F436129

General Info

Members Datasets Scaffolds Average Seq Length
406 251 812 227

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10115614|Ga0070677_101156142
Length 251
Sequence VTLLQLDVPLIDRDRPAKIVDIVTMDTDTRDAVIPPLVNAIRMLTQAELVDYSGHCSARRDAGSFYINSAASVRSTLTADDIVAIDFDGELREGSDRPPLEFPLHAEIYRVRSDVRVVMHTHPKWSTLLTMVGAPFRPVFPQGALLGDVPVLDTPLSVNTREMGASAAAALGAGPALLLKSHGAVVVGSDIVQCFALAIYLEENASRQYMAMQIGSPYIFSEAEQEACRARLASPALFRKAWDHYRAKLGH

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 1.48
Rhizosphere 97.29
Stem 0
Stem Tuber 0
Unclassified 24.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10115614 3300005333 Bacteria 1204
2 Ga0065712_10035878 3300005290 Unclassified 981
3 Ga0065712_10049532 3300005290 Bacteria 863
4 Ga0065715_10039850 3300005293 Bacteria 1972
5 Ga0065715_10212886 3300005293 Bacteria 1290
6 Ga0065707_10005901 3300005295 Bacteria 3707
7 Ga0070658_10285791 3300005327 Bacteria 1405
8 Ga0070676_10082183 3300005328 Bacteria 1956
9 Ga0070676_10129982 3300005328 Unclassified 1591
10 Ga0070683_100200150 3300005329 Unclassified 1897
11 Ga0070690_100116254 3300005330 Unclassified 1790
12 Ga0070670_100050889 3300005331 Bacteria 3559
13 Ga0070670_100123685 3300005331 Bacteria 2232
14 Ga0070670_100275200 3300005331 Unclassified 1469
15 Ga0070670_100312720 3300005331 Bacteria 1375
16 Ga0070677_10250006 3300005333 Bacteria 880
17 Ga0070666_10037728 3300005335 Bacteria 3214
18 Ga0070666_10165121 3300005335 Unclassified 1548
19 Ga0070680_100165010 3300005336 Bacteria 1862
20 Ga0070660_100017394 3300005339 Bacteria 5240
21 Ga0070660_100079189 3300005339 Bacteria 2578
22 Ga0070689_100355631 3300005340 Unclassified 1229
23 Ga0070689_100593944 3300005340 Bacteria 958
24 Ga0070691_10109864 3300005341 Unclassified 1378
25 Ga0070687_100091891 3300005343 Unclassified 1681
26 Ga0070675_100060992 3300005354 Bacteria 3114
27 Ga0070675_100094445 3300005354 Bacteria 2509
28 Ga0070675_100827713 3300005354 Bacteria 847
29 Ga0070671_100070261 3300005355 Unclassified 2921
30 Ga0070674_100030466 3300005356 Bacteria 3565
31 Ga0070674_100563067 3300005356 Bacteria 958
32 Ga0070673_100009090 3300005364 Bacteria 6652
33 Ga0070673_100243274 3300005364 Bacteria 1565
34 Ga0070673_100522831 3300005364 Unclassified 1075
35 Ga0070688_100033161 3300005365 Bacteria 3120
36 Ga0070688_100197457 3300005365 Bacteria 1405
37 Ga0070667_100088275 3300005367 Bacteria 2662
38 Ga0070709_10215651 3300005434 Unclassified 1366
39 Ga0070713_100063655 3300005436 Bacteria 3093
40 Ga0070701_10111695 3300005438 Unclassified 1528
41 Ga0070705_100000232 3300005440 Bacteria 33169
42 Ga0070705_100087251 3300005440 Bacteria 1934
43 Ga0070705_100109282 3300005440 Bacteria 1763
44 Ga0070700_100039979 3300005441 Bacteria 2868
45 Ga0070694_100005469 3300005444 Bacteria 7692
46 Ga0070694_100138061 3300005444 Bacteria 1768
47 Ga0070708_100280646 3300005445 Unclassified 1568
48 Ga0070663_100111595 3300005455 Unclassified 2055
49 Ga0070678_100007570 3300005456 Bacteria 6451
50 Ga0070678_100255212 3300005456 Bacteria 1472
51 Ga0070662_100429634 3300005457 Unclassified 1094
52 Ga0070662_100619009 3300005457 Bacteria 912
53 Ga0070681_10046960 3300005458 Bacteria 4317
54 Ga0070681_10066195 3300005458 Bacteria 3582
55 Ga0070681_10428831 3300005458 Bacteria 1234
56 Ga0068867_100025972 3300005459 Bacteria 4202
57 Ga0068867_100122634 3300005459 Bacteria 2010
58 Ga0070706_100156452 3300005467 Unclassified 2128
59 Ga0070706_100564859 3300005467 Bacteria 1058
60 Ga0070706_100804818 3300005467 Unclassified 870
61 Ga0070707_100049272 3300005468 Bacteria 4037
62 Ga0070707_100203838 3300005468 Unclassified 1928
63 Ga0070707_100265050 3300005468 Bacteria 1671
64 Ga0070698_100209618 3300005471 Bacteria 1884
65 Ga0070698_100234444 3300005471 Bacteria 1768
66 Ga0070699_100158607 3300005518 Bacteria 2002
67 Ga0070699_100418703 3300005518 Bacteria 1212
68 Ga0070679_100307510 3300005530 Bacteria 1535
69 Ga0070684_100076166 3300005535 Bacteria 2961
