F436067

General Info

Members Datasets Scaffolds Average Seq Length
405 264 810 148

Family's Representative Sequence

Representative Sequence 3300049708|Ga0501245_042288|Ga0501245_042288_165_653
Length 162
Sequence MDEMVTRRDALKAGGAVAVYALAVAAGLIRPGTALAQAAWNKAAFDSKALTEAQKALGAAQMTLSPEVRFASPTPDIAENGAVVPVTVASGVPGTRSIAILVPKNPNVLIADFEIPEGTDPFVSTRVKMAETSDVYALVKVADGRWFYAKKEIKVTIGGCGG

Samples

Sample ID Description Type Environment
1 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
167 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
168 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
243 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 2.22
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501245_042288 3300049708 Bacteria 787
2 Ga0065712_10474983 3300005290 Bacteria 667
3 Ga0070676_10002450 3300005328 Bacteria 9504
4 Ga0070676_10238905 3300005328 Bacteria 1207
5 Ga0070683_100233790 3300005329 Bacteria 1747
6 Ga0070670_100474270 3300005331 Bacteria 1111
7 Ga0068869_100079613 3300005334 Bacteria 2442
8 Ga0068869_100143863 3300005334 Bacteria 1844
9 Ga0070666_10288239 3300005335 Bacteria 1168
10 Ga0070680_100026703 3300005336 Bacteria 4618
11 Ga0070680_100327417 3300005336 Bacteria 1301
12 Ga0070680_100493235 3300005336 Bacteria 1047
13 Ga0070680_100555054 3300005336 Bacteria 985
14 Ga0070682_100535556 3300005337 Bacteria 914
15 Ga0068868_100071380 3300005338 Bacteria 2769
16 Ga0070660_100081514 3300005339 Bacteria 2540
17 Ga0070689_100057745 3300005340 Bacteria 3013
18 Ga0070689_100959849 3300005340 Bacteria 759
19 Ga0070691_10116339 3300005341 Bacteria 1342
20 Ga0070691_10120672 3300005341 Bacteria 1320
21 Ga0070687_100419924 3300005343 Bacteria 882
22 Ga0070661_100070972 3300005344 Bacteria 2562
23 Ga0070692_10003541 3300005345 Bacteria 6349
24 Ga0070668_101047429 3300005347 Bacteria 735
25 Ga0070675_101372032 3300005354 Bacteria 652
26 Ga0070671_100037504 3300005355 Bacteria 4020
27 Ga0070674_100020884 3300005356 Bacteria 4193
28 Ga0070674_101464554 3300005356 Bacteria 613
29 Ga0070688_100036738 3300005365 Bacteria 2981
30 Ga0070659_100016898 3300005366 Bacteria 5484
31 Ga0070667_100200987 3300005367 Bacteria 1769
32 Ga0070709_10034047 3300005434 Bacteria 3086
33 Ga0070714_100239771 3300005435 Bacteria 1673
34 Ga0070714_101485716 3300005435 Bacteria 662
35 Ga0070713_100002210 3300005436 Bacteria 12611
36 Ga0070710_10070463 3300005437 Bacteria 2014
37 Ga0070710_10721800 3300005437 Bacteria 705
38 Ga0070701_10424269 3300005438 Bacteria 848
39 Ga0070705_100009463 3300005440 Bacteria 4846
40 Ga0070705_100089730 3300005440 Bacteria 1911
41 Ga0070700_100674309 3300005441 Bacteria 819
42 Ga0070694_100012921 3300005444 Bacteria 5207
43 Ga0070694_100204495 3300005444 Bacteria 1473
44 Ga0070694_100307004 3300005444 Bacteria 1217
45 Ga0070694_100460536 3300005444 Bacteria 1005
46 Ga0070708_100027478 3300005445 Bacteria 4883
47 Ga0070663_100613781 3300005455 Bacteria 916
48 Ga0070678_100019530 3300005456 Bacteria 4421
49 Ga0070678_101067354 3300005456 Bacteria 745
50 Ga0070662_101402348 3300005457 Bacteria 602
51 Ga0070681_10008283 3300005458 Bacteria 10180
52 Ga0070681_10011034 3300005458 Bacteria 8932
53 Ga0068867_100087456 3300005459 Bacteria 2360
54 Ga0070706_100159105 3300005467 Bacteria 2109
55 Ga0070707_100441347 3300005468 Bacteria 1262
56 Ga0070699_100006155 3300005518 Bacteria 10481
57 Ga0070679_100180884 3300005530 Bacteria 2081
58 Ga0070684_100065112 3300005535 Bacteria 3198
59 Ga0068853_100138015 3300005539 Bacteria 2187
60 Ga0070695_100079337 3300005545 Bacteria 2166
61 Ga0070695_100216180 3300005545 Bacteria 1379
62 Ga0070696_100033133 3300005546 Bacteria 3548
63 Ga0070696_100100865 3300005546 Bacteria 2069
64 Ga0070696_100294144 3300005546 Bacteria 1242
65 Ga0070693_100045745 3300005547 Bacteria 2482
66 Ga0070693_100149426 3300005547 Bacteria 1478
