F436121

General Info

Members Datasets Scaffolds Average Seq Length
406 217 812 99

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10039944|Ga0070658_100399443
Length 116
Sequence MCKTPSGRQREISMISNDRPSPYGHHHHNPRSFGQPPRPPVNEDTLKTDKVQIERKTFVFTLKENVRGRFLRITEDVGGRRDTIIIPAPGLEDFKKLLDEMVKVAAETPPPAEKPE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
153 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
154 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 4.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.01
Stem 0
Stem Tuber 0
Unclassified 52.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10039944 3300005327 Bacteria 3786
2 Ga0032354_1061917 3300003693 Bacteria 594
3 Ga0032354_1094639 3300003693 Unclassified 639
4 Ga0006780_1026905 3300003735 Unclassified 579
5 Ga0058863_11942255 3300004799 Unclassified 1043
6 Ga0058862_11480989 3300004803 Unclassified 603
7 Ga0058862_12231727 3300004803 Unclassified 605
8 Ga0065712_10522355 3300005290 Unclassified 635
9 Ga0070683_100172347 3300005329 Bacteria 2054
10 Ga0070689_100047064 3300005340 Bacteria 3325
11 Ga0070689_100252202 3300005340 Unclassified 1456
12 Ga0070692_10097907 3300005345 Unclassified 1604
13 Ga0070692_10561541 3300005345 Unclassified 749
14 Ga0070675_100387488 3300005354 Unclassified 1245
15 Ga0070671_101433249 3300005355 Unclassified 610
16 Ga0070674_101215773 3300005356 Unclassified 669
17 Ga0070688_100004790 3300005365 Bacteria 7074
18 Ga0070688_101472385 3300005365 Unclassified 553
19 Ga0070659_100732428 3300005366 Unclassified 857
20 Ga0070714_100002302 3300005435 Bacteria 14050
21 Ga0070714_100561669 3300005435 Bacteria 1093
22 Ga0070713_100503491 3300005436 Unclassified 1143
23 Ga0070713_100516719 3300005436 Unclassified 1128
24 Ga0070713_101005778 3300005436 Unclassified 804
25 Ga0070710_11471118 3300005437 Bacteria 511
26 Ga0070701_10008097 3300005438 Bacteria 4525
27 Ga0070701_11175235 3300005438 Unclassified 543
28 Ga0070711_100376885 3300005439 Bacteria 1146
29 Ga0070711_101012085 3300005439 Unclassified 713
30 Ga0070705_100132479 3300005440 Bacteria 1628
31 Ga0070705_100167763 3300005440 Unclassified 1474
32 Ga0070705_100363613 3300005440 Unclassified 1059
33 Ga0070700_100103093 3300005441 Unclassified 1883
34 Ga0070694_100004538 3300005444 Bacteria 8346
35 Ga0070708_100415269 3300005445 Bacteria 1269
36 Ga0070708_101745622 3300005445 Bacteria 578
37 Ga0070678_101838573 3300005456 Bacteria 571
38 Ga0070681_10046111 3300005458 Bacteria 4358
39 Ga0070681_10138615 3300005458 Unclassified 2362
40 Ga0068867_100592429 3300005459 Unclassified 966
41 Ga0070685_10686142 3300005466 Unclassified 745
42 Ga0070706_101829578 3300005467 Unclassified 552
43 Ga0070698_100492600 3300005471 Unclassified 1163
44 Ga0070698_101098800 3300005471 Unclassified 744
45 Ga0070679_100205761 3300005530 Unclassified 1933
46 Ga0070679_100318831 3300005530 Bacteria 1504
47 Ga0070679_101475570 3300005530 Unclassified 627
48 Ga0070684_100679234 3300005535 Unclassified 959
49 Ga0070686_100022577 3300005544 Bacteria 3749
50 Ga0070686_100120262 3300005544 Bacteria 1802
51 Ga0070686_100558858 3300005544 Unclassified 896
52 Ga0070695_100134877 3300005545 Bacteria 1705
53 Ga0070695_101640779 3300005545 Unclassified 537
54 Ga0070704_100032900 3300005549 Bacteria 3502
55 Ga0070704_101648377 3300005549 Bacteria 592
56 Ga0068855_100174867 3300005563 Unclassified 2430
57 Ga0068857_100785061 3300005577 Unclassified 909
58 Ga0068857_100854061 3300005577 Bacteria 871
59 Ga0068854_101156632 3300005578 Unclassified 692
60 Ga0068856_100345044 3300005614 Unclassified 1507
61 Ga0068856_100837820 3300005614 Bacteria 939
62 Ga0068856_101031540 3300005614 Unclassified 840
63 Ga0068856_101193125 3300005614 Unclassified 777
64 Ga0070702_100721920 3300005615 Unclassified 762
65 Ga0068852_100890574 3300005616 Unclassified 907
66 Ga0068859_100097832 3300005617 Bacteria 2988
67 Ga0068859_100124472 3300005617 Bacteria 2646
68 Ga0068859_100231202 3300005617 Bacteria 1937
