100650_101711	331
229	3300044712	Ga0453684_0001354	Ga0453684_0001354_44123_45184	331
230	3300046460	Ga0495638_0000125	Ga0495638_0000125_29063_30124	331
231	3300046519	Ga0495632_0042408	Ga0495632_0042408_1099_2160	331
232	3300046648	Ga0495611_0001584	Ga0495611_0001584_2023_3084	331
233	3300047323	Ga0495683_0000244	Ga0495683_0000244_29243_30304	331
234	3300009092	Ga0105250_10000281	Ga0105250_1000028136	332
235	3300025711	Ga0207696_1000109	Ga0207696_1000109102	332
236	3300025735	Ga0207713_1000009	Ga0207713_1000009235	332
237	3300027312	Ga0209371_1000135	Ga0209371_10001353	332
238	3300030500	Ga0268256_1000148	Ga0268256_10001483	332
239	3300035241	Ga0373961_0002270	Ga0373961_0002270_3619_4689	332
240	3300037471	Ga0395905_0001835	Ga0395905_0001835_10045_11109	332
241	3300042115	Ga0450911_000020	Ga0450911_000020_7708_8775	332
242	3300046501	Ga0495607_0003610	Ga0495607_0003610_3607_4668	332
243	3300046507	Ga0495606_0177947	Ga0495606_0177947_41_1102	332
244	3300046520	Ga0495637_0025001	Ga0495637_0025001_958_2019	332
245	3300046665	Ga0495661_0082311	Ga0495661_0082311_72_1133	332
246	3300047323	Ga0495683_0000184	Ga0495683_0000184_6536_7597	332
247	3300049822	Ga0501035_0298100	Ga0501035_0298100_19_1083	332
248	3300005288	Ga0065714_10065523	Ga0065714_100655233	333
249	3300005331	Ga0070670_100026041	Ga0070670_1000260413	333
250	3300005344	Ga0070661_100000831	Ga0070661_10000083123	333
251	3300005458	Ga0070681_10000322	Ga0070681_100003224	333
252	3300005564	Ga0070664_100000996	Ga0070664_1000009962	333
253	3300006871	Ga0075434_100215251	Ga0075434_1002152511	333
254	3300009011	Ga0105251_10000633	Ga0105251_1000063311	333
255	3300009011	Ga0105251_10020142	Ga0105251_100201422	333
256	3300009036	Ga0105244_10006756	Ga0105244_100067564	333
257	3300013306	Ga0163162_10104311	Ga0163162_101043112	333
258	3300015261	Ga0182006_1002849	Ga0182006_10028496	333
259	3300017792	Ga0163161_10030139	Ga0163161_100301391	333
260	3300025728	Ga0207655_1007673	Ga0207655_10076731	333
261	3300025735	Ga0207713_1001214	Ga0207713_100121419	333
262	3300025912	Ga0207707_10000252	Ga0207707_1000025238	333
263	3300025920	Ga0207649_10000088	Ga0207649_100000882	333
264	3300025925	Ga0207650_10000357	Ga0207650_1000035722	333
265	3300025945	Ga0207679_10000034	Ga0207679_10000034130	333
266	3300035113	Ga0373936_0000058	Ga0373936_0000058_16069_17154	333
267	3300046453	Ga0495627_000371	Ga0495627_000371_8576_9643	333
268	3300046457	Ga0495590_0051353	Ga0495590_0051353_108_1175	333
269	3300046458	Ga0495591_000358	Ga0495591_000358_27823_28890	333
270	3300046458	Ga0495591_000501	Ga0495591_000501_9431_10495	333
271	3300046458	Ga0495591_000913	Ga0495591_000913_7398_8462	333
272	3300046458	Ga0495591_008807	Ga0495591_008807_2585_3652	333
273	3300046458	Ga0495591_016313	Ga0495591_016313_952_2016	333
274	3300046471	Ga0495650_0000308	Ga0495650_0000308_27167_28231	333
275	3300046471	Ga0495650_0003234	Ga0495650_0003234_140_1210	333
276	3300046474	Ga0495605_0000357	Ga0495605_0000357_25782_26846	333
277	3300046492	Ga0495585_0026491	Ga0495585_0026491_632_1696	333
278	3300046499	Ga0495594_0001845	Ga0495594_0001845_3675_4742	333
279	3300046500	Ga0495596_0018960	Ga0495596_0018960_1229_2293	333
280	3300046501	Ga0495607_0000338	Ga0495607_0000338_16448_17512	333
281	3300046501	Ga0495607_0018496	Ga0495607_0018496_2364_3428	333
282	3300046501	Ga0495607_0051567	Ga0495607_0051567_1096_2166	333
283	3300046501	Ga0495607_0082288	Ga0495607_0082288_489_1553	333
284	3300046506	Ga0495583_0000070	Ga0495583_0000070_103613_104680	333
285	3300046506	Ga0495583_0000229	Ga0495583_0000229_16698_17768	333
286	3300046506	Ga0495583_0001421	Ga0495583_0001421_16088_17152	333
287	3300046506	Ga0495583_0002532	Ga0495583_0002532_7335_8399	333
288	3300046506	Ga0495583_0003647	Ga0495583_0003647_2969_4033	333
289	3300046507	Ga0495606_0000028	Ga0495606_0000028_62251_63315	333