67 Ga0070693_100291330 3300005547 Bacteria 1097
68 Ga0070704_100483523 3300005549 Bacteria 1072
69 Ga0068855_100943178 3300005563 Bacteria 909
70 Ga0070664_100067776 3300005564 Bacteria 3050
71 Ga0068854_100251082 3300005578 Bacteria 1412
72 Ga0068854_100518835 3300005578 Bacteria 1006
73 Ga0070702_101170272 3300005615 Bacteria 618
74 Ga0070702_101366768 3300005615 Bacteria 578
75 Ga0070702_101372485 3300005615 Bacteria 577
76 Ga0068864_100189094 3300005618 Bacteria 1887
77 Ga0068861_100249648 3300005719 Bacteria 1513
78 Ga0068851_10047506 3300005834 Bacteria 2174
79 Ga0070715_10127490 3300006163 Bacteria 1221
80 Ga0070716_100017483 3300006173 Bacteria 3718
81 Ga0070712_100475199 3300006175 Bacteria 1044
82 Ga0068871_101285518 3300006358 Bacteria 688
83 Ga0075428_100005614 3300006844 Bacteria 13936
84 Ga0075430_100003637 3300006846 Bacteria 12936
85 Ga0075431_100014320 3300006847 Bacteria 8021
86 Ga0075431_101122173 3300006847 Bacteria 751
87 Ga0075429_100031445 3300006880 Bacteria 4613
88 Ga0068865_100618021 3300006881 Bacteria 918
89 Ga0075436_100095599 3300006914 Bacteria 2067
90 Ga0075435_100038152 3300007076 Bacteria 3830
91 Ga0099794_10019327 3300007265 Bacteria 3067
92 Ga0105240_10033359 3300009093 Bacteria 6652
93 Ga0111539_10022575 3300009094 Bacteria 7731
94 Ga0105245_10785416 3300009098 Bacteria 990
95 Ga0114129_10013192 3300009147 Bacteria 11773
96 Ga0114129_11443703 3300009147 Bacteria 847
97 Ga0105241_10116499 3300009174 Bacteria 2146
98 Ga0105241_10889571 3300009174 Unclassified 826
99 Ga0105248_10362384 3300009177 Bacteria 1632
100 Ga0105248_13406908 3300009177 Bacteria 505
101 Ga0105237_10546054 3300009545 Bacteria 1165
102 Ga0105239_10688130 3300010375 Bacteria 1169
103 Ga0157373_10334353 3300013100 Bacteria 1079
104 Ga0157371_10458310 3300013102 Bacteria 938
105 Ga0157370_10063590 3300013104 Bacteria 3495
106 Ga0157369_11085281 3300013105 Bacteria 818
107 Ga0157378_10039667 3300013297 Bacteria 4177
108 Ga0157378_11476121 3300013297 Bacteria 724
109 Ga0157377_10404731 3300014745 Bacteria 930
110 Ga0207692_10143139 3300025898 Bacteria 1362
111 Ga0207699_10664642 3300025906 Bacteria 762
112 Ga0207645_10003152 3300025907 Bacteria 12630
113 Ga0207705_10382139 3300025909 Bacteria 1088
114 Ga0207684_11663964 3300025910 Bacteria 515
115 Ga0207707_10001611 3300025912 Bacteria 20789
116 Ga0207707_10065229 3300025912 Bacteria 3171
117 Ga0207707_10953902 3300025912 Bacteria 706
118 Ga0207695_10174018 3300025913 Bacteria 2076
119 Ga0207671_10320891 3300025914 Bacteria 1226
120 Ga0207693_10046859 3300025915 Bacteria 3396
121 Ga0207663_10306052 3300025916 Bacteria 1189
122 Ga0207660_10055664 3300025917 Bacteria 2828
123 Ga0207660_10105060 3300025917 Bacteria 2116
124 Ga0207660_10395588 3300025917 Bacteria 1112
125 Ga0207660_10954761 3300025917 Bacteria 699
126 Ga0207662_10034425 3300025918 Bacteria 2956
127 Ga0207657_10000394 3300025919 Bacteria 46090
128 Ga0207652_10019804 3300025921 Bacteria 5539
129 Ga0207652_10401156 3300025921 Bacteria 1237
130 Ga0207646_11282359 3300025922 Bacteria 640
131 Ga0207650_10458662 3300025925 Bacteria 1061
132 Ga0207687_10373439 3300025927 Bacteria 1167
133 Ga0207700_10000074 3300025928 Bacteria 61772
134 Ga0207700_10154157 3300025928 Bacteria 1902
135 Ga0207664_10033557 3300025929 Bacteria 3944
136 Ga0207644_10187662 3300025931 Bacteria 1624
137 Ga0207690_10020357 3300025932 Bacteria 4098
138 Ga0207706_10250531 3300025933 Bacteria 1547
139 Ga0207709_11048090 3300025935 Bacteria 668
140 Ga0207670_10250179 3300025936 Bacteria 1369
141 Ga0207669_11320662 3300025937 Bacteria 613
142 Ga0207665_10008554 3300025939 Bacteria 6736
143 Ga0207691_10050061 3300025940 Bacteria 3826
144 Ga0207689_10041656 3300025942 Bacteria 3800
145 Ga0207689_10142721 3300025942 Bacteria 1973
146 Ga0207679_10169410 3300025945 Bacteria 1796
