F436023

General Info

Members Datasets Scaffolds Average Seq Length
405 231 810 255

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0241182|Ga0466958_0241182_293_1054
Length 245
Sequence MSEKWFPTMPEFSSPEEERLHRKQRLAAGFRLFAKFGFEEGVAGHITARDPIEPDTFWVNPFVVPFAHIKTSDLIRVNHTGDVVEGNYHVNTAAFAIHSQVHAARPDVVAAAHSHSTYGRALPITQDVCAFYDDHALFDDYTGVVTDVEEGKRIAHALGDNKALILRNHGLLTVGHTVDAAVFWFITMERSCQVQLAAKAAGEVVHIDADQAAKTHDQVGTEFVGWLAFQPLWAKITREQPDLLD

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
133 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
138 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 2849139964 Bacillus sp. R-71875 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 2.72
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0
Rhizoplane 2.22
Rhizosphere 92.1
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0241182 3300045836 Bacteria 1155
2 JGI25407J50210_10012965 3300003373 Bacteria 2140
3 JGI25407J50210_10017799 3300003373 Unclassified 1846
4 Ga0070658_10001032 3300005327 Bacteria 23831
5 Ga0070680_100194655 3300005336 Bacteria 1709
6 Ga0070660_100079675 3300005339 Bacteria 2570
7 Ga0070692_10013269 3300005345 Bacteria 3837
8 Ga0070669_100001133 3300005353 Bacteria 19452
9 Ga0070671_100179314 3300005355 Bacteria 1793
10 Ga0070659_100002183 3300005366 Bacteria 13926
11 Ga0070667_100000022 3300005367 Bacteria 204861
12 Ga0070667_100335724 3300005367 Bacteria 1366
13 Ga0070709_10024821 3300005434 Bacteria 3534
14 Ga0070714_100035080 3300005435 Bacteria 4203
15 Ga0070714_100130294 3300005435 Bacteria 2247
16 Ga0070713_100121223 3300005436 Bacteria 2294
17 Ga0070705_100007233 3300005440 Bacteria 5457
18 Ga0070694_100047663 3300005444 Bacteria 2881
19 Ga0070708_100113495 3300005445 Bacteria 2492
20 Ga0070678_100464687 3300005456 Bacteria 1111
21 Ga0070681_10000019 3300005458 Bacteria 124774
22 Ga0070681_10008548 3300005458 Bacteria 10028
23 Ga0070681_10015395 3300005458 Bacteria 7612
24 Ga0070681_10070741 3300005458 Bacteria 3454
25 Ga0070681_10386581 3300005458 Bacteria 1310
26 Ga0070706_100136260 3300005467 Bacteria 2292
27 Ga0070706_100169533 3300005467 Bacteria 2038
28 Ga0070707_100103188 3300005468 Bacteria 2763
29 Ga0070707_100377845 3300005468 Unclassified 1376
30 Ga0070698_100412784 3300005471 Bacteria 1284
31 Ga0070679_100001348 3300005530 Bacteria 21679
32 Ga0070679_100065701 3300005530 Bacteria 3616
33 Ga0070679_100271570 3300005530 Bacteria 1649
34 Ga0070684_100020531 3300005535 Bacteria 5480
35 Ga0070684_100033459 3300005535 Bacteria 4389
36 Ga0070697_100032659 3300005536 Bacteria 4190
37 Ga0070697_100121336 3300005536 Bacteria 2186
38 Ga0070697_100476424 3300005536 Bacteria 1090
39 Ga0070695_100015565 3300005545 Bacteria 4593
40 Ga0070665_100006159 3300005548 Bacteria 12269
41 Ga0070704_100056256 3300005549 Bacteria 2793
42 Ga0070704_100071530 3300005549 Bacteria 2520
43 Ga0068855_100146931 3300005563 Bacteria 2683
44 Ga0070664_100734796 3300005564 Bacteria 921
45 Ga0068859_100001056 3300005617 Bacteria 28169
46 Ga0068859_100113971 3300005617 Bacteria 2767
47 Ga0068864_100059998 3300005618 Bacteria 3293
48 Ga0068866_10077022 3300005718 Bacteria 1780
49 Ga0068863_100028280 3300005841 Bacteria 5353
50 Ga0068858_100009263 3300005842 Bacteria 9404
51 Ga0068858_100026390 3300005842 Bacteria 5398
52 Ga0068860_100000038 3300005843 Bacteria 232936
53 Ga0068860_100640387 3300005843 Bacteria 1070
54 Ga0068862_100000049 3300005844 Bacteria 149792
55 Ga0068862_100000064 3300005844 Bacteria 124473
56 Ga0081455_10004343 3300005937 Bacteria 15951
57 Ga0081455_10012557 3300005937 Bacteria 8448
58 Ga0081455_10043820 3300005937 Bacteria 3911
59 Ga0081455_10104332 3300005937 Bacteria 2268
60 Ga0081538_10000109 3300005981 Bacteria 82103
61 Ga0081538_10042234 3300005981 Bacteria 2880
62 Ga0081538_10067972 3300005981 Bacteria 1985
63 Ga0075365_10284796 3300006038 Bacteria 1163
64 Ga0075364_10005343 3300006051 Bacteria 7459