70 Ga0070684_100229305 3300005535 Unclassified 1696
71 Ga0070672_100009287 3300005543 Bacteria 6774
72 Ga0070672_100065861 3300005543 Unclassified 2867
73 Ga0070672_100102217 3300005543 Unclassified 2326
74 Ga0070672_100165234 3300005543 Bacteria 1838
75 Ga0070672_100170978 3300005543 Bacteria 1807
76 Ga0070686_100198235 3300005544 Bacteria 1437
77 Ga0070695_100001588 3300005545 Bacteria 12702
78 Ga0070695_100305362 3300005545 Bacteria 1178
79 Ga0070696_100000411 3300005546 Bacteria 26681
80 Ga0070693_100004695 3300005547 Bacteria 6493
81 Ga0070665_100192913 3300005548 Bacteria 2038
82 Ga0070704_100023494 3300005549 Bacteria 4028
83 Ga0070704_100187189 3300005549 Bacteria 1661
84 Ga0070702_100002999 3300005615 Bacteria 7463
85 Ga0068852_100866732 3300005616 Unclassified 919
86 Ga0068859_100302660 3300005617 Bacteria 1692
87 Ga0068864_100065256 3300005618 Bacteria 3158
88 Ga0068864_100104466 3300005618 Unclassified 2517
89 Ga0068864_100840110 3300005618 Bacteria 904
90 Ga0068866_10041066 3300005718 Bacteria 2293
91 Ga0068870_10272651 3300005840 Archaea 1057
92 Ga0068863_100110449 3300005841 Unclassified 2618
93 Ga0068863_100258147 3300005841 Unclassified 1684
94 Ga0068863_101409807 3300005841 Unclassified 704
95 Ga0068858_100038585 3300005842 Bacteria 4431
96 Ga0081455_10243423 3300005937 Bacteria 1320
97 Ga0070717_10022080 3300006028 Bacteria 5025
98 Ga0070717_10260867 3300006028 Bacteria 1533
99 Ga0075364_10521132 3300006051 Bacteria 813
100 Ga0097621_100729442 3300006237 Unclassified 914
101 Ga0068871_100173129 3300006358 Unclassified 1852
102 Ga0075428_100000521 3300006844 Bacteria 39098
103 Ga0075428_100263084 3300006844 Unclassified 1857
104 Ga0075430_100034599 3300006846 Bacteria 4288
105 Ga0075430_100124805 3300006846 Bacteria 2146
106 Ga0075430_100261937 3300006846 Bacteria 1432
107 Ga0075431_100121142 3300006847 Bacteria 2699
108 Ga0075431_100203178 3300006847 Unclassified 2027
109 Ga0075433_10521076 3300006852 Unclassified 1046
110 Ga0075434_100000396 3300006871 Bacteria 31984
111 Ga0075434_100008950 3300006871 Bacteria 9323
112 Ga0075434_100076766 3300006871 Bacteria 3336
113 Ga0075434_100333459 3300006871 Unclassified 1537
114 Ga0075429_100163642 3300006880 Unclassified 1949
115 Ga0075429_100183648 3300006880 Bacteria 1833
116 Ga0068865_100147022 3300006881 Unclassified 1784
117 Ga0068865_100234410 3300006881 Bacteria 1441
118 Ga0075436_100019810 3300006914 Unclassified 4614
119 Ga0075436_100230265 3300006914 Bacteria 1316
120 Ga0075436_100477003 3300006914 Unclassified 911
121 Ga0097620_100302648 3300006931 Bacteria 1692
122 Ga0097620_100320928 3300006931 Bacteria 1643
123 Ga0075435_100000044 3300007076 Bacteria 62958
124 Ga0075435_100004922 3300007076 Bacteria 9263
125 Ga0075435_100012008 3300007076 Bacteria 6399
126 Ga0075435_100180923 3300007076 Bacteria 1782
127 Ga0075435_100216658 3300007076 Unclassified 1625
128 Ga0099794_10072688 3300007265 Bacteria 1686
129 Ga0099795_10057458 3300007788 Bacteria 1434
130 Ga0105240_10049915 3300009093 Bacteria 5277
131 Ga0105240_10463008 3300009093 Bacteria 1416
132 Ga0111539_10066299 3300009094 Bacteria 4264
133 Ga0111539_10384198 3300009094 Bacteria 1635
134 Ga0105245_10055577 3300009098 Bacteria 3556
135 Ga0105245_10519872 3300009098 Unclassified 1209
136 Ga0105247_10013138 3300009101 Bacteria 4967
137 Ga0114129_10035405 3300009147 Bacteria 7053
138 Ga0114129_10043397 3300009147 Bacteria 6326
139 Ga0114129_10132294 3300009147 Bacteria 3425
140 Ga0114129_10178933 3300009147 Bacteria 2887
141 Ga0114129_10221964 3300009147 Bacteria 2549
142 Ga0105243_10118847 3300009148 Unclassified 2225
143 Ga0105241_10217746 3300009174 Bacteria 1603
144 Ga0105242_10440124 3300009176 Bacteria 1226
145 Ga0105242_10452282 3300009176 Unclassified 1211
146 Ga0105242_10591330 3300009176 Bacteria 1070
147 Ga0105248_10118688 3300009177 Bacteria 2984
148 Ga0105248_10138233 3300009177 Unclassified 2748
