F436115

General Info

Members Datasets Scaffolds Average Seq Length
406 213 812 342

Family's Representative Sequence

Representative Sequence 3300003693|Ga0032354_1008369|Ga0032354_10083692
Length 353
Sequence MKAARLHAYHEALKVDEVDEPKITGPLDVIVKIGAAGLCRTDLHIQEGQWAEKSEVKLPYTPGHENAGWIHEIGAGVTNVEVGDTVIVHPFITCGLCRACRLGDDMXCENGSFPGINRDGGFAEYLLTSARSVVKLDPSLQPAEIAALADAGLTAIHAVKKAIPVLGAGTKCVVIGSGGLGHIGIQCLKAYTPTEIIVVDPNEKALELARELGADHTVKVEGASHIQEVQELTDGKGAQAIIDFVGEKGAVEDGVAMIEDGGFYYVIGYGQNIDIPTIDVISREISFIGNLVGTYVDLQDLMTLTAQGKVTLHTSTYPLDAINDAMADLDNGRLQGRGILVPEGVREGTAAAA

Samples

Sample ID Description Type Environment
1 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
213 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 1.48
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 12.81
Rhizosphere 76.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0032354_1008369 3300003693 Bacteria 1541
2 JGI25406J46586_10002628 3300003203 Bacteria 8472
3 JGI25407J50210_10000189 3300003373 Bacteria 10259
4 Ga0058862_10016299 3300004803 Bacteria 1276
5 Ga0070676_10047853 3300005328 Bacteria 2499
6 Ga0070683_100015706 3300005329 Bacteria 6655
7 Ga0070683_100220639 3300005329 Bacteria 1802
8 Ga0068869_100079514 3300005334 Bacteria 2443
9 Ga0070682_100046099 3300005337 Bacteria 2704
10 Ga0068868_100011631 3300005338 Bacteria 6410
11 Ga0068868_100099931 3300005338 Bacteria 2347
12 Ga0068868_100147012 3300005338 Bacteria 1939
13 Ga0070691_10007640 3300005341 Bacteria 4955
14 Ga0070668_100050143 3300005347 Bacteria 3213
15 Ga0070675_100121135 3300005354 Bacteria 2223
16 Ga0070659_100333225 3300005366 Bacteria 1270
17 Ga0070709_10116961 3300005434 Bacteria 1801
18 Ga0070714_100022015 3300005435 Bacteria 5222
19 Ga0070714_100151534 3300005435 Bacteria 2090
20 Ga0070713_100110088 3300005436 Bacteria 2400
21 Ga0070713_100421360 3300005436 Bacteria 1250
22 Ga0070710_10053146 3300005437 Bacteria 2281
23 Ga0070700_100002502 3300005441 Bacteria 9361
24 Ga0070700_100146585 3300005441 Bacteria 1609
25 Ga0070694_100002651 3300005444 Bacteria 10586
26 Ga0070708_100013642 3300005445 Bacteria 6661
27 Ga0070708_100063113 3300005445 Bacteria 3315
28 Ga0070708_100081876 3300005445 Bacteria 2923
29 Ga0070663_100027264 3300005455 Bacteria 3878
30 Ga0070663_100195202 3300005455 Bacteria 1577
31 Ga0070678_100100278 3300005456 Bacteria 2243
32 Ga0070662_100392846 3300005457 Bacteria 1143
33 Ga0068867_100088946 3300005459 Bacteria 2341
34 Ga0070685_10037826 3300005466 Bacteria 2734
35 Ga0070685_10144851 3300005466 Bacteria 1500
36 Ga0070707_100011289 3300005468 Bacteria 8329
37 Ga0070707_100026437 3300005468 Bacteria 5510
38 Ga0070707_100329004 3300005468 Bacteria 1485
39 Ga0070698_100007139 3300005471 Bacteria 12098
40 Ga0070698_100015750 3300005471 Bacteria 7987
41 Ga0070698_100137122 3300005471 Bacteria 2400
42 Ga0070699_100002078 3300005518 Bacteria 18130
43 Ga0070699_100034446 3300005518 Bacteria 4376
44 Ga0070684_100086583 3300005535 Bacteria 2780
45 Ga0070684_100197499 3300005535 Bacteria 1832
46 Ga0070684_100225664 3300005535 Bacteria 1710
47 Ga0070697_100002941 3300005536 Bacteria 13112
48 Ga0070697_100012809 3300005536 Bacteria 6569
49 Ga0070672_100229673 3300005543 Bacteria 1559
50 Ga0070695_100007030 3300005545 Bacteria 6668
51 Ga0070665_100232948 3300005548 Bacteria 1842
52 Ga0070704_100001620 3300005549 Bacteria 12194
53 Ga0070704_100022120 3300005549 Bacteria 4133
54 Ga0068855_100200442 3300005563 Bacteria 2247
55 Ga0070664_100175138 3300005564 Bacteria 1904
56 Ga0068854_100195042 3300005578 Bacteria 1589
57 Ga0068856_100021253 3300005614 Bacteria 6305
58 Ga0070702_100005968 3300005615 Bacteria 5729
59 Ga0070702_100031117 3300005615 Bacteria 2917
60 Ga0070702_100074498 3300005615 Bacteria 2014
61 Ga0068859_100029823 3300005617 Bacteria 5472
62 Ga0068859_100638802 3300005617 Bacteria 1157
63 Ga0068864_100186493 3300005618 Bacteria 1899
64 Ga0068866_10078696 3300005718 Bacteria 1765