65 Ga0075362_10018644 3300006177 Bacteria 2875
66 Ga0075369_10093526 3300006186 Bacteria 1343
67 Ga0075428_100000500 3300006844 Bacteria 39777
68 Ga0075428_100006012 3300006844 Bacteria 13484
69 Ga0075428_100009360 3300006844 Bacteria 10868
70 Ga0075428_100033850 3300006844 Bacteria 5636
71 Ga0075428_100597352 3300006844 Bacteria 1179
72 Ga0075428_100771685 3300006844 Bacteria 1022
73 Ga0075428_100783538 3300006844 Bacteria 1014
74 Ga0075430_100002198 3300006846 Bacteria 16160
75 Ga0075430_100051482 3300006846 Bacteria 3470
76 Ga0075430_100066596 3300006846 Bacteria 3024
77 Ga0075430_100090563 3300006846 Bacteria 2558
78 Ga0075430_100217242 3300006846 Bacteria 1586
79 Ga0075431_100020222 3300006847 Bacteria 6800
80 Ga0075431_100035382 3300006847 Bacteria 5143
81 Ga0075431_100071264 3300006847 Bacteria 3586
82 Ga0075431_100139200 3300006847 Bacteria 2502
83 Ga0075431_100305870 3300006847 Bacteria 1605
84 Ga0075434_100043412 3300006871 Bacteria 4459
85 Ga0075429_100004769 3300006880 Bacteria 11675
86 Ga0075429_100052129 3300006880 Bacteria 3560
87 Ga0075436_100000868 3300006914 Bacteria 20095
88 Ga0075436_100040447 3300006914 Bacteria 3217
89 Ga0075436_100153961 3300006914 Bacteria 1619
90 Ga0075436_100240307 3300006914 Bacteria 1288
91 Ga0097620_100000287 3300006931 Bacteria 50179
92 Ga0097620_100001056 3300006931 Bacteria 28169
93 Ga0097620_100113975 3300006931 Bacteria 2767
94 Ga0075435_100225506 3300007076 Bacteria 1592
95 Ga0105250_10103229 3300009092 Bacteria 1164
96 Ga0111539_10004584 3300009094 Bacteria 18060
97 Ga0111539_10034409 3300009094 Bacteria 6143
98 Ga0111539_10175638 3300009094 Bacteria 2502
99 Ga0105247_10000021 3300009101 Bacteria 229443
100 Ga0114129_10009120 3300009147 Bacteria 14142
101 Ga0114129_10133579 3300009147 Bacteria 3407
102 Ga0114129_10136917 3300009147 Bacteria 3359
103 Ga0114129_10312318 3300009147 Bacteria 2092
104 Ga0114129_10401881 3300009147 Bacteria 1805
105 Ga0114129_10513934 3300009147 Bacteria 1562
106 Ga0114129_10726457 3300009147 Bacteria 1274
107 Ga0114129_10825141 3300009147 Bacteria 1181
108 Ga0105242_10093262 3300009176 Bacteria 2538
109 Ga0105248_10000141 3300009177 Bacteria 82929
110 Ga0105248_10041596 3300009177 Bacteria 5153
111 Ga0105237_10121433 3300009545 Bacteria 2607
112 Ga0105249_10000060 3300009553 Bacteria 153462
113 Ga0105249_10410454 3300009553 Bacteria 1386
114 Ga0099796_10013689 3300010159 Bacteria 2323
115 Ga0105239_10637881 3300010375 Bacteria 1216
116 Ga0157373_10215867 3300013100 Bacteria 1353
117 Ga0157371_10010508 3300013102 Bacteria 7198
118 Ga0157369_10104711 3300013105 Bacteria 3013
119 Ga0157369_10164578 3300013105 Bacteria 2340
120 Ga0157378_10039872 3300013297 Bacteria 4165
121 Ga0157372_10939712 3300013307 Bacteria 1002
122 Ga0163163_10020998 3300014325 Bacteria 6159
123 Ga0163163_10021192 3300014325 Bacteria 6130
124 Ga0163163_10078312 3300014325 Bacteria 3302
125 Ga0157380_10914413 3300014326 Bacteria 904
126 Ga0157379_10395623 3300014968 Bacteria 1269
127 Ga0197907_10054443 3300020069 Bacteria 2806
128 Ga0206356_10320441 3300020070 Bacteria 1491
129 Ga0206356_11555394 3300020070 Bacteria 1139
130 Ga0206349_1727302 3300020075 Bacteria 1303
131 Ga0206350_10254393 3300020080 Bacteria 970
132 Ga0206353_10952777 3300020082 Bacteria 1166
133 Ga0206353_11468371 3300020082 Bacteria 1211
134 Ga0206353_11779372 3300020082 Bacteria 930
135 Ga0154015_1263663 3300020610 Bacteria 1330
136 Ga0213873_10032907 3300021358 Bacteria 1298
137 Ga0213871_10012324 3300021441 Bacteria 1984
138 Ga0224712_10073238 3300022467 Bacteria 1397
139 Ga0224712_10082644 3300022467 Bacteria 1329
140 Ga0207692_10067154 3300025898 Bacteria 1877
141 Ga0207710_10000027 3300025900 Bacteria 307001
142 Ga0207699_10091629 3300025906 Bacteria 1909
143 Ga0207705_10000514 3300025909 Bacteria 33010
144 Ga0207684_10098607 3300025910 Bacteria 2496
145 Ga0207707_10000046 3300025912 Bacteria 119404
