F436164

General Info

Members Datasets Scaffolds Average Seq Length
406 228 812 303

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100088108|Ga0068859_1000881081
Length 334
Sequence MIAPASTGRPDLSQDGSRGHAANGVINMQVGFIGLGIMGASMASNLQKAGYKLVVHDLHRQAASRHLNDGATWAASPREVAEQCDVVFSSLPGPPEVEAVATGKDGLLEGFKPGSAYFDLSTNSRAVVRRIGEAFAAKGVHMLDAPVSGGPRGALTGKLAIWVGGDKAVFDQHKKVLDAIGDQARYVGPIGQATVAKLVHNMAGYAITVALGEVFTMGIKAGVDPLTLFESVRQGALGRRRTFDGLVDQFLPGTYDPPHFALKLAHKDVSLATQLGKEVGVPMRLCNMTLEDMTEALGRGWEGRDSRSVMLVQQERAGLKIAVDPAKLKAALEK

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
118 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
225 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
226 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
227 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
228 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0
Rhizoplane 2.46
Rhizosphere 89.16
Stem 0
Stem Tuber 0
Unclassified 6.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100088108 3300005617 Bacteria 3153
2 JGI25406J46586_10019138 3300003203 Bacteria 2798
3 Ga0070658_10006226 3300005327 Bacteria 9669
4 Ga0070683_100573618 3300005329 Bacteria 1079
5 Ga0070690_100016941 3300005330 Bacteria 4374
6 Ga0070680_100001388 3300005336 Bacteria 17507
7 Ga0070680_100070345 3300005336 Bacteria 2874
8 Ga0070680_100219503 3300005336 Bacteria 1604
9 Ga0070680_100529216 3300005336 Bacteria 1009
10 Ga0070682_100240995 3300005337 Bacteria 1298
11 Ga0070689_100029459 3300005340 Bacteria 4155
12 Ga0070689_100114092 3300005340 Bacteria 2152
13 Ga0070689_100123366 3300005340 Bacteria 2071
14 Ga0070691_10000536 3300005341 Bacteria 14322
15 Ga0070668_100374475 3300005347 Bacteria 1210
16 Ga0070659_100440223 3300005366 Bacteria 1104
17 Ga0070714_100037595 3300005435 Bacteria 4068
18 Ga0070714_100139726 3300005435 Bacteria 2172
19 Ga0070714_100140313 3300005435 Unclassified 2168
20 Ga0070714_100370924 3300005435 Bacteria 1348
21 Ga0070713_100011485 3300005436 Bacteria 6452
22 Ga0070713_100031915 3300005436 Bacteria 4201
23 Ga0070713_100338693 3300005436 Bacteria 1393
24 Ga0070710_10018661 3300005437 Bacteria 3572
25 Ga0070711_100074392 3300005439 Unclassified 2402
26 Ga0070705_100008518 3300005440 Bacteria 5080
27 Ga0070705_100023778 3300005440 Bacteria 3296
28 Ga0070700_100132741 3300005441 Bacteria 1682
29 Ga0070694_100019059 3300005444 Bacteria 4361
30 Ga0070694_100155822 3300005444 Bacteria 1672
31 Ga0070694_100302106 3300005444 Bacteria 1227
32 Ga0070708_100012015 3300005445 Bacteria 7057
33 Ga0070708_100075871 3300005445 Bacteria 3035
34 Ga0070681_10001404 3300005458 Bacteria 21121
35 Ga0070681_10014611 3300005458 Bacteria 7814
36 Ga0068867_100423271 3300005459 Bacteria 1128
37 Ga0070706_100044347 3300005467 Bacteria 4108
38 Ga0070706_100290612 3300005467 Bacteria 1525
39 Ga0070698_100000915 3300005471 Bacteria 32284
40 Ga0070698_100034500 3300005471 Bacteria 5236
41 Ga0070698_100174993 3300005471 Bacteria 2086
42 Ga0070699_100019483 3300005518 Bacteria 5843
43 Ga0070699_100020368 3300005518 Bacteria 5720
44 Ga0070699_100108009 3300005518 Bacteria 2442
45 Ga0070699_100151779 3300005518 Bacteria 2049
46 Ga0070699_100210487 3300005518 Bacteria 1731
47 Ga0070679_100003503 3300005530 Bacteria 14373
48 Ga0070679_100023146 3300005530 Bacteria 6079
49 Ga0070679_100182959 3300005530 Bacteria 2068
50 Ga0070684_100044123 3300005535 Bacteria 3855
51 Ga0070697_100038924 3300005536 Bacteria 3843
52 Ga0070697_100073558 3300005536 Bacteria 2806
53 Ga0070686_100288576 3300005544 Bacteria 1213
54 Ga0070695_100048905 3300005545 Bacteria 2706
55 Ga0070695_100128537 3300005545 Bacteria 1743
56 Ga0070696_100045157 3300005546 Bacteria 3053
57 Ga0070704_100003469 3300005549 Bacteria 9048
58 Ga0070704_100041503 3300005549 Bacteria 3176
59 Ga0068855_100006961 3300005563 Bacteria 13724
60 Ga0068856_100179048 3300005614 Bacteria 2133
61 Ga0070702_100051003 3300005615 Bacteria 2367
62 Ga0068859_100281558 3300005617 Bacteria 1756