65 Ga0068861_100030406 3300005719 Bacteria 3957
66 Ga0068858_100047141 3300005842 Bacteria 3996
67 Ga0068860_100301186 3300005843 Bacteria 1570
68 Ga0068862_100154641 3300005844 Bacteria 2043
69 Ga0081455_10009962 3300005937 Bacteria 9716
70 Ga0081455_10019262 3300005937 Bacteria 6462
71 Ga0081455_10055636 3300005937 Bacteria 3365
72 Ga0081455_10076890 3300005937 Bacteria 2748
73 Ga0081455_10181329 3300005937 Bacteria 1594
74 Ga0081538_10000272 3300005981 Bacteria 59231
75 Ga0081538_10000664 3300005981 Bacteria 37865
76 Ga0081538_10001970 3300005981 Bacteria 20534
77 Ga0081538_10008845 3300005981 Bacteria 8475
78 Ga0081538_10009398 3300005981 Bacteria 8169
79 Ga0081538_10015363 3300005981 Bacteria 5932
80 Ga0081538_10020594 3300005981 Bacteria 4846
81 Ga0081538_10035674 3300005981 Bacteria 3262
82 Ga0081538_10044551 3300005981 Bacteria 2765
83 Ga0081538_10053524 3300005981 Bacteria 2398
84 Ga0081540_1000550 3300005983 Bacteria 36321
85 Ga0081540_1045706 3300005983 Bacteria 2220
86 Ga0081540_1046376 3300005983 Bacteria 2195
87 Ga0081539_10001376 3300005985 Bacteria 42070
88 Ga0081539_10016800 3300005985 Bacteria 5194
89 Ga0081539_10059407 3300005985 Bacteria 2105
90 Ga0070717_10001734 3300006028 Bacteria 15205
91 Ga0070717_10032699 3300006028 Bacteria 4194
92 Ga0070717_10042260 3300006028 Bacteria 3717
93 Ga0070717_10402042 3300006028 Bacteria 1230
94 Ga0070712_100004743 3300006175 Bacteria 8403
95 Ga0070712_100088333 3300006175 Bacteria 2265
96 Ga0070712_100117914 3300006175 Bacteria 1993
97 Ga0075433_10029289 3300006852 Bacteria 4689
98 Ga0075433_10159150 3300006852 Bacteria 2009
99 Ga0075433_10241192 3300006852 Bacteria 1604
100 Ga0075434_100011460 3300006871 Bacteria 8366
101 Ga0075434_100062333 3300006871 Bacteria 3711
102 Ga0068865_100161021 3300006881 Bacteria 1712
103 Ga0075436_100016328 3300006914 Bacteria 5083
104 Ga0097620_100029823 3300006931 Bacteria 5472
105 Ga0097620_100638852 3300006931 Bacteria 1157
106 Ga0075435_100041356 3300007076 Bacteria 3684
107 Ga0075435_100060167 3300007076 Bacteria 3079
108 Ga0111539_10007452 3300009094 Bacteria 14019
109 Ga0111539_10045972 3300009094 Bacteria 5224
110 Ga0111539_10063080 3300009094 Bacteria 4385
111 Ga0105245_10054056 3300009098 Bacteria 3606
112 Ga0114129_10032999 3300009147 Bacteria 7317
113 Ga0114129_10229939 3300009147 Bacteria 2498
114 Ga0105243_10033961 3300009148 Bacteria 3946
115 Ga0105243_10252703 3300009148 Bacteria 1574
116 Ga0105249_10044590 3300009553 Bacteria 4032
117 Ga0105249_10059688 3300009553 Bacteria 3498
118 Ga0105249_10247399 3300009553 Bacteria 1766
119 Ga0105249_10289425 3300009553 Bacteria 1639
120 Ga0105239_10134431 3300010375 Bacteria 2753
121 Ga0105239_10321128 3300010375 Bacteria 1746
122 Ga0105239_10445883 3300010375 Bacteria 1468
123 Ga0105246_10090504 3300011119 Bacteria 2203
124 Ga0157371_10034231 3300013102 Bacteria 3644
125 Ga0157370_10007249 3300013104 Bacteria 12097
126 Ga0157372_10121274 3300013307 Bacteria 3003
127 Ga0157375_10128742 3300013308 Bacteria 2650
128 Ga0163163_10190589 3300014325 Bacteria 2099
129 Ga0157380_10191293 3300014326 Bacteria 1807
130 Ga0157377_10007075 3300014745 Bacteria 5391
131 Ga0206352_10510015 3300020078 Bacteria 1501
132 Ga0213874_10001159 3300021377 Bacteria 5406
133 Ga0213874_10001570 3300021377 Bacteria 4770
134 Ga0213874_10019899 3300021377 Bacteria 1833
135 Ga0213876_10004472 3300021384 Bacteria 7824
136 Ga0213876_10005592 3300021384 Bacteria 6900
137 Ga0213876_10009753 3300021384 Bacteria 5168
138 Ga0213876_10010234 3300021384 Bacteria 5037
139 Ga0213876_10020975 3300021384 Bacteria 3454
140 Ga0213876_10030713 3300021384 Bacteria 2834
141 Ga0213876_10095922 3300021384 Bacteria 1571
142 Ga0213875_10000186 3300021388 Bacteria 63592
143 Ga0213875_10001987 3300021388 Bacteria 12636
144 Ga0213875_10004362 3300021388 Bacteria 7793
145 Ga0224712_10044181 3300022467 Bacteria 1698