69 Ga0068859_100392713 3300005617 Unclassified 1483
70 Ga0068859_100576376 3300005617 Unclassified 1219
71 Ga0068859_100997544 3300005617 Unclassified 920
72 Ga0068859_101968601 3300005617 Unclassified 645
73 Ga0068859_102369670 3300005617 Unclassified 585
74 Ga0068864_100593465 3300005618 Unclassified 1074
75 Ga0068864_101287924 3300005618 Unclassified 731
76 Ga0068864_101439683 3300005618 Unclassified 691
77 Ga0068866_11413525 3300005718 Unclassified 509
78 Ga0068861_101949494 3300005719 Unclassified 585
79 Ga0068851_10758306 3300005834 Unclassified 601
80 Ga0068863_100469837 3300005841 Bacteria 1236
81 Ga0068863_100980700 3300005841 Unclassified 847
82 Ga0068863_101274882 3300005841 Unclassified 741
83 Ga0068863_102391263 3300005841 Unclassified 538
84 Ga0068858_100140148 3300005842 Bacteria 2270
85 Ga0068858_100590195 3300005842 Bacteria 1077
86 Ga0068858_101929546 3300005842 Unclassified 584
87 Ga0081455_10111852 3300005937 Unclassified 2169
88 Ga0081455_10265700 3300005937 Unclassified 1247
89 Ga0097621_100199054 3300006237 Bacteria 1738
90 Ga0097621_100310445 3300006237 Bacteria 1395
91 Ga0068871_100021119 3300006358 Bacteria 4999
92 Ga0068871_100406394 3300006358 Bacteria 1213
93 Ga0068871_100575342 3300006358 Unclassified 1022
94 Ga0068871_100660124 3300006358 Unclassified 955
95 Ga0075431_100534808 3300006847 Unclassified 1160
96 Ga0075431_102031505 3300006847 Unclassified 530
97 Ga0075434_100471084 3300006871 Bacteria 1277
98 Ga0075429_100127651 3300006880 Bacteria 2224
99 Ga0068865_100171382 3300006881 Bacteria 1664
100 Ga0097620_100005808 3300006931 Bacteria 12532
101 Ga0097620_100097832 3300006931 Bacteria 2988
102 Ga0097620_100124468 3300006931 Bacteria 2646
103 Ga0097620_100231207 3300006931 Bacteria 1937
104 Ga0097620_100392716 3300006931 Unclassified 1483
105 Ga0097620_100576364 3300006931 Unclassified 1219
106 Ga0097620_100997582 3300006931 Unclassified 920
107 Ga0097620_101967655 3300006931 Unclassified 645
108 Ga0097620_102369298 3300006931 Unclassified 585
109 Ga0075435_101010816 3300007076 Unclassified 726
110 Ga0099795_10299141 3300007788 Unclassified 707
111 Ga0105240_10001327 3300009093 Bacteria 42631
112 Ga0105240_10060948 3300009093 Bacteria 4703
113 Ga0105240_10133026 3300009093 Bacteria 2981
114 Ga0105240_10161957 3300009093 Unclassified 2656
115 Ga0105240_11121157 3300009093 Unclassified 836
116 Ga0111539_10055887 3300009094 Unclassified 4693
117 Ga0111539_10411553 3300009094 Bacteria 1575
118 Ga0105245_10157181 3300009098 Bacteria 2154
119 Ga0105245_13016906 3300009098 Unclassified 522
120 Ga0105247_11824832 3300009101 Unclassified 507
121 Ga0114129_12301156 3300009147 Unclassified 647
122 Ga0114129_12594600 3300009147 Unclassified 605
123 Ga0105241_10290211 3300009174 Unclassified 1400
124 Ga0105241_11684408 3300009174 Unclassified 616
125 Ga0105242_10176595 3300009176 Unclassified 1881
126 Ga0105242_10824510 3300009176 Bacteria 920
127 Ga0105242_11698164 3300009176 Unclassified 667
128 Ga0105242_11938603 3300009176 Unclassified 630
129 Ga0105248_11570403 3300009177 Unclassified 745
130 Ga0105248_13356513 3300009177 Bacteria 509
131 Ga0105237_10254158 3300009545 Bacteria 1760
132 Ga0105237_10260255 3300009545 Eukaryota 1737
133 Ga0105238_10052545 3300009551 Bacteria 4096
134 Ga0105238_10055279 3300009551 Unclassified 3985
135 Ga0105238_10134931 3300009551 Bacteria 2446
136 Ga0105238_10363068 3300009551 Bacteria 1438
137 Ga0105238_11050131 3300009551 Unclassified 836
138 Ga0105249_11194418 3300009553 Unclassified 832
139 Ga0157373_10466306 3300013100 Unclassified 910
140 Ga0157373_10958698 3300013100 Unclassified 637
141 Ga0157371_11051755 3300013102 Unclassified 623
142 Ga0157370_10202425 3300013104 Bacteria 1841
143 Ga0157370_10290641 3300013104 Bacteria 1510
144 Ga0157374_10234139 3300013296 Unclassified 1805
145 Ga0157374_10614870 3300013296 Unclassified 1097
146 Ga0157374_11049131 3300013296 Unclassified 835
147 Ga0157374_11666367 3300013296 Unclassified 662