149 Ga0105248_10239254 3300009177 Bacteria 2044
150 Ga0105239_10187254 3300010375 Unclassified 2316
151 Ga0105246_10932238 3300011119 Unclassified 781
152 Ga0157374_10146513 3300013296 Bacteria 2293
153 Ga0163162_10390036 3300013306 Bacteria 1525
154 Ga0163162_10418003 3300013306 Unclassified 1473
155 Ga0157372_10339003 3300013307 Unclassified 1751
156 Ga0157375_10158657 3300013308 Unclassified 2403
157 Ga0157380_10697557 3300014326 Unclassified 1020
158 Ga0157376_10245907 3300014969 Bacteria 1669
159 Ga0157376_10333996 3300014969 Unclassified 1445
160 Ga0157376_10802910 3300014969 Unclassified 954
161 Ga0163161_10224686 3300017792 Unclassified 1455
162 Ga0207697_10072979 3300025315 Unclassified 1440
163 Ga0207656_10110010 3300025321 Bacteria 1272
164 Ga0207682_10001305 3300025893 Bacteria 11444
165 Ga0207682_10212171 3300025893 Bacteria 893
166 Ga0207642_10089512 3300025899 Bacteria 1517
167 Ga0207710_10013088 3300025900 Bacteria 3494
168 Ga0207688_10046936 3300025901 Bacteria 2412
169 Ga0207647_10065858 3300025904 Unclassified 2198
170 Ga0207645_10012564 3300025907 Bacteria 5742
171 Ga0207645_10027461 3300025907 Bacteria 3675
172 Ga0207643_10188136 3300025908 Unclassified 1252
173 Ga0207705_10325567 3300025909 Unclassified 1181
174 Ga0207684_10038375 3300025910 Bacteria 4064
175 Ga0207684_10490478 3300025910 Bacteria 1053
176 Ga0207707_10087435 3300025912 Bacteria 2723
177 Ga0207695_10115337 3300025913 Bacteria 2661
178 Ga0207660_10143277 3300025917 Bacteria 1829
179 Ga0207662_10049979 3300025918 Bacteria 2482
180 Ga0207657_10048150 3300025919 Bacteria 3722
181 Ga0207649_10362851 3300025920 Unclassified 1075
182 Ga0207652_10184365 3300025921 Bacteria 1876
183 Ga0207646_10312767 3300025922 Bacteria 1419
184 Ga0207650_10071720 3300025925 Bacteria 2606
185 Ga0207650_10086519 3300025925 Unclassified 2386
186 Ga0207650_10180533 3300025925 Unclassified 1682
187 Ga0207659_10103917 3300025926 Bacteria 2148
188 Ga0207659_10750357 3300025926 Archaea 837
189 Ga0207700_10011466 3300025928 Bacteria 5652
190 Ga0207700_10802668 3300025928 Unclassified 842
191 Ga0207644_10022998 3300025931 Bacteria 4264
192 Ga0207644_10210369 3300025931 Bacteria 1537
193 Ga0207690_10228049 3300025932 Unclassified 1429
194 Ga0207706_10060250 3300025933 Bacteria 3342
195 Ga0207706_10062449 3300025933 Bacteria 3280
196 Ga0207686_10264376 3300025934 Unclassified 1263
197 Ga0207686_10370300 3300025934 Bacteria 1084
198 Ga0207709_10106163 3300025935 Unclassified 1868
199 Ga0207670_10166082 3300025936 Unclassified 1651
200 Ga0207669_10151982 3300025937 Bacteria 1623
201 Ga0207669_10166160 3300025937 Unclassified 1565
202 Ga0207665_10003431 3300025939 Bacteria 10602
203 Ga0207691_10002232 3300025940 Bacteria 18962
204 Ga0207691_10036908 3300025940 Bacteria 4527
205 Ga0207691_10188194 3300025940 Bacteria 1801
206 Ga0207691_10286747 3300025940 Bacteria 1416
207 Ga0207711_10102655 3300025941 Unclassified 2531
208 Ga0207711_10552135 3300025941 Unclassified 1074
209 Ga0207689_10140621 3300025942 Bacteria 1988
210 Ga0207689_10431504 3300025942 Unclassified 1100
211 Ga0207661_10087405 3300025944 Bacteria 2589
212 Ga0207661_10566324 3300025944 Bacteria 1041
213 Ga0207679_10051593 3300025945 Bacteria 3011
214 Ga0207679_10271773 3300025945 Bacteria 1450
215 Ga0207679_10277722 3300025945 Unclassified 1435
216 Ga0207679_10938128 3300025945 Bacteria 792
217 Ga0207667_10170916 3300025949 Bacteria 2234
218 Ga0207667_10766959 3300025949 Bacteria 963
219 Ga0207651_10033017 3300025960 Bacteria 3332
220 Ga0207651_10175176 3300025960 Unclassified 1696
221 Ga0207651_10187149 3300025960 Unclassified 1648
222 Ga0207712_10084219 3300025961 Bacteria 2323
223 Ga0207668_10679836 3300025972 Unclassified 903
224 Ga0207668_10793634 3300025972 Bacteria 838
225 Ga0207640_10017754 3300025981 Bacteria 4169
226 Ga0207677_10125572 3300026023 Bacteria 1938
227 Ga0207708_10003842 3300026075 Bacteria 11067
228 Ga0207708_10181855 3300026075 Bacteria 1669