146 Ga0207707_10013135 3300025912 Bacteria 7216
147 Ga0207707_10053686 3300025912 Bacteria 3508
148 Ga0207707_10106928 3300025912 Bacteria 2446
149 Ga0207671_10059052 3300025914 Bacteria 2843
150 Ga0207693_10046600 3300025915 Bacteria 3406
151 Ga0207660_10002877 3300025917 Bacteria 11251
152 Ga0207660_10140231 3300025917 Bacteria 1848
153 Ga0207660_10196129 3300025917 Bacteria 1575
154 Ga0207657_10059939 3300025919 Bacteria 3268
155 Ga0207657_10313844 3300025919 Bacteria 1240
156 Ga0207652_10007855 3300025921 Bacteria 8564
157 Ga0207652_10078671 3300025921 Bacteria 2880
158 Ga0207652_10135959 3300025921 Bacteria 2195
159 Ga0207652_10534001 3300025921 Bacteria 1055
160 Ga0207646_10141995 3300025922 Bacteria 2163
161 Ga0207646_10611381 3300025922 Bacteria 978
162 Ga0207681_10001434 3300025923 Bacteria 15351
163 Ga0207700_10114626 3300025928 Bacteria 2175
164 Ga0207664_10003623 3300025929 Bacteria 10338
165 Ga0207664_10153693 3300025929 Bacteria 1957
166 Ga0207644_10142120 3300025931 Bacteria 1849
167 Ga0207690_10000089 3300025932 Bacteria 75740
168 Ga0207704_10258655 3300025938 Bacteria 1311
169 Ga0207711_10000311 3300025941 Bacteria 52029
170 Ga0207711_10106637 3300025941 Bacteria 2486
171 Ga0207689_10067979 3300025942 Bacteria 2928
172 Ga0207661_10063787 3300025944 Bacteria 2985
173 Ga0207661_10789608 3300025944 Bacteria 874
174 Ga0207667_10096460 3300025949 Bacteria 3052
175 Ga0207712_10000051 3300025961 Bacteria 153466
176 Ga0207712_10003259 3300025961 Bacteria 10297
177 Ga0207658_10000070 3300025986 Bacteria 113173
178 Ga0207703_10046572 3300026035 Bacteria 3492
179 Ga0207703_10180275 3300026035 Bacteria 1864
180 Ga0207703_10338042 3300026035 Bacteria 1383
181 Ga0207702_10922897 3300026078 Bacteria 865
182 Ga0207641_10022250 3300026088 Bacteria 5217
183 Ga0207676_10047382 3300026095 Bacteria 3331
184 Ga0207683_10080169 3300026121 Bacteria 2895
185 Ga0209588_1010934 3300027671 Bacteria 2735
186 Ga0209813_10141131 3300027866 Bacteria 855
187 Ga0207428_10027537 3300027907 Bacteria 4731
188 Ga0207428_10050287 3300027907 Bacteria 3336
189 Ga0207428_10342643 3300027907 Bacteria 1101
190 Ga0268266_10005067 3300028379 Bacteria 12429
191 Ga0268265_10000017 3300028380 Bacteria 293875
192 Ga0268265_10000028 3300028380 Bacteria 236467
193 Ga0268264_10000092 3300028381 Bacteria 232950
194 Ga0268264_10154537 3300028381 Bacteria 2061
195 Ga0268264_10232151 3300028381 Bacteria 1704
196 Ga0265327_10000171 3300031251 Bacteria 139992
197 Ga0373926_0009912 3300035083 Bacteria 3188
198 Ga0373934_0123868 3300035086 Bacteria 1052
199 Ga0373945_0058519 3300035116 Bacteria 1433
200 Ga0373935_0031242 3300035692 Bacteria 3304
201 Ga0373927_0000406 3300035695 Bacteria 33145
202 Ga0373947_0004885 3300035725 Bacteria 7844
203 Ga0373937_0633579 3300036401 Bacteria 1014
204 Ga0373925_0000820 3300037068 Bacteria 28603
205 Ga0373925_0584493 3300037068 Bacteria 919
206 Ga0395900_0066609 3300037418 Bacteria 3701
207 Ga0395898_0069727 3300037466 Bacteria 3401
208 Ga0395901_0394401 3300038443 Bacteria 1423
209 Ga0436365_0045799 3300039437 Bacteria 12688
210 Ga0436360_0843420 3300039438 Bacteria 2439
211 Ga0436363_1126501 3300039450 Bacteria 4111
212 Ga0436362_0153351 3300039453 Bacteria 1692
213 Ga0436362_1303522 3300039453 Bacteria 2704
214 Ga0451787_815825 3300041441 Bacteria 910
215 Ga0439448_0052680 3300042005 Bacteria 1334
216 Ga0439450_008303 3300042008 Bacteria 1934
217 Ga0439454_000922 3300042011 Bacteria 2603
218 Ga0439446_0067446 3300042156 Bacteria 1090
219 Ga0439434_0010210 3300042435 Bacteria 2767
220 Ga0439434_0096911 3300042435 Bacteria 947
221 Ga0439444_0026280 3300042437 Bacteria 1064
222 Ga0439464_0000279 3300042439 Bacteria 9594
223 Ga0439460_0005880 3300042461 Bacteria 3024
224 Ga0439440_0000974 3300042993 Bacteria 5039
225 Ga0466961_0224229 3300044693 Bacteria 1158
226 Ga0466964_0157370 3300044706 Bacteria 1059
227 Ga0466968_0015630 3300044735 Bacteria 3012