290	3300046507	Ga0495606_0000800	Ga0495606_0000800_8142_9206	333
291	3300046507	Ga0495606_0001660	Ga0495606_0001660_18273_19340	333
292	3300046512	Ga0495610_0012113	Ga0495610_0012113_2172_3242	333
293	3300046513	Ga0495616_0010909	Ga0495616_0010909_2869_3936	333
294	3300046515	Ga0495620_0000009	Ga0495620_0000009_50974_52041	333
295	3300046515	Ga0495620_0000481	Ga0495620_0000481_8376_9440	333
296	3300046515	Ga0495620_0000590	Ga0495620_0000590_1276_2340	333
297	3300046519	Ga0495632_0001102	Ga0495632_0001102_4268_5338	333
298	3300046520	Ga0495637_0000070	Ga0495637_0000070_7462_8526	333
299	3300046520	Ga0495637_0000322	Ga0495637_0000322_28718_29782	333
300	3300046522	Ga0495643_0018110	Ga0495643_0018110_613_1677	333
301	3300046522	Ga0495643_0041300	Ga0495643_0041300_506_1573	333
302	3300046530	Ga0495654_0000234	Ga0495654_0000234_25247_26314	333
303	3300046530	Ga0495654_0005358	Ga0495654_0005358_4880_5944	333
304	3300046530	Ga0495654_0050371	Ga0495654_0050371_882_1946	333
305	3300046538	Ga0495609_0000203	Ga0495609_0000203_7362_8426	333
306	3300046542	Ga0495597_0000605	Ga0495597_0000605_5471_6538	333
307	3300046557	Ga0495622_0026408	Ga0495622_0026408_1342_2406	333
308	3300046558	Ga0495633_0000010	Ga0495633_0000010_176281_177348	333
309	3300046616	Ga0495668_0004273	Ga0495668_0004273_1508_2572	333
310	3300046616	Ga0495668_0143580	Ga0495668_0143580_207_1271	333
311	3300046648	Ga0495611_0005779	Ga0495611_0005779_183_1247	333
312	3300046648	Ga0495611_0019065	Ga0495611_0019065_1296_2363	333
313	3300046660	Ga0495625_0000302	Ga0495625_0000302_69544_70608	333
314	3300046665	Ga0495661_0000136	Ga0495661_0000136_7443_8507	333
315	3300046665	Ga0495661_0000169	Ga0495661_0000169_59503_60573	333
316	3300046665	Ga0495661_0000376	Ga0495661_0000376_27834_28901	333
317	3300046665	Ga0495661_0003598	Ga0495661_0003598_3496_4560	333
318	3300046665	Ga0495661_0037212	Ga0495661_0037212_417_1481	333
319	3300046692	Ga0495671_0003452	Ga0495671_0003452_681_1748	333
320	3300046692	Ga0495671_0048065	Ga0495671_0048065_169_1233	333
321	3300046694	Ga0495649_0000021	Ga0495649_0000021_93572_94636	333
322	3300046694	Ga0495649_0029001	Ga0495649_0029001_1113_2177	333
323	3300046810	Ga0495660_0004370	Ga0495660_0004370_408_1472	333
324	3300047320	Ga0495672_0006043	Ga0495672_0006043_6534_7601	333
325	3300047320	Ga0495672_0009864	Ga0495672_0009864_389_1456	333
326	3300047321	Ga0495676_0000003	Ga0495676_0000003_309978_311042	333
327	3300047321	Ga0495676_0010167	Ga0495676_0010167_2123_3187	333
328	3300047323	Ga0495683_0000002	Ga0495683_0000002_515756_516823	333
329	3300047446	Ga0495679_000027	Ga0495679_000027_133561_134625	333
330	3300047446	Ga0495679_000034	Ga0495679_000034_120544_121611	333
331	3300047469	Ga0495673_0000328	Ga0495673_0000328_52397_53461	333
332	3300047469	Ga0495673_0001088	Ga0495673_0001088_13135_14199	333
333	3300047469	Ga0495673_0008397	Ga0495673_0008397_24_1088	333
334	3300047469	Ga0495673_0061705	Ga0495673_0061705_261_1325	333
335	3300047470	Ga0495681_0001430	Ga0495681_0001430_1404_2471	333
336	3300048091	Ga0495626_0000245	Ga0495626_0000245_190_1254	333
337	3300048913	Ga0496110_0091380	Ga0496110_0091380_350_1414	333
338	3300048920	Ga0496117_0000790	Ga0496117_0000790_11110_12177	333
339	3300048921	Ga0496118_0024837	Ga0496118_0024837_108_1175	333
340	3300048923	Ga0496120_0007221	Ga0496120_0007221_114_1181	333
341	3300048924	Ga0496121_0003873	Ga0496121_0003873_4636_5700	333
342	3300048924	Ga0496121_0017924	Ga0496121_0017924_2608_3672	333
343	3300048925	Ga0496122_0000242	Ga0496122_0000242_98285_99349	333
344	3300048925	Ga0496122_0007734	Ga0496122_0007734_3637_4701	333
345	3300048925	Ga0496122_0087641	Ga0496122_0087641_820_1887	333
346	3300048926	Ga0496123_0000269	Ga0496123_0000269_98287_99351	333
347	3300048926	Ga0496123_0012121	Ga0496123_0012121_3936_5003	333