229 Ga0207641_10980393 3300026088 Bacteria 841
230 Ga0207648_10021088 3300026089 Bacteria 5859
231 Ga0207648_10054538 3300026089 Bacteria 3491
232 Ga0207648_10370761 3300026089 Unclassified 1293
233 Ga0207676_10094005 3300026095 Bacteria 2469
234 Ga0207676_10249487 3300026095 Bacteria 1597
235 Ga0207676_10409773 3300026095 Unclassified 1269
236 Ga0207675_100012373 3300026118 Bacteria 7970
237 Ga0207675_100020687 3300026118 Bacteria 6134
238 Ga0207683_10602337 3300026121 Bacteria 1017
239 Ga0207698_10499003 3300026142 Unclassified 1184
240 Ga0209588_1071670 3300027671 Bacteria 1119
241 Ga0207428_10346178 3300027907 Unclassified 1094
242 Ga0268266_10055033 3300028379 Bacteria 3420
243 Ga0268266_10205855 3300028379 Bacteria 1803
244 Ga0265327_10146807 3300031251 Unclassified 1098
245 Ga0307405_10039287 3300031731 Bacteria 2859
246 Ga0307412_10075927 3300031911 Bacteria 2307
247 Ga0307507_10023613 3300033179 Bacteria 6741
248 Ga0373926_0190935 3300035083 Unclassified 787
249 Ga0373934_0001153 3300035086 Bacteria 9631
250 Ga0373934_0008204 3300035086 Bacteria 3889
251 Ga0373949_0012569 3300035090 Bacteria 1874
252 Ga0373923_0000056 3300035111 Bacteria 17507
253 Ga0373945_0064892 3300035116 Bacteria 1370
254 Ga0373953_0005940 3300035117 Bacteria 3995
255 Ga0373954_0021985 3300035118 Bacteria 2891
256 Ga0373956_0001058 3300035119 Bacteria 11333
257 Ga0373956_0040340 3300035119 Bacteria 2070
258 Ga0373943_0072394 3300035170 Bacteria 1748
259 Ga0373955_0005370 3300035172 Bacteria 5753
260 Ga0373955_0014567 3300035172 Bacteria 3828
261 Ga0373942_0001956 3300035207 Bacteria 5153
262 Ga0373924_0001051 3300035410 Bacteria 8793
263 Ga0373924_0029120 3300035410 Bacteria 2206
264 Ga0373935_0001625 3300035692 Bacteria 12545
265 Ga0373927_0210821 3300035695 Bacteria 1276
266 Ga0373933_0001112 3300035724 Bacteria 16015
267 Ga0373933_0015107 3300035724 Bacteria 4303
268 Ga0373937_0003821 3300036401 Bacteria 12726
269 Ga0373937_0008981 3300036401 Bacteria 8676
270 Ga0373937_0611390 3300036401 Bacteria 1034
271 Ga0373925_0727909 3300037068 Bacteria 818
272 Ga0395901_0254485 3300038443 Bacteria 1829
273 Ga0395901_0579931 3300038443 Unclassified 1133
274 Ga0436360_0431417 3300039438 Bacteria 1155
275 Ga0451853_0312867 3300041512 Bacteria 1867
276 Ga0439441_007177 3300042001 Bacteria 1787
277 Ga0439464_0072351 3300042439 Bacteria 1021
278 Ga0451576_0222567 3300045051 Unclassified 1970
279 Ga0451576_0359216 3300045051 Bacteria 1525
280 Ga0495592_0000440 3300046454 Bacteria 31213
281 Ga0495592_0004872 3300046454 Bacteria 9878
282 Ga0495603_0086385 3300046455 Bacteria 1836
283 Ga0495629_0108984 3300046459 Bacteria 1931
284 Ga0495641_0008790 3300046461 Bacteria 6092
285 Ga0495641_0145508 3300046461 Unclassified 1059
286 Ga0495651_0011660 3300046462 Bacteria 6756
287 Ga0495651_0058431 3300046462 Bacteria 2959
288 Ga0495580_0227088 3300046472 Bacteria 1282
289 Ga0495580_0456813 3300046472 Unclassified 857
290 Ga0495582_0013960 3300046473 Bacteria 4425
291 Ga0495605_0050723 3300046474 Bacteria 2023
292 Ga0495639_0008348 3300046475 Bacteria 4443
293 Ga0495639_0196265 3300046475 Bacteria 987
294 Ga0495664_0001317 3300046477 Bacteria 13039
295 Ga0495594_0061211 3300046499 Bacteria 2083
296 Ga0495618_0014636 3300046514 Bacteria 4782
297 Ga0495628_0010000 3300046516 Bacteria 8072
298 Ga0495628_0010149 3300046516 Bacteria 8009
299 Ga0495628_0013802 3300046516 Bacteria 6788
300 Ga0495630_0009181 3300046517 Bacteria 7111
301 Ga0495630_0012679 3300046517 Bacteria 6125
302 Ga0495666_0006889 3300046526 Bacteria 5708
303 Ga0495642_0007663 3300046528 Bacteria 4138
304 Ga0495652_0008345 3300046529 Bacteria 9460
305 Ga0495640_0006086 3300046533 Bacteria 9569
306 Ga0495586_0032028 3300046535 Bacteria 2818
307 Ga0495587_0061075 3300046536 Bacteria 2208
308 Ga0495587_0085778 3300046536 Bacteria 1823
309 Ga0495598_0041021 3300046537 Bacteria 1352
310 Ga0495621_0007474 3300046539 Bacteria 3238
311 Ga0495621_0033403 3300046539 Unclassified 1773