146 Ga0207426_1023712 3300025302 Bacteria 2091
147 Ga0207692_10027979 3300025898 Bacteria 2661
148 Ga0207692_10085615 3300025898 Bacteria 1696
149 Ga0207688_10033830 3300025901 Bacteria 2828
150 Ga0207688_10039479 3300025901 Bacteria 2621
151 Ga0207688_10058749 3300025901 Bacteria 2165
152 Ga0207647_10102241 3300025904 Bacteria 1699
153 Ga0207647_10118252 3300025904 Bacteria 1564
154 Ga0207699_10218233 3300025906 Bacteria 1301
155 Ga0207643_10066343 3300025908 Bacteria 2069
156 Ga0207684_10000408 3300025910 Bacteria 57555
157 Ga0207684_10015767 3300025910 Bacteria 6500
158 Ga0207684_10130903 3300025910 Bacteria 2153
159 Ga0207693_10008582 3300025915 Bacteria 8365
160 Ga0207693_10010703 3300025915 Bacteria 7446
161 Ga0207693_10100587 3300025915 Bacteria 2267
162 Ga0207693_10240494 3300025915 Bacteria 1421
163 Ga0207663_10132891 3300025916 Bacteria 1722
164 Ga0207663_10174867 3300025916 Bacteria 1528
165 Ga0207646_10005260 3300025922 Bacteria 13646
166 Ga0207687_10018346 3300025927 Bacteria 4617
167 Ga0207687_10027133 3300025927 Bacteria 3841
168 Ga0207700_10176690 3300025928 Bacteria 1785
169 Ga0207664_10011357 3300025929 Bacteria 6325
170 Ga0207690_10217759 3300025932 Bacteria 1459
171 Ga0207706_10018706 3300025933 Bacteria 6232
172 Ga0207686_10078283 3300025934 Bacteria 2150
173 Ga0207709_10016973 3300025935 Bacteria 4057
174 Ga0207670_10015950 3300025936 Bacteria 4501
175 Ga0207704_10118623 3300025938 Bacteria 1805
176 Ga0207704_10125091 3300025938 Bacteria 1768
177 Ga0207665_10075352 3300025939 Bacteria 2311
178 Ga0207667_10319989 3300025949 Bacteria 1584
179 Ga0207712_10024766 3300025961 Bacteria 3980
180 Ga0207640_10097749 3300025981 Bacteria 2050
181 Ga0207640_10171574 3300025981 Bacteria 1617
182 Ga0207640_10270283 3300025981 Bacteria 1329
183 Ga0207677_10105973 3300026023 Bacteria 2081
184 Ga0207703_10032807 3300026035 Bacteria 4112
185 Ga0207678_10289632 3300026067 Bacteria 1406
186 Ga0207708_10000282 3300026075 Bacteria 39901
187 Ga0207708_10006747 3300026075 Bacteria 8493
188 Ga0207708_10016712 3300026075 Bacteria 5521
189 Ga0207708_10021676 3300026075 Bacteria 4846
190 Ga0207702_10230235 3300026078 Bacteria 1731
191 Ga0207648_10055657 3300026089 Bacteria 3453
192 Ga0207674_10140732 3300026116 Bacteria 2372
193 Ga0207675_100015029 3300026118 Bacteria 7223
194 Ga0207675_100342149 3300026118 Bacteria 1464
195 Ga0207675_100435506 3300026118 Bacteria 1297
196 Ga0207698_10025487 3300026142 Bacteria 4168
197 Ga0207428_10081342 3300027907 Bacteria 2529
198 Ga0207428_10117733 3300027907 Bacteria 2039
199 Ga0268265_10136306 3300028380 Bacteria 2048
200 Ga0268264_10164681 3300028381 Bacteria 2001
201 Ga0316182_1017847 3300030745 Bacteria 1540
202 Ga0307405_10027039 3300031731 Bacteria 3320
203 Ga0307413_10059887 3300031824 Bacteria 2341
204 Ga0307413_10072920 3300031824 Bacteria 2169
205 Ga0307410_10237678 3300031852 Bacteria 1410
206 Ga0307412_10065655 3300031911 Bacteria 2457
207 Ga0307409_100023473 3300031995 Bacteria 4275
208 Ga0307409_100136451 3300031995 Bacteria 2106
209 Ga0307409_100170926 3300031995 Bacteria 1913
210 Ga0307409_100306240 3300031995 Bacteria 1480
211 Ga0307409_100418927 3300031995 Bacteria 1284
212 Ga0307416_100045159 3300032002 Bacteria 3467
213 Ga0307416_100055821 3300032002 Bacteria 3183
214 Ga0307416_100427548 3300032002 Bacteria 1370
215 Ga0307414_10083621 3300032004 Bacteria 2345
216 Ga0307411_10214764 3300032005 Bacteria 1488
217 Ga0307415_100014660 3300032126 Bacteria 4617
218 Ga0307415_100025552 3300032126 Bacteria 3708
219 Ga0373954_0143044 3300035118 Bacteria 1167
220 Ga0373960_0057785 3300035121 Bacteria 1169
221 Ga0373933_0147581 3300035724 Bacteria 1488
222 Ga0373937_0027359 3300036401 Bacteria 5156
223 Ga0395899_0008151 3300037312 Bacteria 8073
224 Ga0395899_0092181 3300037312 Bacteria 2194
225 Ga0395900_0003125 3300037418 Bacteria 17977
226 Ga0395898_0014810 3300037466 Bacteria 8004