63 Ga0068866_10146687 3300005718 Bacteria 1361
64 Ga0068860_100027791 3300005843 Bacteria 5448
65 Ga0068860_100089304 3300005843 Bacteria 2934
66 Ga0068862_100084028 3300005844 Bacteria 2765
67 Ga0081455_10005180 3300005937 Bacteria 14352
68 Ga0081538_10012399 3300005981 Bacteria 6832
69 Ga0081538_10013870 3300005981 Bacteria 6352
70 Ga0081539_10000161 3300005985 Bacteria 156560
71 Ga0081539_10000556 3300005985 Bacteria 77121
72 Ga0070717_10019691 3300006028 Bacteria 5297
73 Ga0075365_10032365 3300006038 Bacteria 3360
74 Ga0075365_10156072 3300006038 Bacteria 1588
75 Ga0075365_10223762 3300006038 Bacteria 1320
76 Ga0075365_10353794 3300006038 Bacteria 1035
77 Ga0070715_10091292 3300006163 Unclassified 1402
78 Ga0070712_100017210 3300006175 Bacteria 4677
79 Ga0075367_10022651 3300006178 Bacteria 3526
80 Ga0075369_10096169 3300006186 Bacteria 1325
81 Ga0075366_10003597 3300006195 Bacteria 8207
82 Ga0097621_100022942 3300006237 Bacteria 4850
83 Ga0068871_100006490 3300006358 Bacteria 8280
84 Ga0075428_100000848 3300006844 Bacteria 32123
85 Ga0075428_100012504 3300006844 Bacteria 9440
86 Ga0075428_100083780 3300006844 Bacteria 3479
87 Ga0075428_100705003 3300006844 Bacteria 1075
88 Ga0075430_100000185 3300006846 Bacteria 41854
89 Ga0075430_100154140 3300006846 Bacteria 1913
90 Ga0075431_100009631 3300006847 Bacteria 9703
91 Ga0075431_100015263 3300006847 Bacteria 7784
92 Ga0075431_100037010 3300006847 Bacteria 5027
93 Ga0075433_10068175 3300006852 Bacteria 3123
94 Ga0075433_10197124 3300006852 Bacteria 1791
95 Ga0075434_100037017 3300006871 Bacteria 4828
96 Ga0075434_100047386 3300006871 Bacteria 4265
97 Ga0075429_100021286 3300006880 Bacteria 5622
98 Ga0075429_100026726 3300006880 Bacteria 5011
99 Ga0075429_100177214 3300006880 Bacteria 1868
100 Ga0075429_100229716 3300006880 Unclassified 1625
101 Ga0075429_100300960 3300006880 Bacteria 1404
102 Ga0068865_100010427 3300006881 Bacteria 5783
103 Ga0075436_100000628 3300006914 Bacteria 23202
104 Ga0075436_100041007 3300006914 Bacteria 3194
105 Ga0075436_100041140 3300006914 Bacteria 3189
106 Ga0097620_100088109 3300006931 Bacteria 3153
107 Ga0097620_100281570 3300006931 Bacteria 1756
108 Ga0075435_100018408 3300007076 Bacteria 5312
109 Ga0075435_100022075 3300007076 Bacteria 4907
110 Ga0075435_100047770 3300007076 Bacteria 3437
111 Ga0105240_10006118 3300009093 Bacteria 17754
112 Ga0105240_10128174 3300009093 Bacteria 3046
113 Ga0111539_10001180 3300009094 Bacteria 34688
114 Ga0111539_10035049 3300009094 Bacteria 6078
115 Ga0111539_10046003 3300009094 Bacteria 5222
116 Ga0105245_10254806 3300009098 Bacteria 1706
117 Ga0105245_10398781 3300009098 Bacteria 1374
118 Ga0114129_10002145 3300009147 Bacteria 27198
119 Ga0114129_10039204 3300009147 Bacteria 6679
120 Ga0114129_10039515 3300009147 Bacteria 6652
121 Ga0114129_10161226 3300009147 Bacteria 3063
122 Ga0114129_10196211 3300009147 Bacteria 2737
123 Ga0114129_10564980 3300009147 Bacteria 1478
124 Ga0105242_10117803 3300009176 Bacteria 2274
125 Ga0105248_10851374 3300009177 Bacteria 1029
126 Ga0105249_10012926 3300009553 Bacteria 7365
127 Ga0105035_101459 3300009988 Bacteria 1644
128 Ga0099796_10079284 3300010159 Bacteria 1201
129 Ga0157369_10061554 3300013105 Bacteria 4046
130 Ga0157378_10694869 3300013297 Bacteria 1036
131 Ga0163162_10366713 3300013306 Bacteria 1573
132 Ga0163163_10067705 3300014325 Bacteria 3551
133 Ga0163163_10094838 3300014325 Bacteria 3002
134 Ga0163163_10220013 3300014325 Bacteria 1947
135 Ga0157379_10087130 3300014968 Bacteria 2800
136 Ga0157379_10114901 3300014968 Bacteria 2419
137 Ga0157376_10245837 3300014969 Bacteria 1669
138 Ga0213875_10000138 3300021388 Bacteria 79866
139 Ga0213875_10000708 3300021388 Bacteria 25616
140 Ga0213875_10020318 3300021388 Bacteria 3186
141 Ga0207692_10010690 3300025898 Bacteria 3879
142 Ga0207685_10047819 3300025905 Bacteria 1635
143 Ga0207684_10279194 3300025910 Bacteria 1440
144 Ga0207707_10001628 3300025912 Bacteria 20704