312 Ga0495645_0000523 3300046543 Bacteria 26523
313 Ga0495622_0044755 3300046557 Bacteria 2057
314 Ga0495633_0206218 3300046558 Bacteria 902
315 Ga0495667_0008613 3300046559 Bacteria 6923
316 Ga0495667_0029720 3300046559 Bacteria 3678
317 Ga0495656_0029880 3300046615 Bacteria 2198
318 Ga0495634_0002446 3300046642 Bacteria 15427
319 Ga0495635_0025209 3300046663 Bacteria 4142
320 Ga0495659_0100787 3300046664 Unclassified 1118
321 Ga0495657_0041474 3300046675 Bacteria 3149
322 Ga0495599_0001708 3300046678 Bacteria 12700
323 Ga0495599_0018838 3300046678 Bacteria 4302
324 Ga0495647_0000113 3300046681 Bacteria 20397
325 Ga0495647_0163591 3300046681 Unclassified 960
326 Ga0495658_0002474 3300046683 Bacteria 9302
327 Ga0495658_0005554 3300046683 Bacteria 6197
328 Ga0495658_0154157 3300046683 Unclassified 1413
329 Ga0495613_0006916 3300046689 Bacteria 8462
330 Ga0495624_0039078 3300046690 Bacteria 3044
331 Ga0495604_0003696 3300047317 Bacteria 12188
332 Ga0495604_0131500 3300047317 Bacteria 1798
333 Ga0495636_0061448 3300047318 Bacteria 1589
334 Ga0495674_0122556 3300047319 Bacteria 2195
335 Ga0495674_0263707 3300047319 Bacteria 1415
336 Ga0495680_0139297 3300047322 Bacteria 1776
337 Ga0495684_0005262 3300047471 Bacteria 10072
338 Ga0496106_0239397 3300048909 Unclassified 1450
339 Ga0496110_0102625 3300048913 Bacteria 2565
340 Ga0496111_0343537 3300048914 Unclassified 1105
341 Ga0496113_0132248 3300048916 Unclassified 1959
342 Ga0496113_0689497 3300048916 Unclassified 816
343 Ga0496114_0107660 3300048917 Unclassified 2386
344 Ga0501034_0077898 3300049571 Bacteria 3320
345 Ga0501036_0442976 3300049572 Unclassified 1082
346 Ga0501037_0152245 3300049573 Bacteria 1652
347 Ga0501039_0704398 3300049575 Unclassified 789
348 Ga0501040_0058690 3300049576 Bacteria 2643
349 Ga0501041_0021401 3300049577 Bacteria 3875
350 Ga0501042_0014715 3300049578 Bacteria 5342
351 Ga0501042_0102555 3300049578 Bacteria 2058
352 Ga0501043_0068715 3300049579 Bacteria 2782
353 Ga0501046_0291035 3300049580 Bacteria 1195
354 Ga0501046_0327696 3300049580 Bacteria 1115
355 Ga0501047_0098410 3300049581 Bacteria 2804
356 Ga0501073_0175082 3300049589 Bacteria 1485
357 Ga0501075_0010190 3300049591 Bacteria 6599
358 Ga0501076_0002204 3300049592 Bacteria 13350
359 Ga0501076_0101598 3300049592 Bacteria 2318
360 Ga0501077_0311530 3300049593 Bacteria 1003
361 Ga0501077_0328383 3300049593 Bacteria 975
362 Ga0501079_0002104 3300049741 Bacteria 14299
363 Ga0501080_0208591 3300049742 Bacteria 1791
364 Ga0501081_0000260 3300049743 Bacteria 27512
365 Ga0501081_0156921 3300049743 Unclassified 1637
366 Ga0501083_0083498 3300049744 Bacteria 2116
367 Ga0501035_0675274 3300049822 Unclassified 835
368 Ga0501044_0401411 3300049823 Bacteria 1283
369 Ga0501045_0039039 3300049824 Bacteria 3455
370 Ga0501045_0165604 3300049824 Bacteria 1646
371 nmdc:mga00v17_357545_c1 3300050491 Bacteria 949
372 nmdc:mga05p37_196994_c1 3300050507 Bacteria 2442
373 nmdc:mga05p37_881102_c1 3300050507 Unclassified 968
374 nmdc:mga09592_312376_c1 3300050508 Unclassified 1362
375 nmdc:mga09592_4925_c1 3300050508 Bacteria 10827
376 nmdc:mga0qj67_240594_c1 3300050509 Bacteria 1468
377 nmdc:mga0qj67_262786_c1 3300050509 Unclassified 1400
378 nmdc:mga06r32_311826_c1 3300050510 Unclassified 1559
379 nmdc:mga06r32_314368_c1 3300050510 Unclassified 1552
380 nmdc:mga08y16_132488_c1 3300050511 Bacteria 2591
381 nmdc:mga08y16_46541_c1 3300050511 Bacteria 4542
382 nmdc:mga0n895_16115_c1 3300050512 Bacteria 6849
383 nmdc:mga0n895_19_c1 3300050512 Bacteria 95133
384 nmdc:mga0n895_23644_c1 3300050512 Bacteria 5779
385 nmdc:mga0n895_357088_c1 3300050512 Bacteria 1480
386 nmdc:mga0n895_581382_c1 3300050512 Bacteria 1124
387 nmdc:mga0n895_62150_c1 3300050512 Bacteria 3690
388 nmdc:mga0n895_926611_c1 3300050512 Bacteria 855
389 nmdc:mga0rr50_109271_c1 3300050513 Unclassified 2186
390 nmdc:mga0rr50_10_c1 3300050513 Bacteria 218067