227 Ga0395898_0135702 3300037466 Bacteria 2356
228 Ga0395898_0472898 3300037466 Bacteria 1193
229 Ga0395905_0005961 3300037471 Bacteria 12344
230 Ga0395905_0126562 3300037471 Bacteria 2402
231 Ga0436364_0043482 3300037853 Bacteria 2700
232 Ga0436364_0409665 3300037853 Bacteria 38199
233 Ga0436364_1040466 3300037853 Bacteria 95595
234 Ga0436364_1180097 3300037853 Bacteria 39008
235 Ga0436364_1402556 3300037853 Bacteria 2777
236 Ga0436364_1499925 3300037853 Bacteria 1750
237 Ga0395901_0005515 3300038443 Bacteria 12812
238 Ga0395901_0016549 3300038443 Bacteria 7514
239 Ga0395901_0164704 3300038443 Bacteria 2328
240 Ga0395901_0168622 3300038443 Bacteria 2297
241 Ga0395901_0309314 3300038443 Bacteria 1637
242 Ga0436365_0152989 3300039437 Bacteria 4937
243 Ga0436365_0248508 3300039437 Bacteria 47975
244 Ga0436365_0870509 3300039437 Bacteria 1036
245 Ga0436365_0987482 3300039437 Bacteria 10308
246 Ga0436365_1072604 3300039437 Bacteria 12891
247 Ga0436365_1199562 3300039437 Bacteria 4248
248 Ga0436365_1291562 3300039437 Bacteria 4893
249 Ga0436365_1331228 3300039437 Bacteria 9737
250 Ga0436365_1611802 3300039437 Bacteria 1720
251 Ga0436365_1649890 3300039437 Bacteria 15288
252 Ga0436363_0216337 3300039450 Bacteria 5361
253 Ga0436363_0228184 3300039450 Bacteria 55094
254 Ga0436363_0230425 3300039450 Bacteria 32869
255 Ga0436363_0341965 3300039450 Bacteria 13542
256 Ga0436363_0567618 3300039450 Bacteria 5124
257 Ga0436363_0786596 3300039450 Bacteria 9214
258 Ga0436362_0661420 3300039453 Bacteria 2681
259 Ga0451791_0076893 3300041451 Bacteria 3930
260 Ga0466963_0011524 3300044694 Bacteria 5384
261 Ga0466963_0015625 3300044694 Bacteria 4706
262 Ga0466963_0017017 3300044694 Bacteria 4528
263 Ga0466963_0023118 3300044694 Bacteria 3942
264 Ga0466963_0032603 3300044694 Bacteria 3375
265 Ga0466963_0066076 3300044694 Bacteria 2425
266 Ga0453684_0074054 3300044712 Bacteria 4290
267 Ga0466971_0017680 3300044719 Bacteria 3156
268 Ga0466971_0025333 3300044719 Bacteria 2649
269 Ga0466971_0080259 3300044719 Bacteria 1487
270 Ga0466971_0092085 3300044719 Bacteria 1389
271 Ga0466957_0095621 3300044842 Bacteria 1866
272 Ga0466959_0010102 3300045049 Bacteria 6731
273 Ga0466959_0087366 3300045049 Bacteria 2243
274 Ga0466958_0006451 3300045836 Bacteria 6385
275 Ga0466958_0014478 3300045836 Bacteria 4504
276 Ga0466958_0023037 3300045836 Bacteria 3652
277 Ga0466958_0061901 3300045836 Bacteria 2280
278 Ga0466967_0014309 3300045976 Bacteria 6174
279 Ga0466967_0059322 3300045976 Bacteria 3386
280 Ga0466967_0087887 3300045976 Bacteria 2819
281 Ga0466967_0103027 3300045976 Bacteria 2612
282 Ga0466967_0114175 3300045976 Bacteria 2486
283 Ga0466967_0146577 3300045976 Bacteria 2202
284 Ga0466967_0160216 3300045976 Bacteria 2111
285 Ga0466967_0415871 3300045976 Bacteria 1310
286 Ga0495592_0165461 3300046454 Bacteria 1518
287 Ga0495651_0103081 3300046462 Bacteria 2120
288 Ga0495650_0000121 3300046471 Bacteria 183055
289 Ga0495664_0180043 3300046477 Bacteria 1282
290 Ga0495608_0003501 3300046511 Bacteria 11248
291 Ga0495616_0051787 3300046513 Bacteria 2046
292 Ga0495618_0025138 3300046514 Bacteria 3695
293 Ga0495628_0032923 3300046516 Bacteria 4180
294 Ga0495642_0014720 3300046528 Bacteria 3035
295 Ga0495652_0024352 3300046529 Bacteria 5358
296 Ga0495667_0011736 3300046559 Bacteria 5932
297 Ga0495634_0057235 3300046642 Bacteria 2603
298 Ga0495635_0079114 3300046663 Bacteria 2250
299 Ga0495657_0013674 3300046675 Bacteria 5978
300 Ga0495623_0092702 3300046679 Bacteria 1851
301 Ga0495613_0166414 3300046689 Bacteria 1566
302 Ga0495670_0076413 3300046691 Bacteria 1702
303 Ga0495649_0136860 3300046694 Bacteria 1291
304 Ga0495600_0053357 3300046809 Bacteria 2640
305 Ga0495604_0019080 3300047317 Bacteria 5491
306 Ga0495674_0111362 3300047319 Bacteria 2320
307 Ga0495684_0190292 3300047471 Bacteria 1517
308 Ga0496100_0002773 3300048903 Bacteria 8960
309 Ga0496100_0056412 3300048903 Bacteria 2570