228 Ga0466970_0277126 3300044765 Bacteria 943
229 Ga0466959_0064538 3300045049 Bacteria 2659
230 Ga0466959_0075156 3300045049 Bacteria 2442
231 Ga0466958_0048833 3300045836 Bacteria 2559
232 Ga0466967_0182136 3300045976 Bacteria 1982
233 Ga0466967_0755754 3300045976 Bacteria 964
234 Ga0495629_0189918 3300046459 Bacteria 1422
235 Ga0495641_0029647 3300046461 Bacteria 2635
236 Ga0495641_0033913 3300046461 Bacteria 2418
237 Ga0495651_0042304 3300046462 Bacteria 3538
238 Ga0495580_0001960 3300046472 Bacteria 18074
239 Ga0495582_0000232 3300046473 Bacteria 30900
240 Ga0495582_0048863 3300046473 Bacteria 2330
241 Ga0495628_0048584 3300046516 Bacteria 3363
242 Ga0495630_0033703 3300046517 Bacteria 3820
243 Ga0495666_0172232 3300046526 Bacteria 1001
244 Ga0495665_0140517 3300046531 Bacteria 1262
245 Ga0495640_0032175 3300046533 Bacteria 3738
246 Ga0495640_0078193 3300046533 Bacteria 2204
247 Ga0495586_0039401 3300046535 Bacteria 2540
248 Ga0495667_0139706 3300046559 Bacteria 1561
249 Ga0495634_0036618 3300046642 Bacteria 3355
250 Ga0495658_0008617 3300046683 Bacteria 5060
251 Ga0495658_0019570 3300046683 Bacteria 3536
252 Ga0495613_0000311 3300046689 Bacteria 44152
253 Ga0495674_0181627 3300047319 Bacteria 1752
254 Ga0495676_0088196 3300047321 Bacteria 2328
255 Ga0495675_0053608 3300047444 Bacteria 2560
256 Ga0495684_0036856 3300047471 Bacteria 3749
257 Ga0495593_0005089 3300047673 Bacteria 7773
258 Ga0495602_0032181 3300048088 Bacteria 4943
259 Ga0496100_0011210 3300048903 Bacteria 5097
260 Ga0496101_0024966 3300048904 Bacteria 4142
261 Ga0496101_0267706 3300048904 Bacteria 1334
262 Ga0496102_0000833 3300048905 Bacteria 29589
263 Ga0496106_0383831 3300048909 Bacteria 1129
264 Ga0496108_0048768 3300048911 Bacteria 3541
265 Ga0496112_0102940 3300048915 Bacteria 2825
266 Ga0496115_0352591 3300048918 Bacteria 1200
267 Ga0496117_0001027 3300048920 Bacteria 42609
268 Ga0496118_0002605 3300048921 Bacteria 23971
269 Ga0496119_0004219 3300048922 Bacteria 14423
270 Ga0496120_0056289 3300048923 Bacteria 2220
271 Ga0496121_0009709 3300048924 Bacteria 11017
272 Ga0496124_0206718 3300048927 Bacteria 1488
273 Ga0496125_0120914 3300048928 Bacteria 1868
274 Ga0496126_0008644 3300048929 Bacteria 10943
275 Ga0501031_0249284 3300049568 Bacteria 1154
276 Ga0501031_0405638 3300049568 Bacteria 881
277 Ga0501032_0330301 3300049569 Bacteria 983
278 Ga0501033_0009774 3300049570 Bacteria 7368
279 Ga0501033_0041050 3300049570 Bacteria 3453
280 Ga0501034_0001361 3300049571 Bacteria 33010
281 Ga0501036_0023608 3300049572 Bacteria 5182
282 Ga0501036_0265595 3300049572 Bacteria 1437
283 Ga0501036_0387873 3300049572 Bacteria 1165
284 Ga0501037_0027866 3300049573 Bacteria 4174
285 Ga0501037_0106339 3300049573 Bacteria 2022
286 Ga0501037_0202870 3300049573 Bacteria 1401
287 Ga0501037_0404805 3300049573 Bacteria 935
288 Ga0501038_0101324 3300049574 Bacteria 2397
289 Ga0501038_0117049 3300049574 Bacteria 2202
290 Ga0501039_0004241 3300049575 Bacteria 10794
291 Ga0501039_0014248 3300049575 Bacteria 6087
292 Ga0501039_0077094 3300049575 Bacteria 2592
293 Ga0501040_0003366 3300049576 Bacteria 10322
294 Ga0501040_0015835 3300049576 Bacteria 4983
295 Ga0501040_0019197 3300049576 Bacteria 4546
296 Ga0501040_0035729 3300049576 Bacteria 3371
297 Ga0501041_0009458 3300049577 Bacteria 5745
298 Ga0501041_0025091 3300049577 Bacteria 3582
299 Ga0501042_0002799 3300049578 Bacteria 10790
300 Ga0501042_0013662 3300049578 Bacteria 5529
301 Ga0501043_0016325 3300049579 Bacteria 5824
302 Ga0501043_0225279 3300049579 Bacteria 1449
303 Ga0501046_0025949 3300049580 Bacteria 4789
304 Ga0501046_0036991 3300049580 Bacteria 3924
305 Ga0501048_0019730 3300049582 Bacteria 4944
306 Ga0501048_0032218 3300049582 Bacteria 3788
307 Ga0501048_0047950 3300049582 Bacteria 3047
308 Ga0501067_0006043 3300049583 Bacteria 6713
309 Ga0501067_0020299 3300049583 Bacteria 3677
310 Ga0501068_0001018 3300049584 Bacteria 14781