147 Ga0207667_10017537 3300025949 Bacteria 8053
148 Ga0207640_10412302 3300025981 Bacteria 1103
149 Ga0207639_10906091 3300026041 Bacteria 824
150 Ga0207678_10384271 3300026067 Bacteria 1214
151 Ga0207678_10521522 3300026067 Bacteria 1037
152 Ga0207708_10186475 3300026075 Bacteria 1649
153 Ga0207702_10131439 3300026078 Bacteria 2253
154 Ga0207641_10965855 3300026088 Bacteria 848
155 Ga0207648_10033988 3300026089 Bacteria 4496
156 Ga0207676_10108818 3300026095 Bacteria 2315
157 Ga0207674_10062797 3300026116 Bacteria 3751
158 Ga0207675_100316247 3300026118 Bacteria 1523
159 Ga0207698_12267247 3300026142 Unclassified 555
160 Ga0209967_1004452 3300027364 Bacteria 1862
161 Ga0209981_1001315 3300027378 Bacteria 3147
162 Ga0209981_1029084 3300027378 Bacteria 808
163 Ga0209996_1003190 3300027395 Bacteria 2053
164 Ga0209996_1022685 3300027395 Bacteria 889
165 Ga0210000_1000649 3300027462 Bacteria 4801
166 Ga0209995_1005623 3300027471 Bacteria 2014
167 Ga0209999_1000570 3300027543 Bacteria 5806
168 Ga0209999_1004192 3300027543 Bacteria 2596
169 Ga0209970_1015792 3300027614 Bacteria 1258
170 Ga0209588_1022932 3300027671 Bacteria 1965
171 Ga0209971_1006629 3300027682 Bacteria 2741
172 Ga0209966_1004388 3300027695 Bacteria 2389
173 Ga0209974_10036951 3300027876 Bacteria 1622
174 Ga0268264_11036337 3300028381 Bacteria 828
175 Ga0307408_100341019 3300031548 Bacteria 1268
176 Ga0307408_100366711 3300031548 Bacteria 1227
177 Ga0307405_10103593 3300031731 Bacteria 1914
178 Ga0307405_10733552 3300031731 Bacteria 821
179 Ga0307405_11268541 3300031731 Bacteria 640
180 Ga0307410_10385702 3300031852 Bacteria 1128
181 Ga0307407_10144012 3300031903 Bacteria 1541
182 Ga0307407_10414774 3300031903 Bacteria 969
183 Ga0307412_10169770 3300031911 Bacteria 1630
184 Ga0307412_11325220 3300031911 Bacteria 649
185 Ga0307409_100449614 3300031995 Bacteria 1243
186 Ga0307409_100501518 3300031995 Bacteria 1182
187 Ga0307409_101055016 3300031995 Bacteria 833
188 Ga0307416_100040483 3300032002 Bacteria 3621
189 Ga0307416_101339404 3300032002 Bacteria 822
190 Ga0307416_101406158 3300032002 Bacteria 803
191 Ga0307416_101407331 3300032002 Bacteria 803
192 Ga0307414_10208303 3300032004 Bacteria 1596
193 Ga0307411_10125658 3300032005 Bacteria 1865
194 Ga0307411_10273660 3300032005 Bacteria 1340
195 Ga0307415_100122486 3300032126 Bacteria 1953
196 Ga0307415_100815655 3300032126 Bacteria 853
197 Ga0373934_0068651 3300035086 Bacteria 1416
198 Ga0373934_0103710 3300035086 Bacteria 1150
199 Ga0373944_0051166 3300035089 Bacteria 1302
200 Ga0373949_0188566 3300035090 Bacteria 614
201 Ga0373936_0068403 3300035113 Bacteria 1460
202 Ga0373936_0091060 3300035113 Bacteria 1279
203 Ga0373939_0087975 3300035114 Bacteria 1045
204 Ga0373939_0302144 3300035114 Bacteria 638
205 Ga0373941_0059927 3300035115 Bacteria 1236
206 Ga0373945_0156176 3300035116 Bacteria 927
207 Ga0373954_0000034 3300035118 Bacteria 52216
208 Ga0373954_0080782 3300035118 Bacteria 1553
209 Ga0373956_0079244 3300035119 Bacteria 1505
210 Ga0373957_0105899 3300035120 Bacteria 1129
211 Ga0373960_0083405 3300035121 Bacteria 1011
212 Ga0373955_0121547 3300035172 Bacteria 1518
213 Ga0373955_0256976 3300035172 Bacteria 1048
214 Ga0373942_0177117 3300035207 Bacteria 697
215 Ga0373961_0088770 3300035241 Bacteria 984
216 Ga0316574_0004626 3300035398 Bacteria 7241
217 Ga0373924_0007989 3300035410 Bacteria 3830
218 Ga0373924_0015583 3300035410 Bacteria 2891
219 Ga0373924_0188931 3300035410 Bacteria 907
220 Ga0373935_0123406 3300035692 Bacteria 1733
221 Ga0373935_0255461 3300035692 Bacteria 1227
222 Ga0373927_0231642 3300035695 Bacteria 1214
223 Ga0373933_0003835 3300035724 Bacteria 8308
224 Ga0373933_0039444 3300035724 Bacteria 2779
225 Ga0373933_0043299 3300035724 Bacteria 2663
226 Ga0373933_0121572 3300035724 Bacteria 1635
227 Ga0373947_0184244 3300035725 Bacteria 1360
228 Ga0373947_0226358 3300035725 Bacteria 1231