148 Ga0157378_10267725 3300013297 Bacteria 1642
149 Ga0157378_10840911 3300013297 Unclassified 946
150 Ga0157378_11998524 3300013297 Unclassified 630
151 Ga0157378_12561095 3300013297 Unclassified 562
152 Ga0157378_12830670 3300013297 Unclassified 538
153 Ga0157378_13163017 3300013297 Unclassified 511
154 Ga0163162_12259405 3300013306 Unclassified 625
155 Ga0157372_10193003 3300013307 Unclassified 2359
156 Ga0157372_10277002 3300013307 Bacteria 1950
157 Ga0157372_11893441 3300013307 Unclassified 686
158 Ga0157375_10000172 3300013308 Bacteria 60073
159 Ga0157375_10071464 3300013308 Bacteria 3484
160 Ga0163163_12312174 3300014325 Bacteria 596
161 Ga0157380_10852868 3300014326 Unclassified 933
162 Ga0157379_10729353 3300014968 Unclassified 932
163 Ga0157376_10822342 3300014969 Bacteria 943
164 Ga0157376_11152258 3300014969 Unclassified 802
165 Ga0182005_1184060 3300015265 Bacteria 621
166 Ga0163161_10286705 3300017792 Unclassified 1293
167 Ga0163161_11683832 3300017792 Unclassified 561
168 Ga0206356_10116051 3300020070 Bacteria 740
169 Ga0206356_10420439 3300020070 Bacteria 671
170 Ga0206352_11015012 3300020078 Bacteria 534
171 Ga0206350_10189556 3300020080 Unclassified 899
172 Ga0207656_10548136 3300025321 Unclassified 589
173 Ga0207680_10576145 3300025903 Bacteria 804
174 Ga0207705_10047623 3300025909 Unclassified 3083
175 Ga0207654_10323681 3300025911 Unclassified 1054
176 Ga0207707_10067979 3300025912 Bacteria 3104
177 Ga0207707_10384353 3300025912 Unclassified 1206
178 Ga0207707_10508430 3300025912 Bacteria 1027
179 Ga0207707_11373446 3300025912 Unclassified 565
180 Ga0207695_10009511 3300025913 Bacteria 12019
181 Ga0207695_10047344 3300025913 Bacteria 4552
182 Ga0207695_11327017 3300025913 Bacteria 600
183 Ga0207652_10231002 3300025921 Unclassified 1667
184 Ga0207652_10536034 3300025921 Bacteria 1053
185 Ga0207694_10040514 3300025924 Bacteria 3586
186 Ga0207687_11660152 3300025927 Unclassified 548
187 Ga0207687_11794985 3300025927 Unclassified 525
188 Ga0207700_10443685 3300025928 Unclassified 1143
189 Ga0207700_10534265 3300025928 Unclassified 1040
190 Ga0207700_11688490 3300025928 Unclassified 559
191 Ga0207700_11826295 3300025928 Unclassified 534
192 Ga0207664_10001832 3300025929 Bacteria 14022
193 Ga0207686_11162625 3300025934 Unclassified 631
194 Ga0207670_10104629 3300025936 Bacteria 2028
195 Ga0207670_10209622 3300025936 Unclassified 1485
196 Ga0207669_11048477 3300025937 Unclassified 687
197 Ga0207704_10234124 3300025938 Bacteria 1368
198 Ga0207691_10271371 3300025940 Bacteria 1461
199 Ga0207711_11306555 3300025941 Bacteria 667
200 Ga0207689_11560646 3300025942 Unclassified 550
201 Ga0207667_10191788 3300025949 Unclassified 2097
202 Ga0207667_10549079 3300025949 Bacteria 1169
203 Ga0207712_10178184 3300025961 Bacteria 1667
204 Ga0207640_11435485 3300025981 Unclassified 619
205 Ga0207703_10131593 3300026035 Bacteria 2161
206 Ga0207703_10471171 3300026035 Bacteria 1176
207 Ga0207703_11767993 3300026035 Unclassified 594
208 Ga0207702_10120241 3300026078 Bacteria 2350
209 Ga0207702_10159230 3300026078 Bacteria 2061
210 Ga0207702_10397783 3300026078 Bacteria 1328
211 Ga0207702_10717933 3300026078 Unclassified 985
212 Ga0207641_10248575 3300026088 Unclassified 1660
213 Ga0207641_10857127 3300026088 Unclassified 901
214 Ga0207641_11392066 3300026088 Unclassified 702
215 Ga0207641_11921785 3300026088 Unclassified 593
216 Ga0207648_10523519 3300026089 Bacteria 1087
217 Ga0207674_10603264 3300026116 Unclassified 1060
218 Ga0207698_10996382 3300026142 Unclassified 848
219 Ga0265337_1000017 3300028556 Bacteria 76887
220 Ga0265337_1015498 3300028556 Unclassified 2493
221 Ga0265319_1000003 3300028563 Bacteria 340561
222 Ga0265319_1024322 3300028563 Bacteria 2182
223 Ga0265334_10124826 3300028573 Unclassified 918
224 Ga0265334_10165577 3300028573 Unclassified 776
225 Ga0265318_10074779 3300028577 Bacteria 1254
226 Ga0265323_10000470 3300028653 Bacteria 22785
227 Ga0265323_10010610 3300028653 Bacteria 3731