311 Ga0501068_0026834 3300049584 Bacteria 3397
312 Ga0501068_0088904 3300049584 Bacteria 1903
313 Ga0501069_0057922 3300049585 Bacteria 2161
314 Ga0501069_0057937 3300049585 Bacteria 2160
315 Ga0501070_0000447 3300049586 Bacteria 37526
316 Ga0501070_0325384 3300049586 Bacteria 1250
317 Ga0501071_0009180 3300049587 Bacteria 6574
318 Ga0501071_0021745 3300049587 Bacteria 4471
319 Ga0501071_0050262 3300049587 Bacteria 3003
320 Ga0501071_0051657 3300049587 Bacteria 2963
321 Ga0501072_0001180 3300049588 Bacteria 19448
322 Ga0501072_0001814 3300049588 Bacteria 15906
323 Ga0501072_0007713 3300049588 Bacteria 8170
324 Ga0501072_0252394 3300049588 Bacteria 1404
325 Ga0501073_0001342 3300049589 Bacteria 18136
326 Ga0501073_0003330 3300049589 Bacteria 12077
327 Ga0501074_0002155 3300049590 Bacteria 13625
328 Ga0501074_0278448 3300049590 Bacteria 1189
329 Ga0501074_0310437 3300049590 Bacteria 1120
330 Ga0501075_0019726 3300049591 Bacteria 4895
331 Ga0501075_0028157 3300049591 Bacteria 4145
332 Ga0501075_0075402 3300049591 Bacteria 2550
333 Ga0501076_0008376 3300049592 Bacteria 7577
334 Ga0501076_0011867 3300049592 Bacteria 6505
335 Ga0501077_0002970 3300049593 Bacteria 10172
336 Ga0501077_0108758 3300049593 Bacteria 1756
337 Ga0501077_0142268 3300049593 Bacteria 1521
338 Ga0501079_0045017 3300049741 Bacteria 3406
339 Ga0501079_0068862 3300049741 Bacteria 2731
340 Ga0501079_0126940 3300049741 Bacteria 1984
341 Ga0501079_0166445 3300049741 Bacteria 1719
342 Ga0501080_0096576 3300049742 Bacteria 2743
343 Ga0501080_0174000 3300049742 Bacteria 1984
344 Ga0501080_0317740 3300049742 Bacteria 1410
345 Ga0501080_0481198 3300049742 Bacteria 1111
346 Ga0501081_0018874 3300049743 Bacteria 4582
347 Ga0501081_0084327 3300049743 Bacteria 2228
348 Ga0501081_0132899 3300049743 Bacteria 1779
349 Ga0501083_0003078 3300049744 Bacteria 11594
350 Ga0501083_0007281 3300049744 Bacteria 7847
351 Ga0501083_0128633 3300049744 Bacteria 1660
352 Ga0501083_0255118 3300049744 Bacteria 1141
353 Ga0501035_0160131 3300049822 Bacteria 1949
354 Ga0501045_0015669 3300049824 Bacteria 5378
355 Ga0501045_0039451 3300049824 Bacteria 3436
356 Ga0501045_0048272 3300049824 Bacteria 3103
357 Ga0501045_0054130 3300049824 Bacteria 2933
358 nmdc:mga03683_27622_c1 3300050489 Bacteria 2249
359 nmdc:mga03n38_29616_c1 3300050490 Bacteria 2293
360 nmdc:mga00v17_1052_c1 3300050491 Bacteria 14588
361 nmdc:mga0yw44_189799_c1 3300050492 Bacteria 1355
362 nmdc:mga04h51_166324_c1 3300050495 Bacteria 851
363 nmdc:mga05p37_119102_c1 3300050507 Bacteria 3244
364 nmdc:mga05p37_356266_c1 3300050507 Bacteria 1722
365 nmdc:mga05p37_433678_c1 3300050507 Bacteria 1526
366 nmdc:mga05p37_5221_c1 3300050507 Bacteria 15245
367 nmdc:mga05p37_628777_c1 3300050507 Bacteria 1207
368 nmdc:mga09592_126620_c1 3300050508 Bacteria 2196
369 nmdc:mga09592_185142_c1 3300050508 Bacteria 1802
370 nmdc:mga09592_393382_c1 3300050508 Bacteria 1198
371 nmdc:mga09592_52283_c1 3300050508 Bacteria 3448
372 nmdc:mga09592_54931_c1 3300050508 Bacteria 3365
373 nmdc:mga0qj67_117031_c1 3300050509 Bacteria 2154
374 nmdc:mga0qj67_267788_c1 3300050509 Bacteria 1386
375 nmdc:mga0qj67_30628_c1 3300050509 Bacteria 4189
376 nmdc:mga0qj67_333930_c1 3300050509 Bacteria 1226
377 nmdc:mga0qj67_344577_c1 3300050509 Bacteria 1205
378 nmdc:mga06r32_44007_c1 3300050510 Bacteria 4250
379 nmdc:mga06r32_448450_c1 3300050510 Bacteria 1270
380 nmdc:mga06r32_4819_c1 3300050510 Bacteria 12147
381 nmdc:mga06r32_49229_c1 3300050510 Bacteria 4030
382 nmdc:mga06r32_58220_c1 3300050510 Bacteria 3714
383 nmdc:mga06r32_815912_c1 3300050510 Bacteria 893
384 nmdc:mga06r32_8394_c1 3300050510 Bacteria 9305
385 nmdc:mga08y16_122100_c1 3300050511 Bacteria 2711
386 nmdc:mga08y16_183202_c1 3300050511 Bacteria 2174
387 nmdc:mga08y16_4043_c1 3300050511 Bacteria 15303
388 nmdc:mga08x19_5135_c1 3300050514 Bacteria 7743
389 nmdc:mga0a205_554235_c1 3300050515 Bacteria 1004