145 Ga0207707_10007503 3300025912 Bacteria 9503
146 Ga0207695_10347553 3300025913 Bacteria 1371
147 Ga0207695_10497125 3300025913 Bacteria 1102
148 Ga0207693_10086828 3300025915 Bacteria 2451
149 Ga0207693_10129387 3300025915 Unclassified 1984
150 Ga0207663_10009420 3300025916 Bacteria 5157
151 Ga0207660_10005682 3300025917 Bacteria 8090
152 Ga0207660_10014024 3300025917 Bacteria 5260
153 Ga0207660_10160581 3300025917 Bacteria 1733
154 Ga0207662_10064535 3300025918 Bacteria 2203
155 Ga0207652_10004944 3300025921 Bacteria 10792
156 Ga0207652_10393333 3300025921 Bacteria 1251
157 Ga0207652_10413434 3300025921 Bacteria 1217
158 Ga0207646_10019374 3300025922 Bacteria 6325
159 Ga0207681_10009119 3300025923 Bacteria 6061
160 Ga0207687_10091106 3300025927 Bacteria 2223
161 Ga0207700_10039144 3300025928 Bacteria 3448
162 Ga0207700_10240317 3300025928 Unclassified 1543
163 Ga0207664_10018276 3300025929 Bacteria 5156
164 Ga0207664_10104043 3300025929 Bacteria 2350
165 Ga0207690_10364641 3300025932 Bacteria 1145
166 Ga0207686_10131857 3300025934 Bacteria 1715
167 Ga0207709_10217776 3300025935 Bacteria 1375
168 Ga0207669_10404501 3300025937 Bacteria 1070
169 Ga0207665_10020279 3300025939 Bacteria 4367
170 Ga0207665_10218949 3300025939 Bacteria 1394
171 Ga0207691_10102253 3300025940 Bacteria 2556
172 Ga0207711_10722219 3300025941 Bacteria 929
173 Ga0207689_10059749 3300025942 Bacteria 3135
174 Ga0207667_10010630 3300025949 Bacteria 10744
175 Ga0207708_10087551 3300026075 Bacteria 2398
176 Ga0207702_10083228 3300026078 Bacteria 2784
177 Ga0207648_10000443 3300026089 Bacteria 45890
178 Ga0207674_10028477 3300026116 Bacteria 5897
179 Ga0210000_1009433 3300027462 Bacteria 1436
180 Ga0209968_1008633 3300027526 Bacteria 1554
181 Ga0209999_1011834 3300027543 Bacteria 1579
182 Ga0207428_10005229 3300027907 Bacteria 12133
183 Ga0207428_10141693 3300027907 Bacteria 1834
184 Ga0268264_10207510 3300028381 Bacteria 1796
185 Ga0265334_10001215 3300028573 Bacteria 12600
186 Ga0265323_10005921 3300028653 Bacteria 5168
187 Ga0265338_10051310 3300028800 Bacteria 3715
188 Ga0265338_10217835 3300028800 Unclassified 1428
189 Ga0265316_10028453 3300031344 Bacteria 4611
190 Ga0316576_10004948 3300031727 Bacteria 8067
191 Ga0316578_10018025 3300031728 Bacteria 3857
192 Ga0316578_10028659 3300031728 Bacteria 3155
193 Ga0307407_10159528 3300031903 Bacteria 1475
194 Ga0307412_10235748 3300031911 Bacteria 1412
195 Ga0316580_10003936 3300032139 Bacteria 4269
196 Ga0373926_0121682 3300035083 Bacteria 984
197 Ga0373936_0025814 3300035113 Bacteria 2299
198 Ga0373936_0134015 3300035113 Unclassified 1066
199 Ga0373941_0064368 3300035115 Bacteria 1201
200 Ga0373956_0040388 3300035119 Unclassified 2069
201 Ga0373955_0153100 3300035172 Bacteria 1358
202 Ga0373955_0199732 3300035172 Bacteria 1190
203 Ga0373924_0002883 3300035410 Bacteria 5827
204 Ga0373924_0007062 3300035410 Bacteria 4042
205 Ga0373935_0055493 3300035692 Bacteria 2524
206 Ga0373935_0187154 3300035692 Bacteria 1424
207 Ga0373927_0030761 3300035695 Bacteria 3502
208 Ga0373927_0089284 3300035695 Bacteria 2001
209 Ga0373927_0096950 3300035695 Bacteria 1917
210 Ga0373933_0001156 3300035724 Bacteria 15659
211 Ga0373933_0305228 3300035724 Bacteria 1031
212 Ga0373947_0036725 3300035725 Bacteria 2906
213 Ga0373947_0098365 3300035725 Bacteria 1835
214 Ga0373937_0001827 3300036401 Bacteria 17865
215 Ga0373937_0002205 3300036401 Bacteria 16281
216 Ga0373937_0012596 3300036401 Bacteria 7442
217 Ga0373937_0276764 3300036401 Unclassified 1584
218 Ga0316584_0038956 3300036712 Bacteria 3538
219 Ga0373925_0021074 3300037068 Bacteria 4748
220 Ga0373925_0336090 3300037068 Unclassified 1224
221 Ga0436364_0675103 3300037853 Bacteria 5378
222 Ga0436364_1043593 3300037853 Unclassified 2609
223 Ga0436364_1119186 3300037853 Bacteria 34885
224 Ga0436364_1132821 3300037853 Bacteria 32633
225 Ga0436364_1433595 3300037853 Bacteria 6375
226 Ga0400483_039796 3300039062 Bacteria 16392