228 Ga0265323_10041643 3300028653 Bacteria 1666
229 Ga0265323_10088659 3300028653 Bacteria 1037
230 Ga0265322_10020547 3300028654 Unclassified 1892
231 Ga0265336_10000543 3300028666 Bacteria 21601
232 Ga0265338_10000025 3300028800 Bacteria 296972
233 Ga0265338_10000395 3300028800 Bacteria 78200
234 Ga0265338_10006738 3300028800 Bacteria 14509
235 Ga0265338_10007701 3300028800 Bacteria 13260
236 Ga0265338_10010753 3300028800 Bacteria 10679
237 Ga0265338_10012058 3300028800 Bacteria 9885
238 Ga0265338_10013875 3300028800 Bacteria 9050
239 Ga0265338_10018185 3300028800 Bacteria 7534
240 Ga0265338_10089370 3300028800 Unclassified 2553
241 Ga0265338_10093519 3300028800 Unclassified 2477
242 Ga0265338_10095972 3300028800 Unclassified 2434
243 Ga0265338_10141401 3300028800 Bacteria 1884
244 Ga0265338_10317416 3300028800 Bacteria 1129
245 Ga0265338_10368269 3300028800 Unclassified 1029
246 Ga0265338_10542629 3300028800 Bacteria 815
247 Ga0265338_10770477 3300028800 Unclassified 661
248 Ga0265338_11224013 3300028800 Bacteria 503
249 Ga0265324_10019383 3300029957 Bacteria 2451
250 Ga0265324_10024297 3300029957 Bacteria 2152
251 Ga0265324_10253964 3300029957 Unclassified 597
252 Ga0265328_10123686 3300031239 Unclassified 966
253 Ga0265320_10006854 3300031240 Bacteria 7135
254 Ga0265320_10011494 3300031240 Bacteria 5205
255 Ga0265320_10023027 3300031240 Bacteria 3323
256 Ga0265320_10177036 3300031240 Bacteria 957
257 Ga0265325_10172512 3300031241 Bacteria 1011
258 Ga0265340_10047866 3300031247 Bacteria 2080
259 Ga0265339_10059434 3300031249 Bacteria 2061
260 Ga0265327_10057332 3300031251 Unclassified 2004
261 Ga0265327_10266115 3300031251 Bacteria 760
262 Ga0265316_10021112 3300031344 Bacteria 5525
263 Ga0265316_10042670 3300031344 Bacteria 3623
264 Ga0265316_10046746 3300031344 Bacteria 3427
265 Ga0265316_10175404 3300031344 Unclassified 1598
266 Ga0265316_10379285 3300031344 Unclassified 1020
267 Ga0265316_10656043 3300031344 Unclassified 742
268 Ga0265316_10781255 3300031344 Unclassified 670
269 Ga0265316_10871346 3300031344 Bacteria 630
270 Ga0265316_10871357 3300031344 Unclassified 630
271 Ga0307408_101032730 3300031548 Unclassified 759
272 Ga0265313_10002157 3300031595 Bacteria 17470
273 Ga0265314_10031192 3300031711 Bacteria 3938
274 Ga0265314_10562555 3300031711 Bacteria 592
275 Ga0265342_10068520 3300031712 Bacteria 2073
276 Ga0307413_10220263 3300031824 Bacteria 1386
277 Ga0307410_10261448 3300031852 Bacteria 1350
278 Ga0307406_10872287 3300031901 Unclassified 764
279 Ga0307412_10689612 3300031911 Bacteria 875
280 Ga0307409_100847292 3300031995 Bacteria 925
281 Ga0307416_101237779 3300032002 Unclassified 852
282 Ga0307411_10744261 3300032005 Unclassified 858
283 Ga0373934_0223830 3300035086 Unclassified 776
284 Ga0373944_0261751 3300035089 Unclassified 641
285 Ga0373954_0109473 3300035118 Bacteria 1336
286 Ga0373956_0121851 3300035119 Bacteria 1218
287 Ga0373955_0407115 3300035172 Bacteria 827
288 Ga0373927_0045739 3300035695 Bacteria 2831
289 Ga0373933_0459509 3300035724 Bacteria 833
290 Ga0373947_0066082 3300035725 Bacteria 2207
291 Ga0373937_0364658 3300036401 Unclassified 1369
292 Ga0373937_0632384 3300036401 Unclassified 1015
293 Ga0373937_1816316 3300036401 Unclassified 556
294 Ga0373925_0005171 3300037068 Bacteria 9775
295 Ga0373925_0110722 3300037068 Bacteria 2121
296 Ga0373925_0308114 3300037068 Bacteria 1280
297 Ga0373925_0730177 3300037068 Unclassified 816
298 Ga0373925_0967674 3300037068 Unclassified 701
299 Ga0395900_0088705 3300037418 Bacteria 3180
300 Ga0395905_0132111 3300037471 Bacteria 2348
301 Ga0395905_0193962 3300037471 Unclassified 1905
302 Ga0451800_1236623 3300041459 Unclassified 1099
303 Ga0451851_0330661 3300041507 Unclassified 722
304 Ga0439459_0130716 3300042438 Unclassified 641
305 Ga0451577_0367495 3300042876 Bacteria 1305
306 Ga0453683_0510812 3300044673 Unclassified 780
307 Ga0453684_0004245 3300044712 Bacteria 30647
308 Ga0453684_0090245 3300044712 Bacteria 3787