390 nmdc:mga0a205_95700_c1 3300050515 Bacteria 2868
391 nmdc:mga0sz30_12077_c1 3300050516 Bacteria 3352
392 Ga0495601_0094717 3300053077 Bacteria 1925
393 Ga0500568_0000069 3300053139 Bacteria 99921
394 Ga0501084_0001293 3300054114 Bacteria 19714
395 Ga0501084_0002105 3300054114 Bacteria 15903
396 Ga0501084_0086784 3300054114 Bacteria 2627
397 Ga0590075_009932 3300059424 Bacteria 2286
398 Ga0501082_0001063 3300060353 Bacteria 24341
399 Ga0501082_0174247 3300060353 Bacteria 1870
400 Ga0501082_0206430 3300060353 Bacteria 1709
401 Ga0501082_0932287 3300060353 Bacteria 759
402 Ga0530510_0001087 3300061734 Bacteria 18017
403 Ga0530510_0004970 3300061734 Bacteria 9184
404 Ga0530510_0011810 3300061734 Bacteria 6127
405 2849145164 2849139964 Bacteria 5613304
406 Ga0466958_0241182
407 JGI25407J50210_10012965
408 JGI25407J50210_10017799
409 Ga0070658_10001032
410 Ga0070680_100194655
411 Ga0070660_100079675
412 Ga0070692_10013269
413 Ga0070669_100001133
414 Ga0070671_100179314
415 Ga0070659_100002183
416 Ga0070667_100000022
417 Ga0070667_100335724
418 Ga0070709_10024821
419 Ga0070714_100035080
420 Ga0070714_100130294
421 Ga0070713_100121223
422 Ga0070705_100007233
423 Ga0070694_100047663
424 Ga0070708_100113495
425 Ga0070678_100464687
426 Ga0070681_10000019
427 Ga0070681_10008548
428 Ga0070681_10015395
429 Ga0070681_10070741
430 Ga0070681_10386581
431 Ga0070706_100136260
432 Ga0070706_100169533
433 Ga0070707_100103188
434 Ga0070707_100377845
435 Ga0070698_100412784
436 Ga0070679_100001348
437 Ga0070679_100065701
438 Ga0070679_100271570
439 Ga0070684_100020531
440 Ga0070684_100033459
441 Ga0070697_100032659
442 Ga0070697_100121336
443 Ga0070697_100476424
444 Ga0070695_100015565
445 Ga0070665_100006159
446 Ga0070704_100056256
447 Ga0070704_100071530
448 Ga0068855_100146931
449 Ga0070664_100734796
450 Ga0068859_100001056
451 Ga0068859_100113971
452 Ga0068864_100059998
453 Ga0068866_10077022
454 Ga0068863_100028280
455 Ga0068858_100009263
456 Ga0068858_100026390
457 Ga0068860_100000038
458 Ga0068860_100640387
459 Ga0068862_100000049
460 Ga0068862_100000064
461 Ga0081455_10004343
462 Ga0081455_10012557
463 Ga0081455_10043820
464 Ga0081455_10104332
465 Ga0081538_10000109
466 Ga0081538_10042234
467 Ga0081538_10067972
468 Ga0075365_10284796
469 Ga0075364_10005343
470 Ga0075362_10018644
471 Ga0075369_10093526
472 Ga0075428_100000500
473 Ga0075428_100006012
474 Ga0075428_100009360
475 Ga0075428_100033850
476 Ga0075428_100597352
477 Ga0075428_100771685
478 Ga0075428_100783538
479 Ga0075430_100002198
480 Ga0075430_100051482
481 Ga0075430_100066596
482 Ga0075430_100090563
483 Ga0075430_100217242
484 Ga0075431_100020222
485 Ga0075431_100035382
486 Ga0075431_100071264
487 Ga0075431_100139200
488 Ga0075431_100305870
489 Ga0075434_100043412
490 Ga0075429_100004769
491 Ga0075429_100052129
492 Ga0075436_100000868
493 Ga0075436_100040447
494 Ga0075436_100153961
495 Ga0075436_100240307
496 Ga0097620_100000287
497 Ga0097620_100001056
498 Ga0097620_100113975
499 Ga0075435_100225506
500 Ga0105250_10103229
501 Ga0111539_10004584
502 Ga0111539_10034409
503 Ga0111539_10175638
504 Ga0105247_10000021
505 Ga0114129_10009120
506 Ga0114129_10133579
507 Ga0114129_10136917
508 Ga0114129_10312318
509 Ga0114129_10401881
510 Ga0114129_10513934
511 Ga0114129_10726457
512 Ga0114129_10825141
513 Ga0105242_10093262
514 Ga0105248_10000141
515 Ga0105248_10041596
516 Ga0105237_10121433
517 Ga0105249_10000060
518 Ga0105249_10410454
519 Ga0099796_10013689
520 Ga0105239_10637881
521 Ga0157373_10215867
522 Ga0157371_10010508
523 Ga0157369_10104711
524 Ga0157369_10164578
525 Ga0157378_10039872
526 Ga0157372_10939712
527 Ga0163163_10020998
528 Ga0163163_10021192
529 Ga0163163_10078312
530 Ga0157380_10914413
531 Ga0157379_10395623
532 Ga0197907_10054443
533 Ga0206356_10320441
534 Ga0206356_11555394
535 Ga0206349_1727302
536 Ga0206350_10254393
537 Ga0206353_10952777
538 Ga0206353_11468371
539 Ga0206353_11779372
540 Ga0154015_1263663