227 Ga0400483_229004 3300039062 Bacteria 22532
228 Ga0400483_249130 3300039062 Bacteria 20216
229 Ga0436365_1356538 3300039437 Bacteria 2326
230 Ga0436360_0338173 3300039438 Bacteria 1333
231 Ga0436360_0637340 3300039438 Bacteria 1252
232 Ga0436360_0908686 3300039438 Bacteria 1730
233 Ga0436360_1145423 3300039438 Bacteria 1004
234 Ga0436360_1365941 3300039438 Unclassified 854
235 Ga0436361_0589934 3300039447 Bacteria 2060
236 Ga0436361_1220798 3300039447 Bacteria 2752
237 Ga0436363_1465002 3300039450 Bacteria 1311
238 Ga0436362_0284789 3300039453 Bacteria 2542
239 Ga0439451_011970 3300042009 Bacteria 1750
240 Ga0439460_0002765 3300042461 Bacteria 4222
241 Ga0453684_0015114 3300044712 Bacteria 12249
242 Ga0495629_0256348 3300046459 Bacteria 1203
243 Ga0495653_0024610 3300046463 Bacteria 4849
244 Ga0495653_0077288 3300046463 Bacteria 2472
245 Ga0495662_0077465 3300046476 Bacteria 1615
246 Ga0495664_0003516 3300046477 Bacteria 8538
247 Ga0495594_0041084 3300046499 Bacteria 2533
248 Ga0495608_0014289 3300046511 Bacteria 5509
249 Ga0495608_0139323 3300046511 Unclassified 1549
250 Ga0495608_0206088 3300046511 Unclassified 1237
251 Ga0495628_0085543 3300046516 Bacteria 2446
252 Ga0495628_0422154 3300046516 Unclassified 972
253 Ga0495640_0119241 3300046533 Bacteria 1717
254 Ga0495640_0246426 3300046533 Bacteria 1120
255 Ga0495587_0004001 3300046536 Bacteria 9769
256 Ga0495645_0002815 3300046543 Bacteria 11798
257 Ga0495667_0005126 3300046559 Bacteria 8852
258 Ga0495667_0019864 3300046559 Bacteria 4534
259 Ga0495667_0227723 3300046559 Unclassified 1189
260 Ga0495659_0040325 3300046664 Bacteria 1664
261 Ga0495657_0140146 3300046675 Bacteria 1508
262 Ga0495599_0030925 3300046678 Bacteria 3360
263 Ga0495599_0114181 3300046678 Bacteria 1681
264 Ga0495646_0014032 3300046680 Bacteria 5094
265 Ga0495646_0119590 3300046680 Unclassified 1492
266 Ga0495600_0170055 3300046809 Bacteria 1407
267 Ga0495674_0026108 3300047319 Bacteria 5346
268 Ga0495674_0105948 3300047319 Bacteria 2388
269 Ga0495674_0235211 3300047319 Bacteria 1511
270 Ga0495680_0036924 3300047322 Unclassified 3917
271 Ga0495680_0038277 3300047322 Bacteria 3835
272 Ga0495680_0084000 3300047322 Bacteria 2400
273 Ga0495675_0093757 3300047444 Bacteria 1883
274 Ga0495684_0038943 3300047471 Bacteria 3644
275 Ga0495684_0100819 3300047471 Bacteria 2183
276 Ga0495684_0222868 3300047471 Bacteria 1382
277 Ga0495602_0001287 3300048088 Bacteria 24718
278 Ga0496101_0237713 3300048904 Bacteria 1417
279 Ga0496104_0017889 3300048907 Bacteria 6463
280 Ga0496108_0037645 3300048911 Bacteria 4031
281 Ga0496109_0521819 3300048912 Unclassified 1121
282 Ga0496110_0322420 3300048913 Bacteria 1407
283 Ga0496112_0203324 3300048915 Unclassified 1939
284 Ga0496112_0296744 3300048915 Bacteria 1562
285 Ga0496112_0407895 3300048915 Bacteria 1298
286 Ga0496113_0166158 3300048916 Bacteria 1746
287 Ga0496115_0101538 3300048918 Bacteria 2359
288 Ga0496120_0133251 3300048923 Unclassified 1270
289 Ga0496126_0209864 3300048929 Bacteria 1640
290 Ga0501299_021478 3300049522 Bacteria 1184
291 Ga0501299_029507 3300049522 Bacteria 1051
292 Ga0501031_0075026 3300049568 Bacteria 2202
293 Ga0501031_0264074 3300049568 Bacteria 1118
294 Ga0501032_0037870 3300049569 Bacteria 3287
295 Ga0501036_0028511 3300049572 Bacteria 4717
296 Ga0501036_0085297 3300049572 Bacteria 2669
297 Ga0501036_0187418 3300049572 Bacteria 1741
298 Ga0501036_0241622 3300049572 Bacteria 1514
299 Ga0501037_0081298 3300049573 Bacteria 2350
300 Ga0501037_0268549 3300049573 Bacteria 1191
301 Ga0501038_0008917 3300049574 Bacteria 9202
302 Ga0501038_0166539 3300049574 Bacteria 1787
303 Ga0501039_0102073 3300049575 Bacteria 2238
304 Ga0501039_0404845 3300049575 Bacteria 1071
305 Ga0501040_0002278 3300049576 Bacteria 12335
306 Ga0501041_0003252 3300049577 Bacteria 9344
307 Ga0501041_0005337 3300049577 Bacteria 7521
308 Ga0501041_0062998 3300049577 Bacteria 2271
309 Ga0501042_0283081 3300049578 Bacteria 1198