309 Ga0451576_0158393 3300045051 Bacteria 2362
310 Ga0451576_0188537 3300045051 Bacteria 2154
311 Ga0451576_0463187 3300045051 Bacteria 1331
312 Ga0451576_0502462 3300045051 Unclassified 1274
313 Ga0451576_0978722 3300045051 Bacteria 887
314 Ga0451576_1508510 3300045051 Unclassified 698
315 Ga0451576_2219296 3300045051 Bacteria 563
316 Ga0451576_2424379 3300045051 Unclassified 537
317 Ga0495592_0000437 3300046454 Bacteria 31326
318 Ga0495592_0053354 3300046454 Bacteria 2999
319 Ga0495629_0112157 3300046459 Bacteria 1901
320 Ga0495653_0925583 3300046463 Bacteria 518
321 Ga0495582_0517316 3300046473 Unclassified 690
322 Ga0495639_0101800 3300046475 Bacteria 1357
323 Ga0495639_0140964 3300046475 Unclassified 1159
324 Ga0495639_0446035 3300046475 Unclassified 657
325 Ga0495662_0008950 3300046476 Bacteria 4917
326 Ga0495664_0058928 3300046477 Unclassified 2285
327 Ga0495664_0116737 3300046477 Unclassified 1613
328 Ga0495594_0193826 3300046499 Bacteria 1158
329 Ga0495608_0737881 3300046511 Unclassified 584
330 Ga0495618_0017768 3300046514 Unclassified 4365
331 Ga0495618_0511822 3300046514 Bacteria 723
332 Ga0495628_0000054 3300046516 Bacteria 90760
333 Ga0495628_0049078 3300046516 Bacteria 3343
334 Ga0495628_0188322 3300046516 Unclassified 1559
335 Ga0495630_0000198 3300046517 Bacteria 47012
336 Ga0495630_0010251 3300046517 Bacteria 6761
337 Ga0495630_0136443 3300046517 Unclassified 1864
338 Ga0495630_0321051 3300046517 Bacteria 1184
339 Ga0495630_0381837 3300046517 Bacteria 1079
340 Ga0495666_0002822 3300046526 Bacteria 8701
341 Ga0495666_0231551 3300046526 Bacteria 844
342 Ga0495652_0054501 3300046529 Unclassified 3405
343 Ga0495640_0015082 3300046533 Bacteria 5821
344 Ga0495640_0236241 3300046533 Unclassified 1148
345 Ga0495640_0322773 3300046533 Bacteria 956
346 Ga0495640_0390427 3300046533 Unclassified 855
347 Ga0495586_0000106 3300046535 Bacteria 49541
348 Ga0495586_0009227 3300046535 Bacteria 5246
349 Ga0495587_0245056 3300046536 Bacteria 1008
350 Ga0495645_0081947 3300046543 Bacteria 2314
351 Ga0495645_0161018 3300046543 Unclassified 1551
352 Ga0495645_0745615 3300046543 Unclassified 591
353 Ga0495667_0188630 3300046559 Unclassified 1322
354 Ga0495667_0703777 3300046559 Unclassified 626
355 Ga0495668_0633445 3300046616 Unclassified 591
356 Ga0495634_0054990 3300046642 Unclassified 2663
357 Ga0495634_0181075 3300046642 Bacteria 1319
358 Ga0495634_0559319 3300046642 Bacteria 666
359 Ga0495635_0224223 3300046663 Bacteria 1271
360 Ga0495599_0015422 3300046678 Unclassified 4741
361 Ga0495599_0028244 3300046678 Bacteria 3516
362 Ga0495646_0306845 3300046680 Bacteria 838
363 Ga0495646_0474909 3300046680 Unclassified 644
364 Ga0495647_0053254 3300046681 Bacteria 1578
365 Ga0495581_0132883 3300047315 Bacteria 1450
366 Ga0495581_0604821 3300047315 Unclassified 635
367 Ga0495581_0801288 3300047315 Bacteria 540
368 Ga0495674_0186995 3300047319 Bacteria 1723
369 Ga0495674_1095070 3300047319 Bacteria 607
370 Ga0495676_0023543 3300047321 Bacteria 5344
371 Ga0495683_0433384 3300047323 Unclassified 542
372 Ga0495675_0211481 3300047444 Bacteria 1177
373 Ga0495684_0213847 3300047471 Bacteria 1416
374 Ga0495684_0769852 3300047471 Unclassified 632
375 Ga0495602_0709267 3300048088 Unclassified 682
376 Ga0496115_0399179 3300048918 Unclassified 1116
377 Ga0495682_0102026 3300049460 Bacteria 1029
378 Ga0501033_0006418 3300049570 Bacteria 9209
379 Ga0501034_0196500 3300049571 Bacteria 1977
380 Ga0501037_0361944 3300049573 Bacteria 999
381 Ga0501037_1000251 3300049573 Unclassified 545
382 Ga0501043_0119197 3300049579 Unclassified 2070
383 Ga0501047_1012214 3300049581 Unclassified 644
384 Ga0501083_0167189 3300049744 Bacteria 1438
385 Ga0501035_0009225 3300049822 Bacteria 9174
386 Ga0501044_0068754 3300049823 Unclassified 3607
387 nmdc:mga05p37_1740710_c1 3300050507 Unclassified 605
388 nmdc:mga09592_1291122_c1 3300050508 Unclassified 600
389 nmdc:mga06r32_1171838_c1 3300050510 Bacteria 715
390 nmdc:mga06r32_1835304_c1 3300050510 Unclassified 541