310 Ga0496101_0067299 3300048904 Bacteria 2615
311 Ga0496102_0041574 3300048905 Bacteria 4163
312 Ga0496102_0065628 3300048905 Bacteria 3327
313 Ga0496102_0093508 3300048905 Bacteria 2785
314 Ga0496102_0284886 3300048905 Bacteria 1557
315 Ga0496103_0037332 3300048906 Bacteria 2977
316 Ga0496103_0094743 3300048906 Bacteria 1886
317 Ga0496103_0102573 3300048906 Bacteria 1812
318 Ga0496104_0001942 3300048907 Bacteria 17924
319 Ga0496104_0050169 3300048907 Bacteria 3938
320 Ga0496104_0075466 3300048907 Bacteria 3210
321 Ga0496105_0038675 3300048908 Bacteria 3930
322 Ga0496105_0093932 3300048908 Bacteria 2477
323 Ga0496105_0167494 3300048908 Bacteria 1802
324 Ga0496106_0003395 3300048909 Bacteria 11865
325 Ga0496106_0015607 3300048909 Bacteria 5617
326 Ga0496106_0035497 3300048909 Bacteria 3728
327 Ga0496106_0061811 3300048909 Bacteria 2842
328 Ga0496106_0301291 3300048909 Bacteria 1285
329 Ga0496107_0007662 3300048910 Bacteria 7454
330 Ga0496107_0099654 3300048910 Bacteria 2129
331 Ga0496107_0136326 3300048910 Bacteria 1813
332 Ga0496108_0004397 3300048911 Bacteria 11344
333 Ga0496108_0064374 3300048911 Bacteria 3089
334 Ga0496108_0095168 3300048911 Bacteria 2535
335 Ga0496108_0269504 3300048911 Bacteria 1482
336 Ga0496109_0003783 3300048912 Bacteria 12627
337 Ga0496109_0023832 3300048912 Bacteria 5433
338 Ga0496109_0049151 3300048912 Bacteria 3838
339 Ga0496109_0096446 3300048912 Bacteria 2740
340 Ga0496109_0213762 3300048912 Bacteria 1813
341 Ga0496110_0007198 3300048913 Bacteria 8860
342 Ga0496110_0010566 3300048913 Bacteria 7517
343 Ga0496110_0047545 3300048913 Bacteria 3758
344 Ga0496110_0201145 3300048913 Bacteria 1810
345 Ga0496111_0006242 3300048914 Bacteria 7726
346 Ga0496111_0013162 3300048914 Bacteria 5623
347 Ga0496111_0045081 3300048914 Bacteria 3172
348 Ga0496111_0063270 3300048914 Bacteria 2683
349 Ga0496112_0004664 3300048915 Bacteria 11655
350 Ga0496112_0038322 3300048915 Bacteria 4680
351 Ga0496112_0070989 3300048915 Bacteria 3442
352 Ga0496112_0088289 3300048915 Bacteria 3068
353 Ga0496113_0003181 3300048916 Bacteria 9781
354 Ga0496113_0032707 3300048916 Bacteria 3780
355 Ga0496113_0193061 3300048916 Bacteria 1616
356 Ga0496114_0032685 3300048917 Bacteria 4284
357 Ga0496115_0066457 3300048918 Bacteria 2914
358 Ga0496115_0101321 3300048918 Bacteria 2361
359 Ga0496121_0322447 3300048924 Bacteria 1040
360 Ga0496126_0245786 3300048929 Bacteria 1493
361 Ga0501034_0262125 3300049571 Bacteria 1671
362 Ga0501037_0161720 3300049573 Bacteria 1596
363 Ga0501039_0034774 3300049575 Bacteria 3888
364 Ga0501039_0093004 3300049575 Bacteria 2350
365 Ga0501041_0064609 3300049577 Bacteria 2241
366 Ga0501048_0049607 3300049582 Bacteria 2991
367 Ga0501071_0018885 3300049587 Bacteria 4780
368 Ga0501071_0074496 3300049587 Bacteria 2477
369 Ga0501072_0071812 3300049588 Bacteria 2735
370 Ga0501072_0164928 3300049588 Bacteria 1767
371 Ga0501075_0034038 3300049591 Bacteria 3792
372 Ga0501075_0145220 3300049591 Bacteria 1808
373 Ga0501076_0016442 3300049592 Bacteria 5609
374 Ga0501076_0059999 3300049592 Bacteria 3026
375 Ga0501076_0098753 3300049592 Bacteria 2352
376 Ga0501077_0061803 3300049593 Bacteria 2377
377 Ga0501081_0234285 3300049743 Bacteria 1338
378 Ga0501045_0015473 3300049824 Bacteria 5412
379 nmdc:mga05p37_268146_c1 3300050507 Bacteria 2041
380 nmdc:mga06r32_214170_c1 3300050510 Bacteria 1914
381 nmdc:mga06r32_233470_c1 3300050510 Bacteria 1827
382 nmdc:mga06r32_314129_c1 3300050510 Bacteria 1553
383 nmdc:mga06r32_729708_c1 3300050510 Bacteria 955
384 nmdc:mga08y16_10815_c1 3300050511 Bacteria 9581
385 nmdc:mga08y16_384327_c1 3300050511 Bacteria 1439
386 nmdc:mga0n895_1445_c1 3300050512 Bacteria 17762
387 nmdc:mga0n895_311312_c1 3300050512 Bacteria 1596
388 nmdc:mga0rr50_334_c1 3300050513 Bacteria 25578
389 nmdc:mga08x19_16012_c1 3300050514 Bacteria 4569
390 nmdc:mga0a205_1744_c1 3300050515 Bacteria 18811
391 nmdc:mga0a205_261754_c1 3300050515 Bacteria 1607