310 Ga0501043_0000024 3300049579 Bacteria 154045
311 Ga0501043_0004421 3300049579 Bacteria 11419
312 Ga0501043_0216434 3300049579 Unclassified 1483
313 Ga0501046_0000173 3300049580 Bacteria 65571
314 Ga0501046_0005084 3300049580 Bacteria 11794
315 Ga0501047_0000051 3300049581 Bacteria 154281
316 Ga0501047_0264283 3300049581 Unclassified 1568
317 Ga0501048_0000650 3300049582 Bacteria 25020
318 Ga0501048_0046768 3300049582 Bacteria 3089
319 Ga0501048_0161964 3300049582 Bacteria 1583
320 Ga0501068_0025847 3300049584 Bacteria 3456
321 Ga0501069_0081854 3300049585 Bacteria 1819
322 Ga0501069_0160947 3300049585 Bacteria 1292
323 Ga0501070_0387964 3300049586 Bacteria 1131
324 Ga0501071_0164840 3300049587 Bacteria 1658
325 Ga0501072_0003779 3300049588 Bacteria 11432
326 Ga0501072_0025526 3300049588 Bacteria 4602
327 Ga0501072_0289630 3300049588 Bacteria 1302
328 Ga0501074_0009878 3300049590 Bacteria 6932
329 Ga0501074_0399349 3300049590 Bacteria 975
330 Ga0501074_0400956 3300049590 Unclassified 973
331 Ga0501075_0024349 3300049591 Bacteria 4438
332 Ga0501075_0096102 3300049591 Bacteria 2248
333 Ga0501075_0126140 3300049591 Bacteria 1949
334 Ga0501076_0006932 3300049592 Bacteria 8232
335 Ga0501077_0018502 3300049593 Bacteria 4407
336 Ga0501077_0088674 3300049593 Bacteria 1960
337 Ga0501077_0104290 3300049593 Viruses 1797
338 Ga0501077_0163223 3300049593 Bacteria 1415
339 Ga0501079_0003567 3300049741 Bacteria 11447
340 Ga0501080_0038583 3300049742 Bacteria 4459
341 Ga0501080_0169968 3300049742 Bacteria 2011
342 Ga0501081_0049302 3300049743 Bacteria 2899
343 Ga0501081_0063967 3300049743 Bacteria 2554
344 Ga0501081_0113846 3300049743 Bacteria 1921
345 Ga0501081_0295715 3300049743 Bacteria 1187
346 Ga0501083_0209723 3300049744 Bacteria 1270
347 Ga0501035_0083930 3300049822 Bacteria 2810
348 Ga0501045_0002923 3300049824 Bacteria 11681
349 Ga0501045_0031418 3300049824 Bacteria 3846
350 Ga0501045_0059517 3300049824 Bacteria 2798
351 Ga0501045_0261283 3300049824 Bacteria 1289
352 nmdc:mga0yw44_197708_c1 3300050492 Bacteria 1327
353 nmdc:mga0yw44_29248_c1 3300050492 Bacteria 3179
354 nmdc:mga0k408_157964_c1 3300050493 Bacteria 1351
355 nmdc:mga06z11_19196_c1 3300050494 Bacteria 3137
356 nmdc:mga07m45_32358_c1 3300050496 Bacteria 2076
357 nmdc:mga05p37_146237_c1 3300050507 Bacteria 2894
358 nmdc:mga05p37_241254_c1 3300050507 Bacteria 2173
359 nmdc:mga05p37_312296_c1 3300050507 Bacteria 1863
360 nmdc:mga05p37_33468_c1 3300050507 Unclassified 2878
361 nmdc:mga05p37_89396_c1 3300050507 Bacteria 3066
362 nmdc:mga05p37_9193_c1 3300050507 Bacteria 11680
363 nmdc:mga09592_132053_c1 3300050508 Bacteria 2149
364 nmdc:mga09592_132221_c1 3300050508 Bacteria 2148
365 nmdc:mga09592_317006_c1 3300050508 Bacteria 1351
366 nmdc:mga09592_40461_c1 3300050508 Bacteria 3916
367 nmdc:mga0qj67_1053_c1 3300050509 Bacteria 19086
368 nmdc:mga0qj67_146714_c1 3300050509 Bacteria 1913
369 nmdc:mga0qj67_23670_c1 3300050509 Bacteria 4726
370 nmdc:mga06r32_15966_c1 3300050510 Bacteria 6832
371 nmdc:mga06r32_420668_c1 3300050510 Bacteria 1317
372 nmdc:mga08y16_1491_c1 3300050511 Bacteria 23546
373 nmdc:mga08y16_26941_c1 3300050511 Bacteria 6057
374 nmdc:mga08y16_66914_c1 3300050511 Bacteria 3749
375 nmdc:mga0n895_172100_c1 3300050512 Bacteria 2197
376 nmdc:mga0n895_208550_c1 3300050512 Bacteria 1985
377 nmdc:mga0rr50_10702_c1 3300050513 Bacteria 5840
378 nmdc:mga0rr50_19294_c1 3300050513 Bacteria 4599
379 nmdc:mga0rr50_28227_c1 3300050513 Bacteria 3942
380 nmdc:mga0rr50_66621_c1 3300050513 Bacteria 2733
381 nmdc:mga08x19_117179_c1 3300050514 Bacteria 1782
382 nmdc:mga08x19_2710_c1 3300050514 Bacteria 10713
383 nmdc:mga08x19_33018_c1 3300050514 Bacteria 3265
384 nmdc:mga08x19_59667_c1 3300050514 Bacteria 2470
385 nmdc:mga0a205_131918_c1 3300050515 Bacteria 2399
386 Ga0495601_0001243 3300053077 Bacteria 13971
387 Ga0495612_0002988 3300053078 Bacteria 7016
388 Ga0495595_0012829 3300053084 Bacteria 3533
389 Ga0495595_0061570 3300053084 Bacteria 1758