391 nmdc:mga08y16_1127710_c1 3300050511 Unclassified 758
392 nmdc:mga0n895_247742_c1 3300050512 Bacteria 1808
393 nmdc:mga0rr50_1202691_c1 3300050513 Unclassified 644
394 nmdc:mga0rr50_1667963_c1 3300050513 Unclassified 537
395 nmdc:mga08x19_1348106_c1 3300050514 Unclassified 505
396 Ga0495601_0458805 3300053077 Bacteria 824
397 Ga0495601_0630929 3300053077 Bacteria 686
398 Ga0500595_202889 3300053119 Unclassified 547
399 Ga0587082_075106 3300059504 Unclassified 694
400 Ga0587098_046973 3300059604 Unclassified 645
401 Ga0587106_057180 3300059605 Unclassified 707
402 Ga0587131_025361 3300059609 Unclassified 509
403 Ga0587128_058417 3300059630 Bacteria 722
404 Ga0587067_080089 3300059640 Unclassified 722
405 Ga0587114_050840 3300059655 Unclassified 701
406 Ga0587071_071026 3300060344 Unclassified 758
407 Ga0070658_10039944
408 Ga0032354_1061917
409 Ga0032354_1094639
410 Ga0006780_1026905
411 Ga0058863_11942255
412 Ga0058862_11480989
413 Ga0058862_12231727
414 Ga0065712_10522355
415 Ga0070683_100172347
416 Ga0070689_100047064
417 Ga0070689_100252202
418 Ga0070692_10097907
419 Ga0070692_10561541
420 Ga0070675_100387488
421 Ga0070671_101433249
422 Ga0070674_101215773
423 Ga0070688_100004790
424 Ga0070688_101472385
425 Ga0070659_100732428
426 Ga0070714_100002302
427 Ga0070714_100561669
428 Ga0070713_100503491
429 Ga0070713_100516719
430 Ga0070713_101005778
431 Ga0070710_11471118
432 Ga0070701_10008097
433 Ga0070701_11175235
434 Ga0070711_100376885
435 Ga0070711_101012085
436 Ga0070705_100132479
437 Ga0070705_100167763
438 Ga0070705_100363613
439 Ga0070700_100103093
440 Ga0070694_100004538
441 Ga0070708_100415269
442 Ga0070708_101745622
443 Ga0070678_101838573
444 Ga0070681_10046111
445 Ga0070681_10138615
446 Ga0068867_100592429
447 Ga0070685_10686142
448 Ga0070706_101829578
449 Ga0070698_100492600
450 Ga0070698_101098800
451 Ga0070679_100205761
452 Ga0070679_100318831
453 Ga0070679_101475570
454 Ga0070684_100679234
455 Ga0070686_100022577
456 Ga0070686_100120262
457 Ga0070686_100558858
458 Ga0070695_100134877
459 Ga0070695_101640779
460 Ga0070704_100032900
461 Ga0070704_101648377
462 Ga0068855_100174867
463 Ga0068857_100785061
464 Ga0068857_100854061
465 Ga0068854_101156632
466 Ga0068856_100345044
467 Ga0068856_100837820
468 Ga0068856_101031540
469 Ga0068856_101193125
470 Ga0070702_100721920
471 Ga0068852_100890574
472 Ga0068859_100097832
473 Ga0068859_100124472
474 Ga0068859_100231202
475 Ga0068859_100392713
476 Ga0068859_100576376
477 Ga0068859_100997544
478 Ga0068859_101968601
479 Ga0068859_102369670
480 Ga0068864_100593465
481 Ga0068864_101287924
482 Ga0068864_101439683
483 Ga0068866_11413525
484 Ga0068861_101949494
485 Ga0068851_10758306
486 Ga0068863_100469837
487 Ga0068863_100980700
488 Ga0068863_101274882
489 Ga0068863_102391263
490 Ga0068858_100140148
491 Ga0068858_100590195
492 Ga0068858_101929546
493 Ga0081455_10111852
494 Ga0081455_10265700
495 Ga0097621_100199054
496 Ga0097621_100310445
497 Ga0068871_100021119
498 Ga0068871_100406394
499 Ga0068871_100575342
500 Ga0068871_100660124
501 Ga0075431_100534808
502 Ga0075431_102031505
503 Ga0075434_100471084
504 Ga0075429_100127651
505 Ga0068865_100171382
506 Ga0097620_100005808
507 Ga0097620_100097832
508 Ga0097620_100124468
509 Ga0097620_100231207
510 Ga0097620_100392716
511 Ga0097620_100576364
512 Ga0097620_100997582
513 Ga0097620_101967655
514 Ga0097620_102369298
515 Ga0075435_101010816
516 Ga0099795_10299141
517 Ga0105240_10001327
518 Ga0105240_10060948
519 Ga0105240_10133026
520 Ga0105240_10161957
521 Ga0105240_11121157
522 Ga0111539_10055887
523 Ga0111539_10411553
524 Ga0105245_10157181
525 Ga0105245_13016906
526 Ga0105247_11824832
527 Ga0114129_12301156
528 Ga0114129_12594600
529 Ga0105241_10290211
530 Ga0105241_11684408
531 Ga0105242_10176595
532 Ga0105242_10824510
533 Ga0105242_11698164
534 Ga0105242_11938603
535 Ga0105248_11570403
536 Ga0105248_13356513
537 Ga0105237_10254158
538 Ga0105237_10260255
539 Ga0105238_10052545
540 Ga0105238_10055279