391 nmdc:mga0rr50_220693_c1 3300050513 Bacteria 1565
392 nmdc:mga0rr50_238620_c1 3300050513 Bacteria 1506
393 nmdc:mga0rr50_619353_c1 3300050513 Bacteria 923
394 nmdc:mga0rr50_91404_c1 3300050513 Bacteria 2370
395 nmdc:mga0rr50_9557_c1 3300050513 Bacteria 6104
396 nmdc:mga08x19_132440_c1 3300050514 Bacteria 1678
397 nmdc:mga08x19_137249_c1 3300050514 Bacteria 1650
398 nmdc:mga08x19_255068_c1 3300050514 Bacteria 1212
399 nmdc:mga0a205_30559_c1 3300050515 Bacteria 3418
400 Ga0495601_0002701 3300053077 Bacteria 10069
401 Ga0495612_0038078 3300053078 Bacteria 1954
402 Ga0495595_0008305 3300053084 Bacteria 4262
403 Ga0495619_0002898 3300053085 Bacteria 11141
404 Ga0500636_0107574 3300053177 Bacteria 1579
405 Ga0501082_0004635 3300060353 Bacteria 11998
406 Ga0530510_0174433 3300061734 Bacteria 1593
407 Ga0070677_10115614
408 Ga0065712_10035878
409 Ga0065712_10049532
410 Ga0065715_10039850
411 Ga0065715_10212886
412 Ga0065707_10005901
413 Ga0070658_10285791
414 Ga0070676_10082183
415 Ga0070676_10129982
416 Ga0070683_100200150
417 Ga0070690_100116254
418 Ga0070670_100050889
419 Ga0070670_100123685
420 Ga0070670_100275200
421 Ga0070670_100312720
422 Ga0070677_10250006
423 Ga0070666_10037728
424 Ga0070666_10165121
425 Ga0070680_100165010
426 Ga0070660_100017394
427 Ga0070660_100079189
428 Ga0070689_100355631
429 Ga0070689_100593944
430 Ga0070691_10109864
431 Ga0070687_100091891
432 Ga0070675_100060992
433 Ga0070675_100094445
434 Ga0070675_100827713
435 Ga0070671_100070261
436 Ga0070674_100030466
437 Ga0070674_100563067
438 Ga0070673_100009090
439 Ga0070673_100243274
440 Ga0070673_100522831
441 Ga0070688_100033161
442 Ga0070688_100197457
443 Ga0070667_100088275
444 Ga0070709_10215651
445 Ga0070713_100063655
446 Ga0070701_10111695
447 Ga0070705_100000232
448 Ga0070705_100087251
449 Ga0070705_100109282
450 Ga0070700_100039979
451 Ga0070694_100005469
452 Ga0070694_100138061
453 Ga0070708_100280646
454 Ga0070663_100111595
455 Ga0070678_100007570
456 Ga0070678_100255212
457 Ga0070662_100429634
458 Ga0070662_100619009
459 Ga0070681_10046960
460 Ga0070681_10066195
461 Ga0070681_10428831
462 Ga0068867_100025972
463 Ga0068867_100122634
464 Ga0070706_100156452
465 Ga0070706_100564859
466 Ga0070706_100804818
467 Ga0070707_100049272
468 Ga0070707_100203838
469 Ga0070707_100265050
470 Ga0070698_100209618
471 Ga0070698_100234444
472 Ga0070699_100158607
473 Ga0070699_100418703
474 Ga0070679_100307510
475 Ga0070684_100076166
476 Ga0070684_100229305
477 Ga0070672_100009287
478 Ga0070672_100065861
479 Ga0070672_100102217
480 Ga0070672_100165234
481 Ga0070672_100170978
482 Ga0070686_100198235
483 Ga0070695_100001588
484 Ga0070695_100305362
485 Ga0070696_100000411
486 Ga0070693_100004695
487 Ga0070665_100192913
488 Ga0070704_100023494
489 Ga0070704_100187189
490 Ga0070702_100002999
491 Ga0068852_100866732
492 Ga0068859_100302660
493 Ga0068864_100065256
494 Ga0068864_100104466
495 Ga0068864_100840110
496 Ga0068866_10041066
497 Ga0068870_10272651
498 Ga0068863_100110449
499 Ga0068863_100258147
500 Ga0068863_101409807
501 Ga0068858_100038585
502 Ga0081455_10243423
503 Ga0070717_10022080
504 Ga0070717_10260867
505 Ga0075364_10521132
506 Ga0097621_100729442
507 Ga0068871_100173129
508 Ga0075428_100000521
509 Ga0075428_100263084
510 Ga0075430_100034599
511 Ga0075430_100124805
512 Ga0075430_100261937
513 Ga0075431_100121142
514 Ga0075431_100203178
515 Ga0075433_10521076
516 Ga0075434_100000396
517 Ga0075434_100008950
518 Ga0075434_100076766
519 Ga0075434_100333459
520 Ga0075429_100163642
521 Ga0075429_100183648
522 Ga0068865_100147022
523 Ga0068865_100234410
524 Ga0075436_100019810
525 Ga0075436_100230265
526 Ga0075436_100477003
527 Ga0097620_100302648
528 Ga0097620_100320928
529 Ga0075435_100000044
530 Ga0075435_100004922
531 Ga0075435_100012008
532 Ga0075435_100180923
533 Ga0075435_100216658
534 Ga0099794_10072688
535 Ga0099795_10057458
536 Ga0105240_10049915
537 Ga0105240_10463008
538 Ga0111539_10066299
539 Ga0111539_10384198