392 nmdc:mga0a205_94463_c1 3300050515 Bacteria 2889
393 Ga0495619_0027050 3300053085 Bacteria 3694
394 Ga0500556_0000795 3300053104 Bacteria 18495
395 Ga0500616_0008373 3300053153 Bacteria 6434
396 Ga0500616_0013597 3300053153 Bacteria 4717
397 Ga0500599_003184 3300053736 Bacteria 1996
398 Ga0501084_0085038 3300054114 Bacteria 2656
399 Ga0587085_011905 3300059506 Bacteria 1184
400 Ga0587115_005103 3300059626 Bacteria 1463
401 Ga0501082_0051402 3300060353 Bacteria 3552
402 Ga0501082_0101028 3300060353 Bacteria 2495
403 Ga0466962_0009532 3300061719 Bacteria 4657
404 Ga0466962_0022628 3300061719 Bacteria 3021
405 2895438578 2895427314 Bacteria 13147766
406 3003003856 3002998708 Bacteria 11715108
407 Ga0032354_1008369
408 JGI25406J46586_10002628
409 JGI25407J50210_10000189
410 Ga0058862_10016299
411 Ga0070676_10047853
412 Ga0070683_100015706
413 Ga0070683_100220639
414 Ga0068869_100079514
415 Ga0070682_100046099
416 Ga0068868_100011631
417 Ga0068868_100099931
418 Ga0068868_100147012
419 Ga0070691_10007640
420 Ga0070668_100050143
421 Ga0070675_100121135
422 Ga0070659_100333225
423 Ga0070709_10116961
424 Ga0070714_100022015
425 Ga0070714_100151534
426 Ga0070713_100110088
427 Ga0070713_100421360
428 Ga0070710_10053146
429 Ga0070700_100002502
430 Ga0070700_100146585
431 Ga0070694_100002651
432 Ga0070708_100013642
433 Ga0070708_100063113
434 Ga0070708_100081876
435 Ga0070663_100027264
436 Ga0070663_100195202
437 Ga0070678_100100278
438 Ga0070662_100392846
439 Ga0068867_100088946
440 Ga0070685_10037826
441 Ga0070685_10144851
442 Ga0070707_100011289
443 Ga0070707_100026437
444 Ga0070707_100329004
445 Ga0070698_100007139
446 Ga0070698_100015750
447 Ga0070698_100137122
448 Ga0070699_100002078
449 Ga0070699_100034446
450 Ga0070684_100086583
451 Ga0070684_100197499
452 Ga0070684_100225664
453 Ga0070697_100002941
454 Ga0070697_100012809
455 Ga0070672_100229673
456 Ga0070695_100007030
457 Ga0070665_100232948
458 Ga0070704_100001620
459 Ga0070704_100022120
460 Ga0068855_100200442
461 Ga0070664_100175138
462 Ga0068854_100195042
463 Ga0068856_100021253
464 Ga0070702_100005968
465 Ga0070702_100031117
466 Ga0070702_100074498
467 Ga0068859_100029823
468 Ga0068859_100638802
469 Ga0068864_100186493
470 Ga0068866_10078696
471 Ga0068861_100030406
472 Ga0068858_100047141
473 Ga0068860_100301186
474 Ga0068862_100154641
475 Ga0081455_10009962
476 Ga0081455_10019262
477 Ga0081455_10055636
478 Ga0081455_10076890
479 Ga0081455_10181329
480 Ga0081538_10000272
481 Ga0081538_10000664
482 Ga0081538_10001970
483 Ga0081538_10008845
484 Ga0081538_10009398
485 Ga0081538_10015363
486 Ga0081538_10020594
487 Ga0081538_10035674
488 Ga0081538_10044551
489 Ga0081538_10053524
490 Ga0081540_1000550
491 Ga0081540_1045706
492 Ga0081540_1046376
493 Ga0081539_10001376
494 Ga0081539_10016800
495 Ga0081539_10059407
496 Ga0070717_10001734
497 Ga0070717_10032699
498 Ga0070717_10042260
499 Ga0070717_10402042
500 Ga0070712_100004743
501 Ga0070712_100088333
502 Ga0070712_100117914
503 Ga0075433_10029289
504 Ga0075433_10159150
505 Ga0075433_10241192
506 Ga0075434_100011460
507 Ga0075434_100062333
508 Ga0068865_100161021
509 Ga0075436_100016328
510 Ga0097620_100029823
511 Ga0097620_100638852
512 Ga0075435_100041356
513 Ga0075435_100060167
514 Ga0111539_10007452
515 Ga0111539_10045972
516 Ga0111539_10063080
517 Ga0105245_10054056
518 Ga0114129_10032999
519 Ga0114129_10229939
520 Ga0105243_10033961
521 Ga0105243_10252703
522 Ga0105249_10044590
523 Ga0105249_10059688
524 Ga0105249_10247399
525 Ga0105249_10289425
526 Ga0105239_10134431
527 Ga0105239_10321128
528 Ga0105239_10445883
529 Ga0105246_10090504
530 Ga0157371_10034231
531 Ga0157370_10007249
532 Ga0157372_10121274
533 Ga0157375_10128742
534 Ga0163163_10190589
535 Ga0157380_10191293
536 Ga0157377_10007075
537 Ga0206352_10510015
538 Ga0213874_10001159
539 Ga0213874_10001570
540 Ga0213874_10019899
541 Ga0213876_10004472