390 Ga0495619_0025658 3300053085 Bacteria 3787
391 Ga0500568_0003575 3300053139 Bacteria 8588
392 Ga0500616_0001129 3300053153 Bacteria 27455
393 Ga0500552_000060 3300053733 Bacteria 9063
394 Ga0501084_0007126 3300054114 Bacteria 9210
395 Ga0501084_0146608 3300054114 Bacteria 1988
396 Ga0501084_0292973 3300054114 Bacteria 1374
397 Ga0501082_0051449 3300060353 Bacteria 3550
398 Ga0501082_0207508 3300060353 Bacteria 1705
399 Ga0501082_0237486 3300060353 Bacteria 1586
400 Ga0530510_0017041 3300061734 Bacteria 5146
401 Ga0530510_0050495 3300061734 Bacteria 3004
402 2574430269 2574179768 Bacteria 4907129
403 2837186313 2837183177 Bacteria 4637169
404 2883581236 2883577096 Bacteria 4709178
405 2929200220 2929199973 Bacteria 7260745
406 8055912144 8055909800 Bacteria 7278581
407 Ga0068859_100088108
408 JGI25406J46586_10019138
409 Ga0070658_10006226
410 Ga0070683_100573618
411 Ga0070690_100016941
412 Ga0070680_100001388
413 Ga0070680_100070345
414 Ga0070680_100219503
415 Ga0070680_100529216
416 Ga0070682_100240995
417 Ga0070689_100029459
418 Ga0070689_100114092
419 Ga0070689_100123366
420 Ga0070691_10000536
421 Ga0070668_100374475
422 Ga0070659_100440223
423 Ga0070714_100037595
424 Ga0070714_100139726
425 Ga0070714_100140313
426 Ga0070714_100370924
427 Ga0070713_100011485
428 Ga0070713_100031915
429 Ga0070713_100338693
430 Ga0070710_10018661
431 Ga0070711_100074392
432 Ga0070705_100008518
433 Ga0070705_100023778
434 Ga0070700_100132741
435 Ga0070694_100019059
436 Ga0070694_100155822
437 Ga0070694_100302106
438 Ga0070708_100012015
439 Ga0070708_100075871
440 Ga0070681_10001404
441 Ga0070681_10014611
442 Ga0068867_100423271
443 Ga0070706_100044347
444 Ga0070706_100290612
445 Ga0070698_100000915
446 Ga0070698_100034500
447 Ga0070698_100174993
448 Ga0070699_100019483
449 Ga0070699_100020368
450 Ga0070699_100108009
451 Ga0070699_100151779
452 Ga0070699_100210487
453 Ga0070679_100003503
454 Ga0070679_100023146
455 Ga0070679_100182959
456 Ga0070684_100044123
457 Ga0070697_100038924
458 Ga0070697_100073558
459 Ga0070686_100288576
460 Ga0070695_100048905
461 Ga0070695_100128537
462 Ga0070696_100045157
463 Ga0070704_100003469
464 Ga0070704_100041503
465 Ga0068855_100006961
466 Ga0068856_100179048
467 Ga0070702_100051003
468 Ga0068859_100281558
469 Ga0068866_10146687
470 Ga0068860_100027791
471 Ga0068860_100089304
472 Ga0068862_100084028
473 Ga0081455_10005180
474 Ga0081538_10012399
475 Ga0081538_10013870
476 Ga0081539_10000161
477 Ga0081539_10000556
478 Ga0070717_10019691
479 Ga0075365_10032365
480 Ga0075365_10156072
481 Ga0075365_10223762
482 Ga0075365_10353794
483 Ga0070715_10091292
484 Ga0070712_100017210
485 Ga0075367_10022651
486 Ga0075369_10096169
487 Ga0075366_10003597
488 Ga0097621_100022942
489 Ga0068871_100006490
490 Ga0075428_100000848
491 Ga0075428_100012504
492 Ga0075428_100083780
493 Ga0075428_100705003
494 Ga0075430_100000185
495 Ga0075430_100154140
496 Ga0075431_100009631
497 Ga0075431_100015263
498 Ga0075431_100037010
499 Ga0075433_10068175
500 Ga0075433_10197124
501 Ga0075434_100037017
502 Ga0075434_100047386
503 Ga0075429_100021286
504 Ga0075429_100026726
505 Ga0075429_100177214
506 Ga0075429_100229716
507 Ga0075429_100300960
508 Ga0068865_100010427
509 Ga0075436_100000628
510 Ga0075436_100041007
511 Ga0075436_100041140
512 Ga0097620_100088109
513 Ga0097620_100281570
514 Ga0075435_100018408
515 Ga0075435_100022075
516 Ga0075435_100047770
517 Ga0105240_10006118
518 Ga0105240_10128174
519 Ga0111539_10001180
520 Ga0111539_10035049
521 Ga0111539_10046003
522 Ga0105245_10254806
523 Ga0105245_10398781
524 Ga0114129_10002145
525 Ga0114129_10039204
526 Ga0114129_10039515
527 Ga0114129_10161226
528 Ga0114129_10196211
529 Ga0114129_10564980
530 Ga0105242_10117803
531 Ga0105248_10851374
532 Ga0105249_10012926
533 Ga0105035_101459
534 Ga0099796_10079284
535 Ga0157369_10061554
536 Ga0157378_10694869
537 Ga0163162_10366713
538 Ga0163163_10067705
539 Ga0163163_10094838