540 Ga0105245_10055577
541 Ga0105245_10519872
542 Ga0105247_10013138
543 Ga0114129_10035405
544 Ga0114129_10043397
545 Ga0114129_10132294
546 Ga0114129_10178933
547 Ga0114129_10221964
548 Ga0105243_10118847
549 Ga0105241_10217746
550 Ga0105242_10440124
551 Ga0105242_10452282
552 Ga0105242_10591330
553 Ga0105248_10118688
554 Ga0105248_10138233
555 Ga0105248_10239254
556 Ga0105239_10187254
557 Ga0105246_10932238
558 Ga0157374_10146513
559 Ga0163162_10390036
560 Ga0163162_10418003
561 Ga0157372_10339003
562 Ga0157375_10158657
563 Ga0157380_10697557
564 Ga0157376_10245907
565 Ga0157376_10333996
566 Ga0157376_10802910
567 Ga0163161_10224686
568 Ga0207697_10072979
569 Ga0207656_10110010
570 Ga0207682_10001305
571 Ga0207682_10212171
572 Ga0207642_10089512
573 Ga0207710_10013088
574 Ga0207688_10046936
575 Ga0207647_10065858
576 Ga0207645_10012564
577 Ga0207645_10027461
578 Ga0207643_10188136
579 Ga0207705_10325567
580 Ga0207684_10038375
581 Ga0207684_10490478
582 Ga0207707_10087435
583 Ga0207695_10115337
584 Ga0207660_10143277
585 Ga0207662_10049979
586 Ga0207657_10048150
587 Ga0207649_10362851
588 Ga0207652_10184365
589 Ga0207646_10312767
590 Ga0207650_10071720
591 Ga0207650_10086519
592 Ga0207650_10180533
593 Ga0207659_10103917
594 Ga0207659_10750357
595 Ga0207700_10011466
596 Ga0207700_10802668
597 Ga0207644_10022998
598 Ga0207644_10210369
599 Ga0207690_10228049
600 Ga0207706_10060250
601 Ga0207706_10062449
602 Ga0207686_10264376
603 Ga0207686_10370300
604 Ga0207709_10106163
605 Ga0207670_10166082
606 Ga0207669_10151982
607 Ga0207669_10166160
608 Ga0207665_10003431
609 Ga0207691_10002232
610 Ga0207691_10036908
611 Ga0207691_10188194
612 Ga0207691_10286747
613 Ga0207711_10102655
614 Ga0207711_10552135
615 Ga0207689_10140621
616 Ga0207689_10431504
617 Ga0207661_10087405
618 Ga0207661_10566324
619 Ga0207679_10051593
620 Ga0207679_10271773
621 Ga0207679_10277722
622 Ga0207679_10938128
623 Ga0207667_10170916
624 Ga0207667_10766959
625 Ga0207651_10033017
626 Ga0207651_10175176
627 Ga0207651_10187149
628 Ga0207712_10084219
629 Ga0207668_10679836
630 Ga0207668_10793634
631 Ga0207640_10017754
632 Ga0207677_10125572
633 Ga0207708_10003842
634 Ga0207708_10181855
635 Ga0207641_10980393
636 Ga0207648_10021088
637 Ga0207648_10054538
638 Ga0207648_10370761
639 Ga0207676_10094005
640 Ga0207676_10249487
641 Ga0207676_10409773
642 Ga0207675_100012373
643 Ga0207675_100020687
644 Ga0207683_10602337
645 Ga0207698_10499003
646 Ga0209588_1071670
647 Ga0207428_10346178
648 Ga0268266_10055033
649 Ga0268266_10205855
650 Ga0265327_10146807
651 Ga0307405_10039287
652 Ga0307412_10075927
653 Ga0307507_10023613
654 Ga0373926_0190935
655 Ga0373934_0001153
656 Ga0373934_0008204
657 Ga0373949_0012569
658 Ga0373923_0000056
659 Ga0373945_0064892
660 Ga0373953_0005940
661 Ga0373954_0021985
662 Ga0373956_0001058
663 Ga0373956_0040340
664 Ga0373943_0072394
665 Ga0373955_0005370
666 Ga0373955_0014567
667 Ga0373942_0001956
668 Ga0373924_0001051
669 Ga0373924_0029120
670 Ga0373935_0001625
671 Ga0373927_0210821
672 Ga0373933_0001112
673 Ga0373933_0015107
674 Ga0373937_0003821
675 Ga0373937_0008981
676 Ga0373937_0611390
677 Ga0373925_0727909
678 Ga0395901_0254485
679 Ga0395901_0579931
680 Ga0436360_0431417
681 Ga0451853_0312867
682 Ga0439441_007177
683 Ga0439464_0072351
684 Ga0451576_0222567
685 Ga0451576_0359216
686 Ga0495592_0000440
687 Ga0495592_0004872
688 Ga0495603_0086385
689 Ga0495629_0108984
690 Ga0495641_0008790
691 Ga0495641_0145508
692 Ga0495651_0011660
693 Ga0495651_0058431
694 Ga0495580_0227088
695 Ga0495580_0456813
696 Ga0495582_0013960
697 Ga0495605_0050723
698 Ga0495639_0008348
699 Ga0495639_0196265
700 Ga0495664_0001317
701 Ga0495594_0061211
702 Ga0495618_0014636
703 Ga0495628_0010000
704 Ga0495628_0010149
705 Ga0495628_0013802
706 Ga0495630_0009181
707 Ga0495630_0012679
708 Ga0495666_0006889
709 Ga0495642_0007663
710 Ga0495652_0008345
711 Ga0495640_0006086
712 Ga0495586_0032028