542 Ga0213876_10005592
543 Ga0213876_10009753
544 Ga0213876_10010234
545 Ga0213876_10020975
546 Ga0213876_10030713
547 Ga0213876_10095922
548 Ga0213875_10000186
549 Ga0213875_10001987
550 Ga0213875_10004362
551 Ga0224712_10044181
552 Ga0207426_1023712
553 Ga0207692_10027979
554 Ga0207692_10085615
555 Ga0207688_10033830
556 Ga0207688_10039479
557 Ga0207688_10058749
558 Ga0207647_10102241
559 Ga0207647_10118252
560 Ga0207699_10218233
561 Ga0207643_10066343
562 Ga0207684_10000408
563 Ga0207684_10015767
564 Ga0207684_10130903
565 Ga0207693_10008582
566 Ga0207693_10010703
567 Ga0207693_10100587
568 Ga0207693_10240494
569 Ga0207663_10132891
570 Ga0207663_10174867
571 Ga0207646_10005260
572 Ga0207687_10018346
573 Ga0207687_10027133
574 Ga0207700_10176690
575 Ga0207664_10011357
576 Ga0207690_10217759
577 Ga0207706_10018706
578 Ga0207686_10078283
579 Ga0207709_10016973
580 Ga0207670_10015950
581 Ga0207704_10118623
582 Ga0207704_10125091
583 Ga0207665_10075352
584 Ga0207667_10319989
585 Ga0207712_10024766
586 Ga0207640_10097749
587 Ga0207640_10171574
588 Ga0207640_10270283
589 Ga0207677_10105973
590 Ga0207703_10032807
591 Ga0207678_10289632
592 Ga0207708_10000282
593 Ga0207708_10006747
594 Ga0207708_10016712
595 Ga0207708_10021676
596 Ga0207702_10230235
597 Ga0207648_10055657
598 Ga0207674_10140732
599 Ga0207675_100015029
600 Ga0207675_100342149
601 Ga0207675_100435506
602 Ga0207698_10025487
603 Ga0207428_10081342
604 Ga0207428_10117733
605 Ga0268265_10136306
606 Ga0268264_10164681
607 Ga0316182_1017847
608 Ga0307405_10027039
609 Ga0307413_10059887
610 Ga0307413_10072920
611 Ga0307410_10237678
612 Ga0307412_10065655
613 Ga0307409_100023473
614 Ga0307409_100136451
615 Ga0307409_100170926
616 Ga0307409_100306240
617 Ga0307409_100418927
618 Ga0307416_100045159
619 Ga0307416_100055821
620 Ga0307416_100427548
621 Ga0307414_10083621
622 Ga0307411_10214764
623 Ga0307415_100014660
624 Ga0307415_100025552
625 Ga0373954_0143044
626 Ga0373960_0057785
627 Ga0373933_0147581
628 Ga0373937_0027359
629 Ga0395899_0008151
630 Ga0395899_0092181
631 Ga0395900_0003125
632 Ga0395898_0014810
633 Ga0395898_0135702
634 Ga0395898_0472898
635 Ga0395905_0005961
636 Ga0395905_0126562
637 Ga0436364_0043482
638 Ga0436364_0409665
639 Ga0436364_1040466
640 Ga0436364_1180097
641 Ga0436364_1402556
642 Ga0436364_1499925
643 Ga0395901_0005515
644 Ga0395901_0016549
645 Ga0395901_0164704
646 Ga0395901_0168622
647 Ga0395901_0309314
648 Ga0436365_0152989
649 Ga0436365_0248508
650 Ga0436365_0870509
651 Ga0436365_0987482
652 Ga0436365_1072604
653 Ga0436365_1199562
654 Ga0436365_1291562
655 Ga0436365_1331228
656 Ga0436365_1611802
657 Ga0436365_1649890
658 Ga0436363_0216337
659 Ga0436363_0228184
660 Ga0436363_0230425
661 Ga0436363_0341965
662 Ga0436363_0567618
663 Ga0436363_0786596
664 Ga0436362_0661420
665 Ga0451791_0076893
666 Ga0466963_0011524
667 Ga0466963_0015625
668 Ga0466963_0017017
669 Ga0466963_0023118
670 Ga0466963_0032603
671 Ga0466963_0066076
672 Ga0453684_0074054
673 Ga0466971_0017680
674 Ga0466971_0025333
675 Ga0466971_0080259
676 Ga0466971_0092085
677 Ga0466957_0095621
678 Ga0466959_0010102
679 Ga0466959_0087366
680 Ga0466958_0006451
681 Ga0466958_0014478
682 Ga0466958_0023037
683 Ga0466958_0061901
684 Ga0466967_0014309
685 Ga0466967_0059322
686 Ga0466967_0087887
687 Ga0466967_0103027
688 Ga0466967_0114175
689 Ga0466967_0146577
690 Ga0466967_0160216
691 Ga0466967_0415871
692 Ga0495592_0165461
693 Ga0495651_0103081
694 Ga0495650_0000121
695 Ga0495664_0180043
696 Ga0495608_0003501
697 Ga0495616_0051787
698 Ga0495618_0025138
699 Ga0495628_0032923
700 Ga0495642_0014720
701 Ga0495652_0024352
702 Ga0495667_0011736
703 Ga0495634_0057235
704 Ga0495635_0079114
705 Ga0495657_0013674
706 Ga0495623_0092702
707 Ga0495613_0166414
708 Ga0495670_0076413
709 Ga0495649_0136860
710 Ga0495600_0053357
711 Ga0495604_0019080
712 Ga0495674_0111362
713 Ga0495684_0190292
714 Ga0496100_0002773
715 Ga0496100_0056412