541 Ga0213873_10032907
542 Ga0213871_10012324
543 Ga0224712_10073238
544 Ga0224712_10082644
545 Ga0207692_10067154
546 Ga0207710_10000027
547 Ga0207699_10091629
548 Ga0207705_10000514
549 Ga0207684_10098607
550 Ga0207707_10000046
551 Ga0207707_10013135
552 Ga0207707_10053686
553 Ga0207707_10106928
554 Ga0207671_10059052
555 Ga0207693_10046600
556 Ga0207660_10002877
557 Ga0207660_10140231
558 Ga0207660_10196129
559 Ga0207657_10059939
560 Ga0207657_10313844
561 Ga0207652_10007855
562 Ga0207652_10078671
563 Ga0207652_10135959
564 Ga0207652_10534001
565 Ga0207646_10141995
566 Ga0207646_10611381
567 Ga0207681_10001434
568 Ga0207700_10114626
569 Ga0207664_10003623
570 Ga0207664_10153693
571 Ga0207644_10142120
572 Ga0207690_10000089
573 Ga0207704_10258655
574 Ga0207711_10000311
575 Ga0207711_10106637
576 Ga0207689_10067979
577 Ga0207661_10063787
578 Ga0207661_10789608
579 Ga0207667_10096460
580 Ga0207712_10000051
581 Ga0207712_10003259
582 Ga0207658_10000070
583 Ga0207703_10046572
584 Ga0207703_10180275
585 Ga0207703_10338042
586 Ga0207702_10922897
587 Ga0207641_10022250
588 Ga0207676_10047382
589 Ga0207683_10080169
590 Ga0209588_1010934
591 Ga0209813_10141131
592 Ga0207428_10027537
593 Ga0207428_10050287
594 Ga0207428_10342643
595 Ga0268266_10005067
596 Ga0268265_10000017
597 Ga0268265_10000028
598 Ga0268264_10000092
599 Ga0268264_10154537
600 Ga0268264_10232151
601 Ga0265327_10000171
602 Ga0373926_0009912
603 Ga0373934_0123868
604 Ga0373945_0058519
605 Ga0373935_0031242
606 Ga0373927_0000406
607 Ga0373947_0004885
608 Ga0373937_0633579
609 Ga0373925_0000820
610 Ga0373925_0584493
611 Ga0395900_0066609
612 Ga0395898_0069727
613 Ga0395901_0394401
614 Ga0436365_0045799
615 Ga0436360_0843420
616 Ga0436363_1126501
617 Ga0436362_0153351
618 Ga0436362_1303522
619 Ga0451787_815825
620 Ga0439448_0052680
621 Ga0439450_008303
622 Ga0439454_000922
623 Ga0439446_0067446
624 Ga0439434_0010210
625 Ga0439434_0096911
626 Ga0439444_0026280
627 Ga0439464_0000279
628 Ga0439460_0005880
629 Ga0439440_0000974
630 Ga0466961_0224229
631 Ga0466964_0157370
632 Ga0466968_0015630
633 Ga0466970_0277126
634 Ga0466959_0064538
635 Ga0466959_0075156
636 Ga0466958_0048833
637 Ga0466967_0182136
638 Ga0466967_0755754
639 Ga0495629_0189918
640 Ga0495641_0029647
641 Ga0495641_0033913
642 Ga0495651_0042304
643 Ga0495580_0001960
644 Ga0495582_0000232
645 Ga0495582_0048863
646 Ga0495628_0048584
647 Ga0495630_0033703
648 Ga0495666_0172232
649 Ga0495665_0140517
650 Ga0495640_0032175
651 Ga0495640_0078193
652 Ga0495586_0039401
653 Ga0495667_0139706
654 Ga0495634_0036618
655 Ga0495658_0008617
656 Ga0495658_0019570
657 Ga0495613_0000311
658 Ga0495674_0181627
659 Ga0495676_0088196
660 Ga0495675_0053608
661 Ga0495684_0036856
662 Ga0495593_0005089
663 Ga0495602_0032181
664 Ga0496100_0011210
665 Ga0496101_0024966
666 Ga0496101_0267706
667 Ga0496102_0000833
668 Ga0496106_0383831
669 Ga0496108_0048768
670 Ga0496112_0102940
671 Ga0496115_0352591
672 Ga0496117_0001027
673 Ga0496118_0002605
674 Ga0496119_0004219
675 Ga0496120_0056289
676 Ga0496121_0009709
677 Ga0496124_0206718
678 Ga0496125_0120914
679 Ga0496126_0008644
680 Ga0501031_0249284
681 Ga0501031_0405638
682 Ga0501032_0330301
683 Ga0501033_0009774
684 Ga0501033_0041050
685 Ga0501034_0001361
686 Ga0501036_0023608
687 Ga0501036_0265595
688 Ga0501036_0387873
689 Ga0501037_0027866
690 Ga0501037_0106339
691 Ga0501037_0202870
692 Ga0501037_0404805
693 Ga0501038_0101324
694 Ga0501038_0117049
695 Ga0501039_0004241
696 Ga0501039_0014248
697 Ga0501039_0077094
698 Ga0501040_0003366
699 Ga0501040_0015835
700 Ga0501040_0019197
701 Ga0501040_0035729
702 Ga0501041_0009458
703 Ga0501041_0025091
704 Ga0501042_0002799
705 Ga0501042_0013662
706 Ga0501043_0016325
707 Ga0501043_0225279
708 Ga0501046_0025949
709 Ga0501046_0036991
710 Ga0501048_0019730
711 Ga0501048_0032218
712 Ga0501048_0047950
713 Ga0501067_0006043
714 Ga0501067_0020299
715 Ga0501068_0001018