229 Ga0373937_0000166 3300036401 Bacteria 63970
230 Ga0373937_0002871 3300036401 Bacteria 14389
231 Ga0373937_0036349 3300036401 Bacteria 4488
232 Ga0373937_0086030 3300036401 Bacteria 2909
233 Ga0373937_1335488 3300036401 Bacteria 665
234 Ga0373925_0010652 3300037068 Bacteria 6668
235 Ga0373925_0029268 3300037068 Bacteria 4040
236 Ga0373925_1178711 3300037068 Bacteria 630
237 Ga0451798_0260565 3300041458 Bacteria 637
238 Ga0451800_0807528 3300041459 Bacteria 720
239 Ga0451804_0126433 3300041463 Bacteria 678
240 Ga0451807_0107223 3300041486 Bacteria 4573
241 Ga0451835_0661577 3300041492 Bacteria 1307
242 Ga0451853_0531901 3300041512 Bacteria 2159
243 Ga0439441_018553 3300042001 Bacteria 1259
244 Ga0439434_0045830 3300042435 Bacteria 1349
245 Ga0451577_0310418 3300042876 Bacteria 1429
246 Ga0453684_0462626 3300044712 Bacteria 1410
247 Ga0451576_0130102 3300045051 Bacteria 2624
248 Ga0451576_0645128 3300045051 Bacteria 1112
249 Ga0451576_1012204 3300045051 Bacteria 871
250 Ga0451576_1166747 3300045051 Bacteria 805
251 Ga0466967_0990184 3300045976 Bacteria 837
252 Ga0495592_0009933 3300046454 Bacteria 7166
253 Ga0495592_0410447 3300046454 Unclassified 856
254 Ga0495603_0772287 3300046455 Bacteria 548
255 Ga0495603_0821667 3300046455 Bacteria 530
256 Ga0495629_0071095 3300046459 Bacteria 2428
257 Ga0495651_0078856 3300046462 Bacteria 2491
258 Ga0495651_0263316 3300046462 Bacteria 1172
259 Ga0495653_0539116 3300046463 Bacteria 723
260 Ga0495580_0343765 3300046472 Bacteria 1011
261 Ga0495582_0010801 3300046473 Bacteria 5026
262 Ga0495582_0161505 3300046473 Bacteria 1274
263 Ga0495639_0007255 3300046475 Bacteria 4758
264 Ga0495662_0018949 3300046476 Bacteria 3331
265 Ga0495662_0026944 3300046476 Bacteria 2776
266 Ga0495662_0152646 3300046476 Bacteria 1137
267 Ga0495664_0090477 3300046477 Bacteria 1840
268 Ga0495664_0125823 3300046477 Bacteria 1551
269 Ga0495608_0001125 3300046511 Bacteria 18924
270 Ga0495628_0000532 3300046516 Bacteria 34861
271 Ga0495628_1070579 3300046516 Bacteria 552
272 Ga0495630_0010316 3300046517 Bacteria 6742
273 Ga0495630_0068216 3300046517 Bacteria 2674
274 Ga0495630_0068724 3300046517 Bacteria 2665
275 Ga0495666_0003228 3300046526 Bacteria 8213
276 Ga0495652_0037076 3300046529 Bacteria 4233
277 Ga0495652_0051229 3300046529 Bacteria 3527
278 Ga0495652_0786567 3300046529 Bacteria 634
279 Ga0495665_0013106 3300046531 Bacteria 4488
280 Ga0495640_0001145 3300046533 Bacteria 20719
281 Ga0495640_0078937 3300046533 Bacteria 2192
282 Ga0495640_0432034 3300046533 Bacteria 806
283 Ga0495586_0000593 3300046535 Bacteria 21002
284 Ga0495598_0452115 3300046537 Bacteria 509
285 Ga0495621_0344449 3300046539 Bacteria 624
286 Ga0495667_0024441 3300046559 Bacteria 4068
287 Ga0495667_0083367 3300046559 Bacteria 2076
288 Ga0495668_0827728 3300046616 Bacteria 513
289 Ga0495634_0010374 3300046642 Bacteria 6826
290 Ga0495634_0071595 3300046642 Bacteria 2282
291 Ga0495635_0144082 3300046663 Bacteria 1622
292 Ga0495635_0284969 3300046663 Bacteria 1109
293 Ga0495635_0319745 3300046663 Bacteria 1039
294 Ga0495635_0365078 3300046663 Bacteria 962
295 Ga0495599_0150526 3300046678 Bacteria 1441
296 Ga0495599_0400779 3300046678 Bacteria 817
297 Ga0495623_0536442 3300046679 Bacteria 614
298 Ga0495646_0516448 3300046680 Bacteria 612
299 Ga0495647_0100811 3300046681 Bacteria 1195
300 Ga0495647_0166461 3300046681 Bacteria 953
301 Ga0495658_0058984 3300046683 Bacteria 2196
302 Ga0495669_0175154 3300046684 Bacteria 1021
303 Ga0495613_0027799 3300046689 Bacteria 4209
304 Ga0495613_0191143 3300046689 Bacteria 1446
305 Ga0495600_0003987 3300046809 Bacteria 8775
306 Ga0495581_0008291 3300047315 Bacteria 6023
307 Ga0495581_0101338 3300047315 Bacteria 1673
308 Ga0495604_0003261 3300047317 Bacteria 12967
309 Ga0495604_0609111 3300047317 Bacteria 700
310 Ga0495636_0016308 3300047318 Bacteria 2966