541 Ga0105238_10134931
542 Ga0105238_10363068
543 Ga0105238_11050131
544 Ga0105249_11194418
545 Ga0157373_10466306
546 Ga0157373_10958698
547 Ga0157371_11051755
548 Ga0157370_10202425
549 Ga0157370_10290641
550 Ga0157374_10234139
551 Ga0157374_10614870
552 Ga0157374_11049131
553 Ga0157374_11666367
554 Ga0157378_10267725
555 Ga0157378_10840911
556 Ga0157378_11998524
557 Ga0157378_12561095
558 Ga0157378_12830670
559 Ga0157378_13163017
560 Ga0163162_12259405
561 Ga0157372_10193003
562 Ga0157372_10277002
563 Ga0157372_11893441
564 Ga0157375_10000172
565 Ga0157375_10071464
566 Ga0163163_12312174
567 Ga0157380_10852868
568 Ga0157379_10729353
569 Ga0157376_10822342
570 Ga0157376_11152258
571 Ga0182005_1184060
572 Ga0163161_10286705
573 Ga0163161_11683832
574 Ga0206356_10116051
575 Ga0206356_10420439
576 Ga0206352_11015012
577 Ga0206350_10189556
578 Ga0207656_10548136
579 Ga0207680_10576145
580 Ga0207705_10047623
581 Ga0207654_10323681
582 Ga0207707_10067979
583 Ga0207707_10384353
584 Ga0207707_10508430
585 Ga0207707_11373446
586 Ga0207695_10009511
587 Ga0207695_10047344
588 Ga0207695_11327017
589 Ga0207652_10231002
590 Ga0207652_10536034
591 Ga0207694_10040514
592 Ga0207687_11660152
593 Ga0207687_11794985
594 Ga0207700_10443685
595 Ga0207700_10534265
596 Ga0207700_11688490
597 Ga0207700_11826295
598 Ga0207664_10001832
599 Ga0207686_11162625
600 Ga0207670_10104629
601 Ga0207670_10209622
602 Ga0207669_11048477
603 Ga0207704_10234124
604 Ga0207691_10271371
605 Ga0207711_11306555
606 Ga0207689_11560646
607 Ga0207667_10191788
608 Ga0207667_10549079
609 Ga0207712_10178184
610 Ga0207640_11435485
611 Ga0207703_10131593
612 Ga0207703_10471171
613 Ga0207703_11767993
614 Ga0207702_10120241
615 Ga0207702_10159230
616 Ga0207702_10397783
617 Ga0207702_10717933
618 Ga0207641_10248575
619 Ga0207641_10857127
620 Ga0207641_11392066
621 Ga0207641_11921785
622 Ga0207648_10523519
623 Ga0207674_10603264
624 Ga0207698_10996382
625 Ga0265337_1000017
626 Ga0265337_1015498
627 Ga0265319_1000003
628 Ga0265319_1024322
629 Ga0265334_10124826
630 Ga0265334_10165577
631 Ga0265318_10074779
632 Ga0265323_10000470
633 Ga0265323_10010610
634 Ga0265323_10041643
635 Ga0265323_10088659
636 Ga0265322_10020547
637 Ga0265336_10000543
638 Ga0265338_10000025
639 Ga0265338_10000395
640 Ga0265338_10006738
641 Ga0265338_10007701
642 Ga0265338_10010753
643 Ga0265338_10012058
644 Ga0265338_10013875
645 Ga0265338_10018185
646 Ga0265338_10089370
647 Ga0265338_10093519
648 Ga0265338_10095972
649 Ga0265338_10141401
650 Ga0265338_10317416
651 Ga0265338_10368269
652 Ga0265338_10542629
653 Ga0265338_10770477
654 Ga0265338_11224013
655 Ga0265324_10019383
656 Ga0265324_10024297
657 Ga0265324_10253964
658 Ga0265328_10123686
659 Ga0265320_10006854
660 Ga0265320_10011494
661 Ga0265320_10023027
662 Ga0265320_10177036
663 Ga0265325_10172512
664 Ga0265340_10047866
665 Ga0265339_10059434
666 Ga0265327_10057332
667 Ga0265327_10266115
668 Ga0265316_10021112
669 Ga0265316_10042670
670 Ga0265316_10046746
671 Ga0265316_10175404
672 Ga0265316_10379285
673 Ga0265316_10656043
674 Ga0265316_10781255
675 Ga0265316_10871346
676 Ga0265316_10871357
677 Ga0307408_101032730
678 Ga0265313_10002157
679 Ga0265314_10031192
680 Ga0265314_10562555
681 Ga0265342_10068520
682 Ga0307413_10220263
683 Ga0307410_10261448
684 Ga0307406_10872287
685 Ga0307412_10689612
686 Ga0307409_100847292
687 Ga0307416_101237779
688 Ga0307411_10744261
689 Ga0373934_0223830
690 Ga0373944_0261751
691 Ga0373954_0109473
692 Ga0373956_0121851
693 Ga0373955_0407115
694 Ga0373927_0045739
695 Ga0373933_0459509
696 Ga0373947_0066082
697 Ga0373937_0364658
698 Ga0373937_0632384
699 Ga0373937_1816316
700 Ga0373925_0005171
701 Ga0373925_0110722
702 Ga0373925_0308114
703 Ga0373925_0730177
704 Ga0373925_0967674
705 Ga0395900_0088705
706 Ga0395905_0132111
707 Ga0395905_0193962
708 Ga0451800_1236623
709 Ga0451851_0330661
710 Ga0439459_0130716
711 Ga0451577_0367495
712 Ga0453683_0510812
713 Ga0453684_0004245
714 Ga0453684_0090245