348	3300048926	Ga0496123_0080972	Ga0496123_0080972_29_1093	333
349	3300048926	Ga0496123_0091544	Ga0496123_0091544_65_1129	333
350	3300048927	Ga0496124_0000118	Ga0496124_0000118_113531_114595	333
351	3300048927	Ga0496124_0000944	Ga0496124_0000944_36594_37661	333
352	3300048927	Ga0496124_0002751	Ga0496124_0002751_10802_11866	333
353	3300048927	Ga0496124_0040080	Ga0496124_0040080_400_1464	333
354	3300048927	Ga0496124_0080943	Ga0496124_0080943_1480_2556	333
355	3300048928	Ga0496125_0005972	Ga0496125_0005972_11045_12112	333
356	3300049459	Ga0495678_000654	Ga0495678_000654_25756_26820	333
357	3300049460	Ga0495682_0000721	Ga0495682_0000721_10421_11485	333
358	3300049570	Ga0501033_0016212	Ga0501033_0016212_1637_2704	333
359	3300049581	Ga0501047_0058250	Ga0501047_0058250_120_1193	333
360	3300049742	Ga0501080_0223484	Ga0501080_0223484_15_1103	333
361	3300049822	Ga0501035_0029228	Ga0501035_0029228_509_1576	333
362	3300049853	Ga0501226_000012	Ga0501226_000012_168384_169454	333
363	3300050512	nmdc:mga0n895_211662_c1	nmdc:mga0n895_211662_c1_135_1202	333
364	3300053125	Ga0500618_001696	Ga0500618_001696_785_1849	333
365	3300045049	Ga0466959_0087942	Ga0466959_0087942_165_1244	334
366	3300049460	Ga0495682_0000393	Ga0495682_0000393_1945_3012	334
367	3300005345	Ga0070692_10003555	Ga0070692_100035552	335
368	3300005444	Ga0070694_100000350	Ga0070694_1000003502	335
369	3300005549	Ga0070704_100002191	Ga0070704_1000021914	335
370	3300006847	Ga0075431_100068240	Ga0075431_1000682403	335
371	3300050510	nmdc:mga06r32_87757_c1	nmdc:mga06r32_87757_c1_1524_2606	335
372	3300044658	Ga0466972_0025860	Ga0466972_0025860_1034_2170	338
373	3300009147	Ga0114129_10658272	Ga0114129_106582721	340
374	3300031995	Ga0307409_100099199	Ga0307409_1000991993	340
375	3300049705	Ga0501225_0005365	Ga0501225_0005365_2139_3233	340
376	3300003354	JGI25160J50197_1016662	JGI25160J50197_10166622	342
377	3300013102	Ga0157371_10024363	Ga0157371_100243634	342
378	3300053125	Ga0500618_000867	Ga0500618_000867_2569_3684	342
379	3300046513	Ga0495616_0020853	Ga0495616_0020853_274_1383	343
380	3300049580	Ga0501046_0130243	Ga0501046_0130243_207_1304	343
381	3300013100	Ga0157373_10005223	Ga0157373_100052232	346
382	3300013307	Ga0157372_10084956	Ga0157372_100849561	346
383	3300037466	Ga0395898_0306959	Ga0395898_0306959_345_1460	346
384	3300011119	Ga0105246_10026878	Ga0105246_100268783	347
385	3300048928	Ga0496125_0025389	Ga0496125_0025389_690_1799	347
386	3300046453	Ga0495627_016951	Ga0495627_016951_203_1318	348
387	3300046474	Ga0495605_0000025	Ga0495605_0000025_118974_120089	348
388	3300046524	Ga0495648_0007867	Ga0495648_0007867_2932_4047	348
389	3300046530	Ga0495654_0001028	Ga0495654_0001028_7842_8957	348
390	3300046538	Ga0495609_0000074	Ga0495609_0000074_88675_89790	348
391	3300046542	Ga0495597_0002100	Ga0495597_0002100_11341_12456	348
392	3300046665	Ga0495661_0000008	Ga0495661_0000008_122749_123864	348
393	3300046794	Ga0495589_0001007	Ga0495589_0001007_2123_3238	348
394	3300046810	Ga0495660_0012129	Ga0495660_0012129_1261_2376	348
395	3300049459	Ga0495678_000005	Ga0495678_000005_122638_123753	348
396	3300046455	Ga0495603_0002423	Ga0495603_0002423_1778_2983	356
397	3300046474	Ga0495605_0000200	Ga0495605_0000200_44222_45367	356
398	3300046506	Ga0495583_0002411	Ga0495583_0002411_8171_9316	356
399	3300046538	Ga0495609_0000256	Ga0495609_0000256_31584_32729	356
400	3300049569	Ga0501032_0171664	Ga0501032_0171664_28_1209	358
401	3300009011	Ga0105251_10000003	Ga0105251_1000000354	364
402	3300046501	Ga0495607_0000846	Ga0495607_0000846_16468_17667	371
403	3300009176	Ga0105242_10190370	Ga0105242_101903701	377
404	3300013100	Ga0157373_10001909	Ga0157373_100019092	379
405	2162886011	MRS1b_contig_3205798	MRS1b_0468.00000980	392
406	3300005290	Ga0065712_10067896	Ga0065712_1006789618	392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