311 Ga0495674_0169804 3300047319 Bacteria 1821
312 Ga0495674_0187263 3300047319 Bacteria 1722
313 Ga0495674_0575312 3300047319 Bacteria 894
314 Ga0495674_0825450 3300047319 Bacteria 720
315 Ga0495680_0001364 3300047322 Bacteria 26513
316 Ga0495680_0085522 3300047322 Bacteria 2374
317 Ga0495675_0708996 3300047444 Bacteria 563
318 Ga0495684_0153697 3300047471 Bacteria 1719
319 Ga0495684_0526258 3300047471 Bacteria 809
320 Ga0495593_0045527 3300047673 Bacteria 2341
321 Ga0495593_0203436 3300047673 Bacteria 995
322 Ga0495614_0064837 3300048089 Bacteria 1571
323 Ga0496102_0048002 3300048905 Bacteria 3881
324 Ga0496103_0276639 3300048906 Bacteria 1080
325 Ga0496106_0151058 3300048909 Bacteria 1832
326 Ga0496106_1534069 3300048909 Bacteria 512
327 Ga0496112_0280384 3300048915 Bacteria 1614
328 Ga0501031_0346378 3300049568 Bacteria 962
329 Ga0501031_0898094 3300049568 Bacteria 567
330 Ga0501033_0114161 3300049570 Bacteria 1964
331 Ga0501036_0278474 3300049572 Bacteria 1400
332 Ga0501036_0701348 3300049572 Bacteria 836
333 Ga0501037_0399370 3300049573 Bacteria 943
334 Ga0501038_0006885 3300049574 Bacteria 10501
335 Ga0501038_0737756 3300049574 Bacteria 735
336 Ga0501039_0233160 3300049575 Bacteria 1447
337 Ga0501040_0002650 3300049576 Bacteria 11542
338 Ga0501040_0025121 3300049576 Bacteria 4003
339 Ga0501040_1119446 3300049576 Bacteria 571
340 Ga0501040_1192793 3300049576 Bacteria 552
341 Ga0501041_0008774 3300049577 Bacteria 5949
342 Ga0501042_0131737 3300049578 Bacteria 1802
343 Ga0501042_0171304 3300049578 Bacteria 1566
344 Ga0501042_0736209 3300049578 Bacteria 717
345 Ga0501046_0491640 3300049580 Bacteria 879
346 Ga0501046_0565548 3300049580 Bacteria 809
347 Ga0501046_0604264 3300049580 Bacteria 778
348 Ga0501048_0021146 3300049582 Bacteria 4765
349 Ga0501048_0720556 3300049582 Bacteria 716
350 Ga0501048_0793143 3300049582 Bacteria 680
351 Ga0501068_0008356 3300049584 Bacteria 5757
352 Ga0501070_0816995 3300049586 Bacteria 731
353 Ga0501071_0132572 3300049587 Bacteria 1852
354 Ga0501071_0134115 3300049587 Bacteria 1841
355 Ga0501071_0209840 3300049587 Bacteria 1464
356 Ga0501072_0003229 3300049588 Bacteria 12234
357 Ga0501072_1173510 3300049588 Bacteria 597
358 Ga0501073_0580789 3300049589 Bacteria 774
359 Ga0501075_0011507 3300049591 Bacteria 6263
360 Ga0501076_0001233 3300049592 Bacteria 17022
361 Ga0501076_1067782 3300049592 Bacteria 665
362 Ga0501077_0035284 3300049593 Bacteria 3184
363 Ga0501216_026669 3300049660 Bacteria 1044
364 Ga0501217_097969 3300049661 Bacteria 830
365 Ga0501079_0056086 3300049741 Bacteria 3040
366 Ga0501079_1323076 3300049741 Bacteria 567
367 Ga0501080_0025989 3300049742 Bacteria 5440
368 Ga0501035_0188178 3300049822 Bacteria 1776
369 Ga0501035_0747041 3300049822 Bacteria 785
370 Ga0501045_0013679 3300049824 Bacteria 5736
371 Ga0501045_0198161 3300049824 Bacteria 1496
372 Ga0501045_0288580 3300049824 Bacteria 1221
373 nmdc:mga05p37_305667_c1 3300050507 Bacteria 1887
374 nmdc:mga05p37_7607_c1 3300050507 Bacteria 12783
375 nmdc:mga09592_23945_c1 3300050508 Bacteria 5047
376 nmdc:mga09592_394317_c1 3300050508 Bacteria 1197
377 nmdc:mga09592_628963_c1 3300050508 Bacteria 918
378 nmdc:mga0qj67_217447_c1 3300050509 Bacteria 1551
379 nmdc:mga0qj67_227217_c1 3300050509 Bacteria 1515
380 nmdc:mga06r32_1113371_c1 3300050510 Bacteria 738
381 nmdc:mga06r32_908925_c1 3300050510 Bacteria 836
382 nmdc:mga08y16_20706_c1 3300050511 Bacteria 6942
383 nmdc:mga0n895_389093_c1 3300050512 Bacteria 1410
384 nmdc:mga0n895_434356_c1 3300050512 Bacteria 1326
385 nmdc:mga0n895_94129_c1 3300050512 Bacteria 2999
386 nmdc:mga0n895_9970_c1 3300050512 Bacteria 8358
387 nmdc:mga0rr50_1087044_c1 3300050513 Bacteria 680
388 nmdc:mga0rr50_379642_c1 3300050513 Bacteria 1191
389 nmdc:mga0rr50_65322_c1 3300050513 Bacteria 2756
390 nmdc:mga08x19_16649_c1 3300050514 Bacteria 4486