713 Ga0495587_0061075
714 Ga0495587_0085778
715 Ga0495598_0041021
716 Ga0495621_0007474
717 Ga0495621_0033403
718 Ga0495645_0000523
719 Ga0495622_0044755
720 Ga0495633_0206218
721 Ga0495667_0008613
722 Ga0495667_0029720
723 Ga0495656_0029880
724 Ga0495634_0002446
725 Ga0495635_0025209
726 Ga0495659_0100787
727 Ga0495657_0041474
728 Ga0495599_0001708
729 Ga0495599_0018838
730 Ga0495647_0000113
731 Ga0495647_0163591
732 Ga0495658_0002474
733 Ga0495658_0005554
734 Ga0495658_0154157
735 Ga0495613_0006916
736 Ga0495624_0039078
737 Ga0495604_0003696
738 Ga0495604_0131500
739 Ga0495636_0061448
740 Ga0495674_0122556
741 Ga0495674_0263707
742 Ga0495680_0139297
743 Ga0495684_0005262
744 Ga0496106_0239397
745 Ga0496110_0102625
746 Ga0496111_0343537
747 Ga0496113_0132248
748 Ga0496113_0689497
749 Ga0496114_0107660
750 Ga0501034_0077898
751 Ga0501036_0442976
752 Ga0501037_0152245
753 Ga0501039_0704398
754 Ga0501040_0058690
755 Ga0501041_0021401
756 Ga0501042_0014715
757 Ga0501042_0102555
758 Ga0501043_0068715
759 Ga0501046_0291035
760 Ga0501046_0327696
761 Ga0501047_0098410
762 Ga0501073_0175082
763 Ga0501075_0010190
764 Ga0501076_0002204
765 Ga0501076_0101598
766 Ga0501077_0311530
767 Ga0501077_0328383
768 Ga0501079_0002104
769 Ga0501080_0208591
770 Ga0501081_0000260
771 Ga0501081_0156921
772 Ga0501083_0083498
773 Ga0501035_0675274
774 Ga0501044_0401411
775 Ga0501045_0039039
776 Ga0501045_0165604
777 nmdc:mga00v17_357545_c1
778 nmdc:mga05p37_196994_c1
779 nmdc:mga05p37_881102_c1
780 nmdc:mga09592_312376_c1
781 nmdc:mga09592_4925_c1
782 nmdc:mga0qj67_240594_c1
783 nmdc:mga0qj67_262786_c1
784 nmdc:mga06r32_311826_c1
785 nmdc:mga06r32_314368_c1
786 nmdc:mga08y16_132488_c1
787 nmdc:mga08y16_46541_c1
788 nmdc:mga0n895_16115_c1
789 nmdc:mga0n895_19_c1
790 nmdc:mga0n895_23644_c1
791 nmdc:mga0n895_357088_c1
792 nmdc:mga0n895_581382_c1
793 nmdc:mga0n895_62150_c1
794 nmdc:mga0n895_926611_c1
795 nmdc:mga0rr50_109271_c1
796 nmdc:mga0rr50_10_c1
797 nmdc:mga0rr50_220693_c1
798 nmdc:mga0rr50_238620_c1
799 nmdc:mga0rr50_619353_c1
800 nmdc:mga0rr50_91404_c1
801 nmdc:mga0rr50_9557_c1
802 nmdc:mga08x19_132440_c1
803 nmdc:mga08x19_137249_c1
804 nmdc:mga08x19_255068_c1
805 nmdc:mga0a205_30559_c1
806 Ga0495601_0002701
807 Ga0495612_0038078
808 Ga0495595_0008305
809 Ga0495619_0002898
810 Ga0500636_0107574
811 Ga0501082_0004635
812 Ga0530510_0174433

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

36

209

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z7b-assembly1.cif.gz_A crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase 0.9279 4 222
6btg-assembly1.cif.gz_A crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis 0.9113 1 204
6voq-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae 0.9097 1 202
2z7b-assembly1.cif.gz_A crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase 0.9079 4 222
4c25-assembly1.cif.gz_A l-fuculose 1-phosphate aldolase 0.8984 1 207
ID Description Score Start End Superfamily
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9447 7 187 3.40.225.10
af_A0A1D8PNQ3_32_284_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9255 4 221 3.40.225.10
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9245 7 187 3.40.225.10
6btgA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9112 1 204 3.40.225.10
af_Q54T47_16_268_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.909 1 222 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A2V8JU93-F1-model_v4 Class II aldolase family protein 0.9994 1 223 GO:0005829
GO:0016832
GO:0019323
AF-A0A2V8BZR7-F1-model_v4 Class II aldolase family protein 0.9849 97 223 GO:0005829
GO:0016832
GO:0019323
AF-A0A317IDM3-F1-model_v4 Class II aldolase family protein 0.9843 4 221 GO:0005829
GO:0016832
GO:0019323
AF-A0A0B0ICL3-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.9843 1 223 GO:0005829
GO:0016832
GO:0019323
AF-A0A2V8HDA2-F1-model_v4 Class II aldolase family protein 0.983 6 170 GO:0005829
GO:0016832
GO:0019323

Map