715 Ga0451576_0158393
716 Ga0451576_0188537
717 Ga0451576_0463187
718 Ga0451576_0502462
719 Ga0451576_0978722
720 Ga0451576_1508510
721 Ga0451576_2219296
722 Ga0451576_2424379
723 Ga0495592_0000437
724 Ga0495592_0053354
725 Ga0495629_0112157
726 Ga0495653_0925583
727 Ga0495582_0517316
728 Ga0495639_0101800
729 Ga0495639_0140964
730 Ga0495639_0446035
731 Ga0495662_0008950
732 Ga0495664_0058928
733 Ga0495664_0116737
734 Ga0495594_0193826
735 Ga0495608_0737881
736 Ga0495618_0017768
737 Ga0495618_0511822
738 Ga0495628_0000054
739 Ga0495628_0049078
740 Ga0495628_0188322
741 Ga0495630_0000198
742 Ga0495630_0010251
743 Ga0495630_0136443
744 Ga0495630_0321051
745 Ga0495630_0381837
746 Ga0495666_0002822
747 Ga0495666_0231551
748 Ga0495652_0054501
749 Ga0495640_0015082
750 Ga0495640_0236241
751 Ga0495640_0322773
752 Ga0495640_0390427
753 Ga0495586_0000106
754 Ga0495586_0009227
755 Ga0495587_0245056
756 Ga0495645_0081947
757 Ga0495645_0161018
758 Ga0495645_0745615
759 Ga0495667_0188630
760 Ga0495667_0703777
761 Ga0495668_0633445
762 Ga0495634_0054990
763 Ga0495634_0181075
764 Ga0495634_0559319
765 Ga0495635_0224223
766 Ga0495599_0015422
767 Ga0495599_0028244
768 Ga0495646_0306845
769 Ga0495646_0474909
770 Ga0495647_0053254
771 Ga0495581_0132883
772 Ga0495581_0604821
773 Ga0495581_0801288
774 Ga0495674_0186995
775 Ga0495674_1095070
776 Ga0495676_0023543
777 Ga0495683_0433384
778 Ga0495675_0211481
779 Ga0495684_0213847
780 Ga0495684_0769852
781 Ga0495602_0709267
782 Ga0496115_0399179
783 Ga0495682_0102026
784 Ga0501033_0006418
785 Ga0501034_0196500
786 Ga0501037_0361944
787 Ga0501037_1000251
788 Ga0501043_0119197
789 Ga0501047_1012214
790 Ga0501083_0167189
791 Ga0501035_0009225
792 Ga0501044_0068754
793 nmdc:mga05p37_1740710_c1
794 nmdc:mga09592_1291122_c1
795 nmdc:mga06r32_1171838_c1
796 nmdc:mga06r32_1835304_c1
797 nmdc:mga08y16_1127710_c1
798 nmdc:mga0n895_247742_c1
799 nmdc:mga0rr50_1202691_c1
800 nmdc:mga0rr50_1667963_c1
801 nmdc:mga08x19_1348106_c1
802 Ga0495601_0458805
803 Ga0495601_0630929
804 Ga0500595_202889
805 Ga0587082_075106
806 Ga0587098_046973
807 Ga0587106_057180
808 Ga0587131_025361
809 Ga0587128_058417
810 Ga0587067_080089
811 Ga0587114_050840
812 Ga0587071_071026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04845

PurA

PurA ssDNA and RNA-binding protein

11

115

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fgo-assembly2.cif.gz_C crystal structure of d. melanogaster pur-alpha repeat iii. 0.9145 31 89
5fgo-assembly2.cif.gz_C crystal structure of d. melanogaster pur-alpha repeat iii. 0.8734 31 89
6cib-assembly2.cif.gz_B the structure of ycao from methanopyrus kandleri bound with amppcp and mg2+ 0.8319 29 62
6cib-assembly5.cif.gz_E the structure of ycao from methanopyrus kandleri bound with amppcp and mg2+ 0.825 29 62
6ci7-assembly4.cif.gz_D the structure of ycao from methanopyrus kandleri bound with amppcp and mg2+ 0.821 29 62
ID Description Score Start End Superfamily
af_A0A0P0V197_32_95_3.10.450.700 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9542 27 87 3.10.450.700
af_A0A0P0V197_32_95_3.10.450.700 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8978 27 87 3.10.450.700
af_A0A0R4I9N0_29_184_3.30.2450.30 Alpha Beta;2-Layer Sandwich;Secreted effector protein pipB2 fold; 0.8796 27 97 3.30.2450.30
af_Q9NEW7_1_162_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8677 29 70 2.130.10.10
af_Q94230_157_226_3.10.450.700 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8597 28 91 3.10.450.700
ID Description Score Start End GO Terms
AF-A0A2E6SA92-F1-model_v4 RNA-binding protein 0.9956 26 89 GO:0000977
GO:0000981
GO:0032422
AF-A0A1Z8ZWP7-F1-model_v4 RNA-binding protein 0.9923 26 91 GO:0000977
GO:0032422
AF-A0A2A2QXH6-F1-model_v4 DNA-binding protein 0.9921 26 89 GO:0000977
GO:0000981
GO:0032422
AF-A0A836WLP7-F1-model_v4 DNA-binding protein 0.9897 23 89 GO:0000977
GO:0000981
GO:0032422
AF-A0A838Q8H8-F1-model_v4 DNA-binding protein 0.9827 26 70 GO:0000977
GO:0032422

Map