391 nmdc:mga08x19_54771_c1 3300050514 Bacteria 2568
392 nmdc:mga0a205_967935_c1 3300050515 Bacteria 698
393 Ga0495601_0005687 3300053077 Bacteria 7266
394 Ga0495601_0390721 3300053077 Bacteria 902
395 Ga0495601_0588000 3300053077 Bacteria 715
396 Ga0495612_0249230 3300053078 Bacteria 790
397 Ga0495619_0013973 3300053085 Bacteria 5066
398 Ga0495619_0486587 3300053085 Bacteria 849
399 Ga0500651_0002945 3300053093 Bacteria 9163
400 Ga0500566_0131829 3300053094 Bacteria 1336
401 Ga0500566_0389781 3300053094 Bacteria 627
402 Ga0501084_0716652 3300054114 Bacteria 843
403 Ga0501084_0719443 3300054114 Bacteria 842
404 Ga0501082_0017450 3300060353 Bacteria 6184
405 Ga0530510_0000309 3300061734 Bacteria 31225
406 Ga0501245_042288
407 Ga0065712_10474983
408 Ga0070676_10002450
409 Ga0070676_10238905
410 Ga0070683_100233790
411 Ga0070670_100474270
412 Ga0068869_100079613
413 Ga0068869_100143863
414 Ga0070666_10288239
415 Ga0070680_100026703
416 Ga0070680_100327417
417 Ga0070680_100493235
418 Ga0070680_100555054
419 Ga0070682_100535556
420 Ga0068868_100071380
421 Ga0070660_100081514
422 Ga0070689_100057745
423 Ga0070689_100959849
424 Ga0070691_10116339
425 Ga0070691_10120672
426 Ga0070687_100419924
427 Ga0070661_100070972
428 Ga0070692_10003541
429 Ga0070668_101047429
430 Ga0070675_101372032
431 Ga0070671_100037504
432 Ga0070674_100020884
433 Ga0070674_101464554
434 Ga0070688_100036738
435 Ga0070659_100016898
436 Ga0070667_100200987
437 Ga0070709_10034047
438 Ga0070714_100239771
439 Ga0070714_101485716
440 Ga0070713_100002210
441 Ga0070710_10070463
442 Ga0070710_10721800
443 Ga0070701_10424269
444 Ga0070705_100009463
445 Ga0070705_100089730
446 Ga0070700_100674309
447 Ga0070694_100012921
448 Ga0070694_100204495
449 Ga0070694_100307004
450 Ga0070694_100460536
451 Ga0070708_100027478
452 Ga0070663_100613781
453 Ga0070678_100019530
454 Ga0070678_101067354
455 Ga0070662_101402348
456 Ga0070681_10008283
457 Ga0070681_10011034
458 Ga0068867_100087456
459 Ga0070706_100159105
460 Ga0070707_100441347
461 Ga0070699_100006155
462 Ga0070679_100180884
463 Ga0070684_100065112
464 Ga0068853_100138015
465 Ga0070695_100079337
466 Ga0070695_100216180
467 Ga0070696_100033133
468 Ga0070696_100100865
469 Ga0070696_100294144
470 Ga0070693_100045745
471 Ga0070693_100149426
472 Ga0070693_100291330
473 Ga0070704_100483523
474 Ga0068855_100943178
475 Ga0070664_100067776
476 Ga0068854_100251082
477 Ga0068854_100518835
478 Ga0070702_101170272
479 Ga0070702_101366768
480 Ga0070702_101372485
481 Ga0068864_100189094
482 Ga0068861_100249648
483 Ga0068851_10047506
484 Ga0070715_10127490
485 Ga0070716_100017483
486 Ga0070712_100475199
487 Ga0068871_101285518
488 Ga0075428_100005614
489 Ga0075430_100003637
490 Ga0075431_100014320
491 Ga0075431_101122173
492 Ga0075429_100031445
493 Ga0068865_100618021
494 Ga0075436_100095599
495 Ga0075435_100038152
496 Ga0099794_10019327
497 Ga0105240_10033359
498 Ga0111539_10022575
499 Ga0105245_10785416
500 Ga0114129_10013192
501 Ga0114129_11443703
502 Ga0105241_10116499
503 Ga0105241_10889571
504 Ga0105248_10362384
505 Ga0105248_13406908
506 Ga0105237_10546054
507 Ga0105239_10688130
508 Ga0157373_10334353
509 Ga0157371_10458310
510 Ga0157370_10063590
511 Ga0157369_11085281
512 Ga0157378_10039667
513 Ga0157378_11476121
514 Ga0157377_10404731
515 Ga0207692_10143139
516 Ga0207699_10664642
517 Ga0207645_10003152
518 Ga0207705_10382139
519 Ga0207684_11663964
520 Ga0207707_10001611
521 Ga0207707_10065229
522 Ga0207707_10953902
523 Ga0207695_10174018
524 Ga0207671_10320891
525 Ga0207693_10046859
526 Ga0207663_10306052
527 Ga0207660_10055664
528 Ga0207660_10105060
529 Ga0207660_10395588
530 Ga0207660_10954761
531 Ga0207662_10034425
532 Ga0207657_10000394
533 Ga0207652_10019804
534 Ga0207652_10401156
535 Ga0207646_11282359
536 Ga0207650_10458662
537 Ga0207687_10373439