250

374

0.95 PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

92

211

0.93 PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

235

320

0.9 PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

282

407

0.79 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7cgu-assembly1.cif.gz_A	crystal structure of abhar	0.9753	63	383
1yqx-assembly1.cif.gz_B	sinapyl alcohol dehydrogenase at 2.5 angstrom resolution	0.9728	62	381
6k3g-assembly1.cif.gz_B	crystal structure of 10-hydroxygeraniol dehydrogenase from cantharanthus roseus in complex with nadp+	0.9719	62	383
8b26-assembly1.cif.gz_B	dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga	0.9684	62	382
5vkt-assembly1.cif.gz_A	cinnamyl alcohol dehydrogenases (sbcad4) from sorghum bicolor (l.) moench	0.9641	62	383

ID	Description	Score	Start	End	Superfamily
af_P9WQC5_8_250_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9744	67	288	3.40.50.720
af_C6TB56_4_167_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9683	62	209	3.90.180.10
af_P9WQC5_159_311_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9603	206	350	3.40.50.720
af_Q0JA75_27_278_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9441	67	287	3.90.180.10
af_A0A0R0FW40_1_188_3.90.180.10	Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain	0.9435	122	287	3.90.180.10

ID	Description	Score	Start	End	GO Terms
AF-A0A656JWN7-F1-model_v4	Oxidoreductase zinc-binding protein	0.9989	62	139	GO:0008270 GO:0016616
AF-A0A6N8R2N6-F1-model_v4	NADPH-dependent aldehyde reductase YahK (EC 1.1.1.2)	0.987	62	153	GO:0008106 GO:0008270
AF-A0A6P5MGK0-F1-model_v4	Probable cinnamyl alcohol dehydrogenase 6	0.9844	62	146	GO:0008270 GO:0009809 GO:0016616
AF-A0A2V5LFQ1-F1-model_v4	alcohol dehydrogenase (NADP(+)) (EC 1.1.1.2)	0.9827	62	384	GO:0008270 GO:0016616
AF-A0A6D0IDL8-F1-model_v4	NADPH-dependent aldehyde reductase YahK (EC 1.1.1.2)	0.9802	198	386	GO:0008106

Feature Viewer

pLDDT	pTM	Quality
83.87	0.81	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F436195

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

250

374

0.95

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

92

211

0.93

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

235

320

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

282

407

0.79

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map