540 Ga0163163_10220013
541 Ga0157379_10087130
542 Ga0157379_10114901
543 Ga0157376_10245837
544 Ga0213875_10000138
545 Ga0213875_10000708
546 Ga0213875_10020318
547 Ga0207692_10010690
548 Ga0207685_10047819
549 Ga0207684_10279194
550 Ga0207707_10001628
551 Ga0207707_10007503
552 Ga0207695_10347553
553 Ga0207695_10497125
554 Ga0207693_10086828
555 Ga0207693_10129387
556 Ga0207663_10009420
557 Ga0207660_10005682
558 Ga0207660_10014024
559 Ga0207660_10160581
560 Ga0207662_10064535
561 Ga0207652_10004944
562 Ga0207652_10393333
563 Ga0207652_10413434
564 Ga0207646_10019374
565 Ga0207681_10009119
566 Ga0207687_10091106
567 Ga0207700_10039144
568 Ga0207700_10240317
569 Ga0207664_10018276
570 Ga0207664_10104043
571 Ga0207690_10364641
572 Ga0207686_10131857
573 Ga0207709_10217776
574 Ga0207669_10404501
575 Ga0207665_10020279
576 Ga0207665_10218949
577 Ga0207691_10102253
578 Ga0207711_10722219
579 Ga0207689_10059749
580 Ga0207667_10010630
581 Ga0207708_10087551
582 Ga0207702_10083228
583 Ga0207648_10000443
584 Ga0207674_10028477
585 Ga0210000_1009433
586 Ga0209968_1008633
587 Ga0209999_1011834
588 Ga0207428_10005229
589 Ga0207428_10141693
590 Ga0268264_10207510
591 Ga0265334_10001215
592 Ga0265323_10005921
593 Ga0265338_10051310
594 Ga0265338_10217835
595 Ga0265316_10028453
596 Ga0316576_10004948
597 Ga0316578_10018025
598 Ga0316578_10028659
599 Ga0307407_10159528
600 Ga0307412_10235748
601 Ga0316580_10003936
602 Ga0373926_0121682
603 Ga0373936_0025814
604 Ga0373936_0134015
605 Ga0373941_0064368
606 Ga0373956_0040388
607 Ga0373955_0153100
608 Ga0373955_0199732
609 Ga0373924_0002883
610 Ga0373924_0007062
611 Ga0373935_0055493
612 Ga0373935_0187154
613 Ga0373927_0030761
614 Ga0373927_0089284
615 Ga0373927_0096950
616 Ga0373933_0001156
617 Ga0373933_0305228
618 Ga0373947_0036725
619 Ga0373947_0098365
620 Ga0373937_0001827
621 Ga0373937_0002205
622 Ga0373937_0012596
623 Ga0373937_0276764
624 Ga0316584_0038956
625 Ga0373925_0021074
626 Ga0373925_0336090
627 Ga0436364_0675103
628 Ga0436364_1043593
629 Ga0436364_1119186
630 Ga0436364_1132821
631 Ga0436364_1433595
632 Ga0400483_039796
633 Ga0400483_229004
634 Ga0400483_249130
635 Ga0436365_1356538
636 Ga0436360_0338173
637 Ga0436360_0637340
638 Ga0436360_0908686
639 Ga0436360_1145423
640 Ga0436360_1365941
641 Ga0436361_0589934
642 Ga0436361_1220798
643 Ga0436363_1465002
644 Ga0436362_0284789
645 Ga0439451_011970
646 Ga0439460_0002765
647 Ga0453684_0015114
648 Ga0495629_0256348
649 Ga0495653_0024610
650 Ga0495653_0077288
651 Ga0495662_0077465
652 Ga0495664_0003516
653 Ga0495594_0041084
654 Ga0495608_0014289
655 Ga0495608_0139323
656 Ga0495608_0206088
657 Ga0495628_0085543
658 Ga0495628_0422154
659 Ga0495640_0119241
660 Ga0495640_0246426
661 Ga0495587_0004001
662 Ga0495645_0002815
663 Ga0495667_0005126
664 Ga0495667_0019864
665 Ga0495667_0227723
666 Ga0495659_0040325
667 Ga0495657_0140146
668 Ga0495599_0030925
669 Ga0495599_0114181
670 Ga0495646_0014032
671 Ga0495646_0119590
672 Ga0495600_0170055
673 Ga0495674_0026108
674 Ga0495674_0105948
675 Ga0495674_0235211
676 Ga0495680_0036924
677 Ga0495680_0038277
678 Ga0495680_0084000
679 Ga0495675_0093757
680 Ga0495684_0038943
681 Ga0495684_0100819
682 Ga0495684_0222868
683 Ga0495602_0001287
684 Ga0496101_0237713
685 Ga0496104_0017889
686 Ga0496108_0037645
687 Ga0496109_0521819
688 Ga0496110_0322420
689 Ga0496112_0203324
690 Ga0496112_0296744
691 Ga0496112_0407895
692 Ga0496113_0166158
693 Ga0496115_0101538
694 Ga0496120_0133251
695 Ga0496126_0209864
696 Ga0501299_021478
697 Ga0501299_029507
698 Ga0501031_0075026
699 Ga0501031_0264074
700 Ga0501032_0037870
701 Ga0501036_0028511
702 Ga0501036_0085297
703 Ga0501036_0187418
704 Ga0501036_0241622
705 Ga0501037_0081298
706 Ga0501037_0268549
707 Ga0501038_0008917
708 Ga0501038_0166539
709 Ga0501039_0102073
710 Ga0501039_0404845
711 Ga0501040_0002278
712 Ga0501041_0003252
713 Ga0501041_0005337
714 Ga0501041_0062998
715 Ga0501042_0283081
716 Ga0501043_0000024
717 Ga0501043_0004421