538 Ga0207700_10000074
539 Ga0207700_10154157
540 Ga0207664_10033557
541 Ga0207644_10187662
542 Ga0207690_10020357
543 Ga0207706_10250531
544 Ga0207709_11048090
545 Ga0207670_10250179
546 Ga0207669_11320662
547 Ga0207665_10008554
548 Ga0207691_10050061
549 Ga0207689_10041656
550 Ga0207689_10142721
551 Ga0207679_10169410
552 Ga0207667_10017537
553 Ga0207640_10412302
554 Ga0207639_10906091
555 Ga0207678_10384271
556 Ga0207678_10521522
557 Ga0207708_10186475
558 Ga0207702_10131439
559 Ga0207641_10965855
560 Ga0207648_10033988
561 Ga0207676_10108818
562 Ga0207674_10062797
563 Ga0207675_100316247
564 Ga0207698_12267247
565 Ga0209967_1004452
566 Ga0209981_1001315
567 Ga0209981_1029084
568 Ga0209996_1003190
569 Ga0209996_1022685
570 Ga0210000_1000649
571 Ga0209995_1005623
572 Ga0209999_1000570
573 Ga0209999_1004192
574 Ga0209970_1015792
575 Ga0209588_1022932
576 Ga0209971_1006629
577 Ga0209966_1004388
578 Ga0209974_10036951
579 Ga0268264_11036337
580 Ga0307408_100341019
581 Ga0307408_100366711
582 Ga0307405_10103593
583 Ga0307405_10733552
584 Ga0307405_11268541
585 Ga0307410_10385702
586 Ga0307407_10144012
587 Ga0307407_10414774
588 Ga0307412_10169770
589 Ga0307412_11325220
590 Ga0307409_100449614
591 Ga0307409_100501518
592 Ga0307409_101055016
593 Ga0307416_100040483
594 Ga0307416_101339404
595 Ga0307416_101406158
596 Ga0307416_101407331
597 Ga0307414_10208303
598 Ga0307411_10125658
599 Ga0307411_10273660
600 Ga0307415_100122486
601 Ga0307415_100815655
602 Ga0373934_0068651
603 Ga0373934_0103710
604 Ga0373944_0051166
605 Ga0373949_0188566
606 Ga0373936_0068403
607 Ga0373936_0091060
608 Ga0373939_0087975
609 Ga0373939_0302144
610 Ga0373941_0059927
611 Ga0373945_0156176
612 Ga0373954_0000034
613 Ga0373954_0080782
614 Ga0373956_0079244
615 Ga0373957_0105899
616 Ga0373960_0083405
617 Ga0373955_0121547
618 Ga0373955_0256976
619 Ga0373942_0177117
620 Ga0373961_0088770
621 Ga0316574_0004626
622 Ga0373924_0007989
623 Ga0373924_0015583
624 Ga0373924_0188931
625 Ga0373935_0123406
626 Ga0373935_0255461
627 Ga0373927_0231642
628 Ga0373933_0003835
629 Ga0373933_0039444
630 Ga0373933_0043299
631 Ga0373933_0121572
632 Ga0373947_0184244
633 Ga0373947_0226358
634 Ga0373937_0000166
635 Ga0373937_0002871
636 Ga0373937_0036349
637 Ga0373937_0086030
638 Ga0373937_1335488
639 Ga0373925_0010652
640 Ga0373925_0029268
641 Ga0373925_1178711
642 Ga0451798_0260565
643 Ga0451800_0807528
644 Ga0451804_0126433
645 Ga0451807_0107223
646 Ga0451835_0661577
647 Ga0451853_0531901
648 Ga0439441_018553
649 Ga0439434_0045830
650 Ga0451577_0310418
651 Ga0453684_0462626
652 Ga0451576_0130102
653 Ga0451576_0645128
654 Ga0451576_1012204
655 Ga0451576_1166747
656 Ga0466967_0990184
657 Ga0495592_0009933
658 Ga0495592_0410447
659 Ga0495603_0772287
660 Ga0495603_0821667
661 Ga0495629_0071095
662 Ga0495651_0078856
663 Ga0495651_0263316
664 Ga0495653_0539116
665 Ga0495580_0343765
666 Ga0495582_0010801
667 Ga0495582_0161505
668 Ga0495639_0007255
669 Ga0495662_0018949
670 Ga0495662_0026944
671 Ga0495662_0152646
672 Ga0495664_0090477
673 Ga0495664_0125823
674 Ga0495608_0001125
675 Ga0495628_0000532
676 Ga0495628_1070579
677 Ga0495630_0010316
678 Ga0495630_0068216
679 Ga0495630_0068724
680 Ga0495666_0003228
681 Ga0495652_0037076
682 Ga0495652_0051229
683 Ga0495652_0786567
684 Ga0495665_0013106
685 Ga0495640_0001145
686 Ga0495640_0078937
687 Ga0495640_0432034
688 Ga0495586_0000593
689 Ga0495598_0452115
690 Ga0495621_0344449
691 Ga0495667_0024441
692 Ga0495667_0083367
693 Ga0495668_0827728
694 Ga0495634_0010374
695 Ga0495634_0071595
696 Ga0495635_0144082
697 Ga0495635_0284969
698 Ga0495635_0319745
699 Ga0495635_0365078
700 Ga0495599_0150526
701 Ga0495599_0400779
702 Ga0495623_0536442
703 Ga0495646_0516448
704 Ga0495647_0100811
705 Ga0495647_0166461
706 Ga0495658_0058984
707 Ga0495669_0175154
708 Ga0495613_0027799
709 Ga0495613_0191143