716 Ga0496101_0067299
717 Ga0496102_0041574
718 Ga0496102_0065628
719 Ga0496102_0093508
720 Ga0496102_0284886
721 Ga0496103_0037332
722 Ga0496103_0094743
723 Ga0496103_0102573
724 Ga0496104_0001942
725 Ga0496104_0050169
726 Ga0496104_0075466
727 Ga0496105_0038675
728 Ga0496105_0093932
729 Ga0496105_0167494
730 Ga0496106_0003395
731 Ga0496106_0015607
732 Ga0496106_0035497
733 Ga0496106_0061811
734 Ga0496106_0301291
735 Ga0496107_0007662
736 Ga0496107_0099654
737 Ga0496107_0136326
738 Ga0496108_0004397
739 Ga0496108_0064374
740 Ga0496108_0095168
741 Ga0496108_0269504
742 Ga0496109_0003783
743 Ga0496109_0023832
744 Ga0496109_0049151
745 Ga0496109_0096446
746 Ga0496109_0213762
747 Ga0496110_0007198
748 Ga0496110_0010566
749 Ga0496110_0047545
750 Ga0496110_0201145
751 Ga0496111_0006242
752 Ga0496111_0013162
753 Ga0496111_0045081
754 Ga0496111_0063270
755 Ga0496112_0004664
756 Ga0496112_0038322
757 Ga0496112_0070989
758 Ga0496112_0088289
759 Ga0496113_0003181
760 Ga0496113_0032707
761 Ga0496113_0193061
762 Ga0496114_0032685
763 Ga0496115_0066457
764 Ga0496115_0101321
765 Ga0496121_0322447
766 Ga0496126_0245786
767 Ga0501034_0262125
768 Ga0501037_0161720
769 Ga0501039_0034774
770 Ga0501039_0093004
771 Ga0501041_0064609
772 Ga0501048_0049607
773 Ga0501071_0018885
774 Ga0501071_0074496
775 Ga0501072_0071812
776 Ga0501072_0164928
777 Ga0501075_0034038
778 Ga0501075_0145220
779 Ga0501076_0016442
780 Ga0501076_0059999
781 Ga0501076_0098753
782 Ga0501077_0061803
783 Ga0501081_0234285
784 Ga0501045_0015473
785 nmdc:mga05p37_268146_c1
786 nmdc:mga06r32_214170_c1
787 nmdc:mga06r32_233470_c1
788 nmdc:mga06r32_314129_c1
789 nmdc:mga06r32_729708_c1
790 nmdc:mga08y16_10815_c1
791 nmdc:mga08y16_384327_c1
792 nmdc:mga0n895_1445_c1
793 nmdc:mga0n895_311312_c1
794 nmdc:mga0rr50_334_c1
795 nmdc:mga08x19_16012_c1
796 nmdc:mga0a205_1744_c1
797 nmdc:mga0a205_261754_c1
798 nmdc:mga0a205_94463_c1
799 Ga0495619_0027050
800 Ga0500556_0000795
801 Ga0500616_0008373
802 Ga0500616_0013597
803 Ga0500599_003184
804 Ga0501084_0085038
805 Ga0587085_011905
806 Ga0587115_005103
807 Ga0501082_0051402
808 Ga0501082_0101028
809 Ga0466962_0009532
810 Ga0466962_0022628
811 2895438578
812 3003003856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

25

138

0.97

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

179

307

0.94

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

212

340

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h2b-assembly1.cif.gz_B crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution 0.9707 1 341
1h2b-assembly1.cif.gz_B crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution 0.9651 1 341
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.9467 1 340
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.9466 1 340
2eer-assembly1.cif.gz_B structural study of project id st2577 from sulfolobus tokodaii strain7 0.9462 1 341
ID Description Score Start End Superfamily
1h2bB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9652 152 290 3.40.50.720
1h2bB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9519 152 290 3.40.50.720
1ntoA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9371 156 288 3.40.50.720
af_I1KB52_2_137_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9303 17 148 3.90.180.10
af_Q17334_7_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9298 2 149 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A177ET13-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9909 1 340 GO:0008270
GO:0016491
GO:0043231
AF-A0A177ET13-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9823 1 340 GO:0008270
GO:0016491
GO:0043231
AF-A0A848DDF5-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9806 1 341 GO:0008270
GO:0016491
AF-A0A848DDF5-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9777 1 341 GO:0008270
GO:0016491
AF-A0A528BZ19-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9764 128 341

Map