718 Ga0501043_0216434
719 Ga0501046_0000173
720 Ga0501046_0005084
721 Ga0501047_0000051
722 Ga0501047_0264283
723 Ga0501048_0000650
724 Ga0501048_0046768
725 Ga0501048_0161964
726 Ga0501068_0025847
727 Ga0501069_0081854
728 Ga0501069_0160947
729 Ga0501070_0387964
730 Ga0501071_0164840
731 Ga0501072_0003779
732 Ga0501072_0025526
733 Ga0501072_0289630
734 Ga0501074_0009878
735 Ga0501074_0399349
736 Ga0501074_0400956
737 Ga0501075_0024349
738 Ga0501075_0096102
739 Ga0501075_0126140
740 Ga0501076_0006932
741 Ga0501077_0018502
742 Ga0501077_0088674
743 Ga0501077_0104290
744 Ga0501077_0163223
745 Ga0501079_0003567
746 Ga0501080_0038583
747 Ga0501080_0169968
748 Ga0501081_0049302
749 Ga0501081_0063967
750 Ga0501081_0113846
751 Ga0501081_0295715
752 Ga0501083_0209723
753 Ga0501035_0083930
754 Ga0501045_0002923
755 Ga0501045_0031418
756 Ga0501045_0059517
757 Ga0501045_0261283
758 nmdc:mga0yw44_197708_c1
759 nmdc:mga0yw44_29248_c1
760 nmdc:mga0k408_157964_c1
761 nmdc:mga06z11_19196_c1
762 nmdc:mga07m45_32358_c1
763 nmdc:mga05p37_146237_c1
764 nmdc:mga05p37_241254_c1
765 nmdc:mga05p37_312296_c1
766 nmdc:mga05p37_33468_c1
767 nmdc:mga05p37_89396_c1
768 nmdc:mga05p37_9193_c1
769 nmdc:mga09592_132053_c1
770 nmdc:mga09592_132221_c1
771 nmdc:mga09592_317006_c1
772 nmdc:mga09592_40461_c1
773 nmdc:mga0qj67_1053_c1
774 nmdc:mga0qj67_146714_c1
775 nmdc:mga0qj67_23670_c1
776 nmdc:mga06r32_15966_c1
777 nmdc:mga06r32_420668_c1
778 nmdc:mga08y16_1491_c1
779 nmdc:mga08y16_26941_c1
780 nmdc:mga08y16_66914_c1
781 nmdc:mga0n895_172100_c1
782 nmdc:mga0n895_208550_c1
783 nmdc:mga0rr50_10702_c1
784 nmdc:mga0rr50_19294_c1
785 nmdc:mga0rr50_28227_c1
786 nmdc:mga0rr50_66621_c1
787 nmdc:mga08x19_117179_c1
788 nmdc:mga08x19_2710_c1
789 nmdc:mga08x19_33018_c1
790 nmdc:mga08x19_59667_c1
791 nmdc:mga0a205_131918_c1
792 Ga0495601_0001243
793 Ga0495612_0002988
794 Ga0495595_0012829
795 Ga0495595_0061570
796 Ga0495619_0025658
797 Ga0500568_0003575
798 Ga0500616_0001129
799 Ga0500552_000060
800 Ga0501084_0007126
801 Ga0501084_0146608
802 Ga0501084_0292973
803 Ga0501082_0051449
804 Ga0501082_0207508
805 Ga0501082_0237486
806 Ga0530510_0017041
807 Ga0530510_0050495
808 2574430269
809 2837186313
810 2883581236
811 2929200220
812 8055912144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

29

188

0.98

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

11

117

0.88

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

191

312

0.87

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

29

110

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9458 2 286
1vpd-assembly1.cif.gz_A x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] 0.9431 1 296
1vpd-assembly1.cif.gz_A x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] 0.9401 1 296
3doj-assembly1.cif.gz_A structure of glyoxylate reductase 1 from arabidopsis (atglyr1) 0.9379 1 283
3cky-assembly2.cif.gz_D structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation 0.9356 51 295
ID Description Score Start End Superfamily
af_Q4DFE2_2_165_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9847 1 161 3.40.50.720
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.981 2 163 3.40.50.720
af_Q9C991_11_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9769 2 161 3.40.50.720
5je8D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9704 2 161 3.40.50.720
af_P0A9V8_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9701 3 157 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V6WVQ1-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9882 1 137 GO:0016616
GO:0050661
AF-A0A382UF98-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.9862 2 144 GO:0050661
AF-A0A2V7HW24-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9837 1 119 GO:0016616
GO:0050661
AF-A0A2V6WVQ1-F1-model_v4 3-hydroxyisobutyrate dehydrogenase 0.9811 1 137 GO:0016616
GO:0050661
AF-A0A539E7Y2-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9809 11 173 GO:0050661

Map