710 Ga0495600_0003987
711 Ga0495581_0008291
712 Ga0495581_0101338
713 Ga0495604_0003261
714 Ga0495604_0609111
715 Ga0495636_0016308
716 Ga0495674_0169804
717 Ga0495674_0187263
718 Ga0495674_0575312
719 Ga0495674_0825450
720 Ga0495680_0001364
721 Ga0495680_0085522
722 Ga0495675_0708996
723 Ga0495684_0153697
724 Ga0495684_0526258
725 Ga0495593_0045527
726 Ga0495593_0203436
727 Ga0495614_0064837
728 Ga0496102_0048002
729 Ga0496103_0276639
730 Ga0496106_0151058
731 Ga0496106_1534069
732 Ga0496112_0280384
733 Ga0501031_0346378
734 Ga0501031_0898094
735 Ga0501033_0114161
736 Ga0501036_0278474
737 Ga0501036_0701348
738 Ga0501037_0399370
739 Ga0501038_0006885
740 Ga0501038_0737756
741 Ga0501039_0233160
742 Ga0501040_0002650
743 Ga0501040_0025121
744 Ga0501040_1119446
745 Ga0501040_1192793
746 Ga0501041_0008774
747 Ga0501042_0131737
748 Ga0501042_0171304
749 Ga0501042_0736209
750 Ga0501046_0491640
751 Ga0501046_0565548
752 Ga0501046_0604264
753 Ga0501048_0021146
754 Ga0501048_0720556
755 Ga0501048_0793143
756 Ga0501068_0008356
757 Ga0501070_0816995
758 Ga0501071_0132572
759 Ga0501071_0134115
760 Ga0501071_0209840
761 Ga0501072_0003229
762 Ga0501072_1173510
763 Ga0501073_0580789
764 Ga0501075_0011507
765 Ga0501076_0001233
766 Ga0501076_1067782
767 Ga0501077_0035284
768 Ga0501216_026669
769 Ga0501217_097969
770 Ga0501079_0056086
771 Ga0501079_1323076
772 Ga0501080_0025989
773 Ga0501035_0188178
774 Ga0501035_0747041
775 Ga0501045_0013679
776 Ga0501045_0198161
777 Ga0501045_0288580
778 nmdc:mga05p37_305667_c1
779 nmdc:mga05p37_7607_c1
780 nmdc:mga09592_23945_c1
781 nmdc:mga09592_394317_c1
782 nmdc:mga09592_628963_c1
783 nmdc:mga0qj67_217447_c1
784 nmdc:mga0qj67_227217_c1
785 nmdc:mga06r32_1113371_c1
786 nmdc:mga06r32_908925_c1
787 nmdc:mga08y16_20706_c1
788 nmdc:mga0n895_389093_c1
789 nmdc:mga0n895_434356_c1
790 nmdc:mga0n895_94129_c1
791 nmdc:mga0n895_9970_c1
792 nmdc:mga0rr50_1087044_c1
793 nmdc:mga0rr50_379642_c1
794 nmdc:mga0rr50_65322_c1
795 nmdc:mga08x19_16649_c1
796 nmdc:mga08x19_54771_c1
797 nmdc:mga0a205_967935_c1
798 Ga0495601_0005687
799 Ga0495601_0390721
800 Ga0495601_0588000
801 Ga0495612_0249230
802 Ga0495619_0013973
803 Ga0495619_0486587
804 Ga0500651_0002945
805 Ga0500566_0131829
806 Ga0500566_0389781
807 Ga0501084_0716652
808 Ga0501084_0719443
809 Ga0501082_0017450
810 Ga0530510_0000309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13501

SoxY

Sulfur oxidation protein SoxY

53

160

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nnc-assembly1.cif.gz_A structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.905 46 152
2nnc-assembly1.cif.gz_A structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8745 46 152
4bk8-assembly1.cif.gz_A superoxide reductase (neelaredoxin) from ignicoccus hospitalis 0.8631 65 151
2nnc-assembly1.cif.gz_B structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8439 36 150
2nnc-assembly1.cif.gz_B structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8371 36 150
ID Description Score Start End Superfamily
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.905 46 152 2.60.40.2470
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8745 46 152 2.60.40.2470
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8348 46 154 2.60.40.2470
2ox5B00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8208 46 154 2.60.40.2470
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8075 65 151 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7Y3IVM2-F1-model_v4 Ig-like SoxY domain-containing protein 0.9548 41 154
AF-A0A351BME0-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.9442 40 155
AF-A0A537D0A5-F1-model_v4 Thiosulfate oxidation carrier protein SoxY 0.9286 42 157
AF-A0A2W5DFV7-F1-model_v4 Ig-like SoxY domain-containing protein 0.9273 40 157
AF-A0A7C5WMB5-F1-model_v4 Ig-like SoxY domain-containing protein 0.9248 44 151

Map