716 Ga0501068_0026834
717 Ga0501068_0088904
718 Ga0501069_0057922
719 Ga0501069_0057937
720 Ga0501070_0000447
721 Ga0501070_0325384
722 Ga0501071_0009180
723 Ga0501071_0021745
724 Ga0501071_0050262
725 Ga0501071_0051657
726 Ga0501072_0001180
727 Ga0501072_0001814
728 Ga0501072_0007713
729 Ga0501072_0252394
730 Ga0501073_0001342
731 Ga0501073_0003330
732 Ga0501074_0002155
733 Ga0501074_0278448
734 Ga0501074_0310437
735 Ga0501075_0019726
736 Ga0501075_0028157
737 Ga0501075_0075402
738 Ga0501076_0008376
739 Ga0501076_0011867
740 Ga0501077_0002970
741 Ga0501077_0108758
742 Ga0501077_0142268
743 Ga0501079_0045017
744 Ga0501079_0068862
745 Ga0501079_0126940
746 Ga0501079_0166445
747 Ga0501080_0096576
748 Ga0501080_0174000
749 Ga0501080_0317740
750 Ga0501080_0481198
751 Ga0501081_0018874
752 Ga0501081_0084327
753 Ga0501081_0132899
754 Ga0501083_0003078
755 Ga0501083_0007281
756 Ga0501083_0128633
757 Ga0501083_0255118
758 Ga0501035_0160131
759 Ga0501045_0015669
760 Ga0501045_0039451
761 Ga0501045_0048272
762 Ga0501045_0054130
763 nmdc:mga03683_27622_c1
764 nmdc:mga03n38_29616_c1
765 nmdc:mga00v17_1052_c1
766 nmdc:mga0yw44_189799_c1
767 nmdc:mga04h51_166324_c1
768 nmdc:mga05p37_119102_c1
769 nmdc:mga05p37_356266_c1
770 nmdc:mga05p37_433678_c1
771 nmdc:mga05p37_5221_c1
772 nmdc:mga05p37_628777_c1
773 nmdc:mga09592_126620_c1
774 nmdc:mga09592_185142_c1
775 nmdc:mga09592_393382_c1
776 nmdc:mga09592_52283_c1
777 nmdc:mga09592_54931_c1
778 nmdc:mga0qj67_117031_c1
779 nmdc:mga0qj67_267788_c1
780 nmdc:mga0qj67_30628_c1
781 nmdc:mga0qj67_333930_c1
782 nmdc:mga0qj67_344577_c1
783 nmdc:mga06r32_44007_c1
784 nmdc:mga06r32_448450_c1
785 nmdc:mga06r32_4819_c1
786 nmdc:mga06r32_49229_c1
787 nmdc:mga06r32_58220_c1
788 nmdc:mga06r32_815912_c1
789 nmdc:mga06r32_8394_c1
790 nmdc:mga08y16_122100_c1
791 nmdc:mga08y16_183202_c1
792 nmdc:mga08y16_4043_c1
793 nmdc:mga08x19_5135_c1
794 nmdc:mga0a205_554235_c1
795 nmdc:mga0a205_95700_c1
796 nmdc:mga0sz30_12077_c1
797 Ga0495601_0094717
798 Ga0500568_0000069
799 Ga0501084_0001293
800 Ga0501084_0002105
801 Ga0501084_0086784
802 Ga0590075_009932
803 Ga0501082_0001063
804 Ga0501082_0174247
805 Ga0501082_0206430
806 Ga0501082_0932287
807 Ga0530510_0001087
808 Ga0530510_0004970
809 Ga0530510_0011810
810 2849145164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

24

196

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xxf-assembly1.cif.gz_A l-fuculose 1-phosphate aldolase from glaciozyma antarctica pi12 0.9424 8 251
3ocr-assembly1.cif.gz_A crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.924 19 251
3ocr-assembly2.cif.gz_B crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.9162 19 251
4xxf-assembly1.cif.gz_A l-fuculose 1-phosphate aldolase from glaciozyma antarctica pi12 0.9092 8 251
8iai-assembly1.cif.gz_3 structure of mammalian spectrin-actin junctional complex of membrane skeleton, state ii, global map 0.8898 22 213
ID Description Score Start End Superfamily
af_A0A1D8PNQ3_32_284_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9711 5 248 3.40.225.10
4xxfA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9424 8 251 3.40.225.10
af_A0A1D8PNQ3_32_284_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9408 5 248 3.40.225.10
3ocrB00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9119 19 251 3.40.225.10
4xxfA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9092 8 251 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A261KVF3-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.9981 98 251 GO:0005856
GO:0051015
AF-A0A2E6KPY8-F1-model_v4 Class II aldolase/adducin family protein 0.9936 8 251 GO:0005856
GO:0005996
GO:0051015
AF-A0A7R6Y5B0-F1-model_v4 deleted 0.9929 10 251
AF-A0A211ZMK2-F1-model_v4 Class II aldolase/adducin family protein 0.992 8 251 GO:0005856
GO:0051015
AF-A0A3B8R5C9-F1-model_v4 Class II aldolase/adducin family protein 0.992 10 249 GO:0005856
GO:0005996
GO:0051015

Map